DOCSLIB.ORG

Cwc15 (NM 023153) Mouse Tagged ORF Clone Product Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Cwc15 (NM 023153) Mouse Tagged ORF Clone Product Data OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG202744 Cwc15 (NM_023153) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Cwc15 (NM_023153) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Cwc15 Synonyms: 0610040D20Rik; 2900052N06Rik; c11orf5; Ed1; mED1 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG202744 representing NM_023153 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAACAGCAGCCAGGCCAACTTTTGAACCTGCAAGAGGTGGGAGAGGAAAAGGAGAAGGGGATTTGA GCCAGCTCTCCAAGCAGTATTCAAGCAGAGATCTTCCCTCTCATACAAAGATAAAGTACAGACAAACCAC ACAGGATGCCCCTGAAGAGGTTCGAAACCGTGACTTCAGGAGAGAACTGGAAGAGAGAGAGAGAGCTGCT GCAAGGGACAAAAACAGGGACCGCCCAACTCGAGAGCATACAACTTCCTCTTCAGTGTCAAAGAAGCCCC GCTTAGACCAGATTCCTGCTGCCAACCTTGATGCTGACGATCCTCTCACAGACGAGGAAGATGAAGATTT TGAAGAGGAGAGCGATGACGATGATACTGCAGCTCTTCTCGCAGAGCTAGAAAAGATCAAGAAGGAAAGA GCTGAAGAGCAGGCCAGGAAGGAACAAGAACAAAAAGCAGAGGAAGAGAGAATTCGCATGGAAAACATTC TGAGTGGAAACCCTCTCCTAAACCTCACTGGCCCGTCCCAGCCTCAGGCCAACTTCAAGGTTAAAAGAAG ATGGGATGATGATGTCGTTTTTAAGAACTGTGCAAAAGGTATAGATGACCAGAAGAAAGACAAACGATTT GTAAATGATACACTGCGATCTGAATTTCACAAGAAGTTCATGGAGAAATATATTAAG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >MG202744 representing NM_023153 Red=Cloning site Green=Tags(s) MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAA ARDKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKER AEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGIDDQKKDKRF VNDTLRSEFHKKFMEKYIK TRTRPLE - GFP Tag - V This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Cwc15 (NM_023153) Mouse Tagged ORF Clone – MG202744 Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_023153 ORF Size: 687 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Cwc15 (NM_023153) Mouse Tagged ORF Clone – MG202744 RefSeq: NM_023153.3, NP_075642.1 RefSeq Size: 1152 bp RefSeq ORF: 690 bp Locus ID: 66070 UniProt ID: Q9JHS9 Gene Summary: Involved in pre-mRNA splicing as component of the spliceosome. Component of the PRP19- CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing.[UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • Analysis of Gene Expression Data for Gene Ontology
    ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION A Thesis Presented to The Graduate Faculty of The University of Akron In Partial Fulfillment of the Requirements for the Degree Master of Science Robert Daniel Macholan May 2011 ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION Robert Daniel Macholan Thesis Approved: Accepted: _______________________________ _______________________________ Advisor Department Chair Dr. Zhong-Hui Duan Dr. Chien-Chung Chan _______________________________ _______________________________ Committee Member Dean of the College Dr. Chien-Chung Chan Dr. Chand K. Midha _______________________________ _______________________________ Committee Member Dean of the Graduate School Dr. Yingcai Xiao Dr. George R. Newkome _______________________________ Date ii ABSTRACT A tremendous increase in genomic data has encouraged biologists to turn to bioinformatics in order to assist in its interpretation and processing. One of the present challenges that need to be overcome in order to understand this data more completely is the development of a reliable method to accurately predict the function of a protein from its genomic information. This study focuses on developing an effective algorithm for protein function prediction. The algorithm is based on proteins that have similar expression patterns. The similarity of the expression data is determined using a novel measure, the slope matrix. The slope matrix introduces a normalized method for the comparison of expression levels throughout a proteome. The algorithm is tested using real microarray gene expression data. Their functions are characterized using gene ontology annotations. The results of the case study indicate the protein function prediction algorithm developed is comparable to the prediction algorithms that are based on the annotations of homologous proteins.
    [Show full text]
  • Datasheet Blank Template
    SAN TA C RUZ BI OTEC HNOL OG Y, INC . CWC15 (C-8): sc-514479 BACKGROUND APPLICATIONS CWC15 (CWC15 spliceosome-associated protein), also known as ORF5, Cwf15, CWC15 (C-8) is recommended for detection of CWC15 of mouse, rat and C11orf5 or HSPC14, is a 229 amino acid protein involved in pre-mRNA splicing. human origin by Western Blotting (starting dilution 1:100, dilution range The gene encoding CWC15 maps to human chromosome 11q21. With approx - 1:100- 1:1000), immunoprecipitation [1-2 µg per 100-500 µg of total protein imately 135 million base pairs and 1,400 genes, chromosome 11 makes up (1 ml of cell lysate)], immunofluorescence (starting dilution 1:50, dilution around 4% of human genomic DNA and is considered a gene and disease as- range 1:50- 1:500) and solid phase ELISA (starting dilution 1:30, dilution sociation dense chromosome. The chromosome 11 encoded Atm gene is impor - range 1:30-1:3000). tant for regulation of cell cycle arrest and apoptosis following double strand Suitable for use as control antibody for CWC15 siRNA (h): sc-97055, CWC15 DNA breaks. Atm mutation leads to the disorder known as ataxia-telang iecta - siRNA (m): sc-142639, CWC15 shRNA Plasmid (h): sc-97055-SH, CWC15 sia. The blood disorders sickle cell anemia and thalassemia are caused by β shRNA Plasmid (m): sc-142639-SH, CWC15 shRNA (h) Lentiviral Particles: HBB gene mutations. Wilms’ tumors, WAGR syndrome and Denys-Drash syn - sc- 97055-V and CWC15 shRNA (m) Lentiviral Particles: sc-142639-V. drome are associated with mutations of the WT1 gene.
    [Show full text]
  • A Genome-Wide Scan for Candidate Lethal Variants in Thoroughbred Horses
    bioRxiv preprint doi: https://doi.org/10.1101/2020.05.04.077008; this version posted May 4, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. A genome-wide scan for candidate lethal variants in Thoroughbred horses. Evelyn T. Todd1*, Peter C. Thomson1, Natasha A. Hamilton2, Rachel A. Ang1, Gabriella Lindgren3,4, Åsa Viklund3, Susanne Eriksson3, Sofia Mikko3, Eric Strand5 and Brandon D. Velie1. 1 School of Life and Environmental Sciences, The University of Sydney, NSW 2006, Australia. 2 Racing Australia Equine Genetics Research Centre, Racing Australia, NSW 2000, Australia. 3Department of Animal Breeding and Genetics, Swedish University of Agricultural Sciences, Uppsala, Sweden. 4Livestock Genetics, Department of Biosystems, KU Leuven, Leuven, Belgium. 5Department of Companion Animal Clinical Sciences, Faculty of Veterinary Medicine, Norwegian University of Life Sciences, Oslo, Norway. *Correspondence and requests for materials should be addressed to Evelyn T. Todd (email: [email protected]) 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.05.04.077008; this version posted May 4, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Abstract 2 Recessive lethal variants often segregate at low frequencies in animal populations, such that two 3 randomly selected individuals are unlikely to carry the same mutation.
    [Show full text]
  • Proteomics Provides Insights Into the Inhibition of Chinese Hamster V79
    www.nature.com/scientificreports OPEN Proteomics provides insights into the inhibition of Chinese hamster V79 cell proliferation in the deep underground environment Jifeng Liu1,2, Tengfei Ma1,2, Mingzhong Gao3, Yilin Liu4, Jun Liu1, Shichao Wang2, Yike Xie2, Ling Wang2, Juan Cheng2, Shixi Liu1*, Jian Zou1,2*, Jiang Wu2, Weimin Li2 & Heping Xie2,3,5 As resources in the shallow depths of the earth exhausted, people will spend extended periods of time in the deep underground space. However, little is known about the deep underground environment afecting the health of organisms. Hence, we established both deep underground laboratory (DUGL) and above ground laboratory (AGL) to investigate the efect of environmental factors on organisms. Six environmental parameters were monitored in the DUGL and AGL. Growth curves were recorded and tandem mass tag (TMT) proteomics analysis were performed to explore the proliferative ability and diferentially abundant proteins (DAPs) in V79 cells (a cell line widely used in biological study in DUGLs) cultured in the DUGL and AGL. Parallel Reaction Monitoring was conducted to verify the TMT results. γ ray dose rate showed the most detectable diference between the two laboratories, whereby γ ray dose rate was signifcantly lower in the DUGL compared to the AGL. V79 cell proliferation was slower in the DUGL. Quantitative proteomics detected 980 DAPs (absolute fold change ≥ 1.2, p < 0.05) between V79 cells cultured in the DUGL and AGL. Of these, 576 proteins were up-regulated and 404 proteins were down-regulated in V79 cells cultured in the DUGL. KEGG pathway analysis revealed that seven pathways (e.g.
    [Show full text]
  • Endoglin Protein Interactome Profiling Identifies TRIM21 and Galectin-3 As
    cells Article Endoglin Protein Interactome Profiling Identifies TRIM21 and Galectin-3 as New Binding Partners 1, 1, 2, Eunate Gallardo-Vara y, Lidia Ruiz-Llorente y, Juan Casado-Vela y , 3 4 5 6, , María J. Ruiz-Rodríguez , Natalia López-Andrés , Asit K. Pattnaik , Miguel Quintanilla z * 1, , and Carmelo Bernabeu z * 1 Centro de Investigaciones Biológicas, Consejo Superior de Investigaciones Científicas (CSIC), and Centro de Investigación Biomédica en Red de Enfermedades Raras (CIBERER), 28040 Madrid, Spain; [email protected] (E.G.-V.); [email protected] (L.R.-L.) 2 Bioengineering and Aerospace Engineering Department, Universidad Carlos III and Centro de Investigación Biomédica en Red Enfermedades Neurodegenerativas (CIBERNED), Leganés, 28911 Madrid, Spain; [email protected] 3 Centro Nacional de Investigaciones Cardiovasculares (CNIC), 28029 Madrid, Spain; [email protected] 4 Cardiovascular Translational Research, Navarrabiomed, Complejo Hospitalario de Navarra (CHN), Universidad Pública de Navarra (UPNA), IdiSNA, 31008 Pamplona, Spain; [email protected] 5 School of Veterinary Medicine and Biomedical Sciences, and Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583, USA; [email protected] 6 Instituto de Investigaciones Biomédicas “Alberto Sols”, Consejo Superior de Investigaciones Científicas (CSIC), and Departamento de Bioquímica, Universidad Autónoma de Madrid (UAM), 28029 Madrid, Spain * Correspondence: [email protected] (M.Q.); [email protected] (C.B.) These authors contributed equally to this work. y Equal senior contribution. z Received: 7 August 2019; Accepted: 7 September 2019; Published: 13 September 2019 Abstract: Endoglin is a 180-kDa glycoprotein receptor primarily expressed by the vascular endothelium and involved in cardiovascular disease and cancer.
    [Show full text]
  • WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T (51) International Patent Classification: David [US/US]; 13539 N . 95th Way, Scottsdale, AZ C12Q 1/68 (2006.01) 85260 (US). (21) International Application Number: (74) Agent: AKHAVAN, Ramin; Caris Science, Inc., 6655 N . PCT/US20 12/0425 19 Macarthur Blvd., Irving, TX 75039 (US). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 14 June 2012 (14.06.2012) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, English (25) Filing Language: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, Publication Language: English DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, (30) Priority Data: KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, 61/497,895 16 June 201 1 (16.06.201 1) US MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, 61/499,138 20 June 201 1 (20.06.201 1) US OM, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SC, SD, 61/501,680 27 June 201 1 (27.06.201 1) u s SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, 61/506,019 8 July 201 1(08.07.201 1) u s TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW.
    [Show full text]
  • Proceedings, 10Th World Congress of Genetics Applied to Livestock Production Genomic Regions Affecting Cheese Making Properties
    Proceedings, 10th World Congress of Genetics Applied to Livestock Production Genomic Regions Affecting Cheese Making Properties Identified in Danish Holsteins V. R. Gregersen*, H. P. Bertelsen*, N. Poulsen†, L. B. Larsen†, F. Gustavsson‡, M. Glantz‡, M. Paulsson‡, A. J. Buitenhuis* and C. Bendixen* *Aarhus University, Molecular Biology and Genetics, Tjele, Denmark, †Aarhus University, Food Science, Tjele, Denmark, ‡Lund University, Food Technology, Engineering and Nutrition, Lund, Sweden ABSTRACT: The cheese renneting process is affected by a situated at 20 different farms in Denmark as described in number of factors associated to milk composition and a Poulsen et al. (2012). All cows were housed in loose number of Danish Holsteins has previously been identified housing systems, fed according to standard practices, and to have poor milk coagulation ability. Therefore, the aim of milked two or, rarely, three times daily. Parity, lactation this study was to identify genomic regions affecting the stage and milk yield were recorded for all cows. Somatic technological properties (rennet coagulation time (RCT) cell count (SCC) were identified by the Fossomatic 5000 and curd firming rate (CFR)). Markers were genotyped in (Foss electric) at the Eurofins Laboratory in Holstebro, 373 Holstein cows using the bovine HD beadchip (Illumina Denmark. A total of 37 milk samples were discarded due to Inc.). Two regions were identified for RCT explaining 6.1% high Somatic cell count (SCC > 500.000 per ml). Milk pH and 7.8% of the phenotypic variation, respectively, and five was measured in skimmed milk samples, prior to regions were found for CFR explaining between 5.1% and coagulation, with a PHM 220 pH meter (RadioMeter, 7.6% of the variation.
    [Show full text]
  • Elucidation of Dose-Dependent Transcriptional Events Immediately Following Ionizing Radiation Exposure
    bioRxiv preprint doi: https://doi.org/10.1101/207951; this version posted October 23, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 2 3 4 Elucidation of dose-dependent transcriptional events immediately following 5 ionizing radiation exposure 6 7 Eric C. Rouchka1,2,*, Robert M. Flight3, Brigitte H. Fasciotto4, Rosendo Estrada5, John W. 8 Eaton6,7,8, Phani K. Patibandla5, Sabine J. Waigel8, Dazhuo Li1, John K. Kirtley1, Palaniappan 9 Sethu9,10, and Robert S. Keynton5 10 11 1Department of Computer Engineering and Computer Science, University of Louisville, 12 Louisville, Kentucky, United States of America 13 14 2Kentucky Biomedical Research Infrastructure Network Bioinformatics Core, University of 15 Louisville, Louisville, Kentucky, United States of America 16 17 3Department of Molecular and Cellular Biochemistry, University of Kentucky, Lexington, 18 Kentucky, United States of America 19 20 4The ElectroOptics Research Institute and Nanotechnology Center, University of Louisville, 21 Louisville, Kentucky, United States of America 22 23 5Department of Bioengineering, University of Louisville, Louisville, Kentucky, United States of 24 America 25 26 6Department of Medicine, University of Louisville, Louisville, Kentucky, United States of 27 America 28 29 7Department of Pharmacology and Toxicology, University of Louisville, Louisville, Kentucky, 30 United States of America 31 32 8James Graham Brown Cancer Center, University of Louisville, Louisville, Kentucky, United 33 States of America 34 35 9Division of Cardiovascular Disease, Department of Medicine, University of Alabama at 36 Birmingham, Birmingham, Alabama, United States of America 37 38 10Department of Biomedical Engineering, University of Alabama at Birmingham, Birmingham, 39 Alabama, United States of America 1 bioRxiv preprint doi: https://doi.org/10.1101/207951; this version posted October 23, 2017.
    [Show full text]
  • Global Chromatin Changes Resulting from Single-Gene Inactivation—The Role of SMARCB1 in Malignant Rhabdoid Tumor
    cancers Article Global Chromatin Changes Resulting from Single-Gene Inactivation—The Role of SMARCB1 in Malignant Rhabdoid Tumor Colin Kenny 1, Elaine O’Meara 2, Mevlüt Ula¸s 2 , Karsten Hokamp 3 and Maureen J. O’Sullivan 1,2,4,* 1 School of Medicine, Trinity College, University of Dublin, Dublin 2, Ireland; [email protected] 2 The National Children’s Research Centre, O’Sullivan Research Laboratory, Oncology Division, Gate 5, Children’s Health Ireland at Crumlin, D12N512 Dublin, Ireland; [email protected] (E.O.); [email protected] (M.U.) 3 School of Genetics and Microbiology, Trinity College, University of Dublin, Dublin 2, Ireland; [email protected] 4 Histology Laboratory, Pathology Department, Children’s Health Ireland at Crumlin, D12N512 Dublin, Ireland * Correspondence: [email protected] Simple Summary: Malignant rhabdoid tumors (MRT), one of the most lethal, treatment-resistant human cancers, arises in young children within brain, kidney, liver and/or soft tissues. Generally, cancer arises in older adults, and results from multiple significant changes (mutations) accumulating in the genetic blueprint (DNA) of a person’s tissues. This blueprint is composed of a 4-letter alphabet. Together, the multiple significant changes in the blueprint then allow a cell to go “out of control”, becoming a cancer cell. The striking thing about MRT is that it has only a single spelling change, so that mutation must be very powerful to lead to such a lethal cancer. Using a model system that we developed, we show herein how this single mutation alters how the whole of the DNA is arranged, Citation: Kenny, C.; O’Meara, E.; Ula¸s,M.; Hokamp, K.; O’Sullivan, thereby having its profound and lethal effects.
    [Show full text]
  • The Integral Spliceosomal Component CWC15 Is Required for Development in Arabidopsis Daniel Slane1, Cameron H
    www.nature.com/scientificreports OPEN The integral spliceosomal component CWC15 is required for development in Arabidopsis Daniel Slane1, Cameron H. Lee2, Martina Kolb1, Craig Dent3, Yingjing Miao1, Mirita Franz‑Wachtel4, Stefen Lau1, Boris Maček4, Sureshkumar Balasubramanian3, Martin Bayer1 & Gerd Jürgens1* Efcient mRNA splicing is a prerequisite for protein biosynthesis and the eukaryotic splicing machinery is evolutionarily conserved among species of various phyla. At its catalytic core resides the activated splicing complex Bact consisting of the three small nuclear ribonucleoprotein complexes (snRNPs) U2, U5 and U6 and the so-called NineTeen complex (NTC) which is important for spliceosomal activation. CWC15 is an integral part of the NTC in humans and it is associated with the NTC in other species. Here we show the ubiquitous expression and developmental importance of the Arabidopsis ortholog of yeast CWC15. CWC15 associates with core components of the Arabidopsis NTC and its loss leads to inefcient splicing. Consistent with the central role of CWC15 in RNA splicing, cwc15 mutants are embryo lethal and additionally display strong defects in the female haploid phase. Interestingly, the haploid male gametophyte or pollen in Arabidopsis, on the other hand, can cope without functional CWC15, suggesting that developing pollen might be more tolerant to CWC15-mediated defects in splicing than either embryo or female gametophyte. Angiosperms are the predominant group of land plants. A hallmark of this dominance in the course of evolu- tion is the establishment of a reduced haploid phase (called gametophyte) in the life cycle of fowering plants. In free-living gametophytes of mosses, the gametophytic generation forms independently recognizable plants that can even be the dominant structure.
    [Show full text]
  • Mrna Editing, Processing and Quality Control in Caenorhabditis Elegans
    | WORMBOOK mRNA Editing, Processing and Quality Control in Caenorhabditis elegans Joshua A. Arribere,*,1 Hidehito Kuroyanagi,†,1 and Heather A. Hundley‡,1 *Department of MCD Biology, UC Santa Cruz, California 95064, †Laboratory of Gene Expression, Medical Research Institute, Tokyo Medical and Dental University, Tokyo 113-8510, Japan, and ‡Medical Sciences Program, Indiana University School of Medicine-Bloomington, Indiana 47405 ABSTRACT While DNA serves as the blueprint of life, the distinct functions of each cell are determined by the dynamic expression of genes from the static genome. The amount and specific sequences of RNAs expressed in a given cell involves a number of regulated processes including RNA synthesis (transcription), processing, splicing, modification, polyadenylation, stability, translation, and degradation. As errors during mRNA production can create gene products that are deleterious to the organism, quality control mechanisms exist to survey and remove errors in mRNA expression and processing. Here, we will provide an overview of mRNA processing and quality control mechanisms that occur in Caenorhabditis elegans, with a focus on those that occur on protein-coding genes after transcription initiation. In addition, we will describe the genetic and technical approaches that have allowed studies in C. elegans to reveal important mechanistic insight into these processes. KEYWORDS Caenorhabditis elegans; splicing; RNA editing; RNA modification; polyadenylation; quality control; WormBook TABLE OF CONTENTS Abstract 531 RNA Editing and Modification 533 Adenosine-to-inosine RNA editing 533 The C. elegans A-to-I editing machinery 534 RNA editing in space and time 535 ADARs regulate the levels and fates of endogenous dsRNA 537 Are other modifications present in C.
    [Show full text]
  • NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer
    Florida International University FIU Digital Commons FIU Electronic Theses and Dissertations University Graduate School 11-7-2018 Decipher Mechanisms by which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer Jairo Ramos [email protected] Follow this and additional works at: https://digitalcommons.fiu.edu/etd Part of the Clinical Epidemiology Commons Recommended Citation Ramos, Jairo, "Decipher Mechanisms by which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer" (2018). FIU Electronic Theses and Dissertations. 3872. https://digitalcommons.fiu.edu/etd/3872 This work is brought to you for free and open access by the University Graduate School at FIU Digital Commons. It has been accepted for inclusion in FIU Electronic Theses and Dissertations by an authorized administrator of FIU Digital Commons. For more information, please contact [email protected]. FLORIDA INTERNATIONAL UNIVERSITY Miami, Florida DECIPHER MECHANISMS BY WHICH NUCLEAR RESPIRATORY FACTOR ONE (NRF1) COORDINATES CHANGES IN THE TRANSCRIPTIONAL AND CHROMATIN LANDSCAPE AFFECTING DEVELOPMENT AND PROGRESSION OF INVASIVE BREAST CANCER A dissertation submitted in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY in PUBLIC HEALTH by Jairo Ramos 2018 To: Dean Tomás R. Guilarte Robert Stempel College of Public Health and Social Work This dissertation, Written by Jairo Ramos, and entitled Decipher Mechanisms by Which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer, having been approved in respect to style and intellectual content, is referred to you for judgment.
    [Show full text]