Cwc15 (NM 023153) Mouse Tagged ORF Clone Product Data

Cwc15 (NM 023153) Mouse Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG202744 Cwc15 (NM_023153) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Cwc15 (NM_023153) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Cwc15 Synonyms: 0610040D20Rik; 2900052N06Rik; c11orf5; Ed1; mED1 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG202744 representing NM_023153 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAACAGCAGCCAGGCCAACTTTTGAACCTGCAAGAGGTGGGAGAGGAAAAGGAGAAGGGGATTTGA GCCAGCTCTCCAAGCAGTATTCAAGCAGAGATCTTCCCTCTCATACAAAGATAAAGTACAGACAAACCAC ACAGGATGCCCCTGAAGAGGTTCGAAACCGTGACTTCAGGAGAGAACTGGAAGAGAGAGAGAGAGCTGCT GCAAGGGACAAAAACAGGGACCGCCCAACTCGAGAGCATACAACTTCCTCTTCAGTGTCAAAGAAGCCCC GCTTAGACCAGATTCCTGCTGCCAACCTTGATGCTGACGATCCTCTCACAGACGAGGAAGATGAAGATTT TGAAGAGGAGAGCGATGACGATGATACTGCAGCTCTTCTCGCAGAGCTAGAAAAGATCAAGAAGGAAAGA GCTGAAGAGCAGGCCAGGAAGGAACAAGAACAAAAAGCAGAGGAAGAGAGAATTCGCATGGAAAACATTC TGAGTGGAAACCCTCTCCTAAACCTCACTGGCCCGTCCCAGCCTCAGGCCAACTTCAAGGTTAAAAGAAG ATGGGATGATGATGTCGTTTTTAAGAACTGTGCAAAAGGTATAGATGACCAGAAGAAAGACAAACGATTT GTAAATGATACACTGCGATCTGAATTTCACAAGAAGTTCATGGAGAAATATATTAAG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >MG202744 representing NM_023153 Red=Cloning site Green=Tags(s) MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAA ARDKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKER AEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGIDDQKKDKRF VNDTLRSEFHKKFMEKYIK TRTRPLE - GFP Tag - V This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Cwc15 (NM_023153) Mouse Tagged ORF Clone – MG202744 Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_023153 ORF Size: 687 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Cwc15 (NM_023153) Mouse Tagged ORF Clone – MG202744 RefSeq: NM_023153.3, NP_075642.1 RefSeq Size: 1152 bp RefSeq ORF: 690 bp Locus ID: 66070 UniProt ID: Q9JHS9 Gene Summary: Involved in pre-mRNA splicing as component of the spliceosome. Component of the PRP19- CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing.[UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us