Rabbit Anti-FGFR1OP/FITC Conjugated Antibody
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Transcriptional Profiling of Breast Cancer Cells in Response to Mevinolin: Evidence of Cell Cycle Arrest, DNA Degradation and Apoptosis
1886 INTERNATIONAL JOURNAL OF ONCOLOGY 48: 1886-1894, 2016 Transcriptional profiling of breast cancer cells in response to mevinolin: Evidence of cell cycle arrest, DNA degradation and apoptosis ALI M. MAHMOUD1,2, MOURAD A.M. ABOUL-SOUD1,3, JUNKYU HAN4,5, YAZEED A. AL-SHEIKH3, AHMED M. AL-ABD6 and HANY A. EL-SHEMY1 1Department of Biochemistry, Faculty of Agriculture, Cairo University, Giza 12613; 2Centre for Aging and Associated Diseases, Helmy Institute for Medical Sciences, Zewail City of Science and Technology, Giza 12588, Egypt; 3Chair of Medical and Molecular Genetics Research, Department of Clinical Laboratory Sciences, College of Applied Medical Sciences, King Saud University, Riyadh 11433, Kingdom of Saudi Arabia; 4Graduate School of Life and Environmental Sciences; 5Alliance for Research on North Africa (ARENA), University of Tsukuba, Tsukuba, Ibaraki 305-8572, Japan; 6Department of Pharmacology, Medical Division, National Research Centre, Cairo 21622, Egypt Received January 29, 2015; Accepted March 3, 2016 DOI: 10.3892/ijo.2016.3418 Abstract. The merging of high-throughput gene expression lines. In addition, MVN‑induced transcript abundance profiles techniques, such as microarray, in the screening of natural inferred from microarrays showed significant changes in some products as anticancer agents, is considered the optimal solu- key cell processes. The changes were predicted to induce cell tion for gaining a better understanding of the intervention cycle arrest and reactive oxygen species generation but inhibit mechanism. Red yeast rice (RYR), a Chinese dietary product, DNA repair and cell proliferation. This MVN-mediated contains a mixture of hypocholesterolemia agents such as multi‑factorial stress triggered specific programmed cell death statins. -
Myopia in African Americans Is Significantly Linked to Chromosome 7P15.2-14.2
Genetics Myopia in African Americans Is Significantly Linked to Chromosome 7p15.2-14.2 Claire L. Simpson,1,2,* Anthony M. Musolf,2,* Roberto Y. Cordero,1 Jennifer B. Cordero,1 Laura Portas,2 Federico Murgia,2 Deyana D. Lewis,2 Candace D. Middlebrooks,2 Elise B. Ciner,3 Joan E. Bailey-Wilson,1,† and Dwight Stambolian4,† 1Department of Genetics, Genomics and Informatics and Department of Ophthalmology, University of Tennessee Health Science Center, Memphis, Tennessee, United States 2Computational and Statistical Genomics Branch, National Human Genome Research Institute, National Institutes of Health, Baltimore, Maryland, United States 3The Pennsylvania College of Optometry at Salus University, Elkins Park, Pennsylvania, United States 4Department of Ophthalmology, University of Pennsylvania, Philadelphia, Pennsylvania, United States Correspondence: Joan E. PURPOSE. The purpose of this study was to perform genetic linkage analysis and associ- Bailey-Wilson, NIH/NHGRI, 333 ation analysis on exome genotyping from highly aggregated African American families Cassell Drive, Suite 1200, Baltimore, with nonpathogenic myopia. African Americans are a particularly understudied popula- MD 21131, USA; tion with respect to myopia. [email protected]. METHODS. One hundred six African American families from the Philadelphia area with a CLS and AMM contributed equally to family history of myopia were genotyped using an Illumina ExomePlus array and merged this work and should be considered co-first authors. with previous microsatellite data. Myopia was initially measured in mean spherical equiv- JEB-W and DS contributed equally alent (MSE) and converted to a binary phenotype where individuals were identified as to this work and should be affected, unaffected, or unknown. -
Molecular Genetics in Neuroblastoma Prognosis
children Review Molecular Genetics in Neuroblastoma Prognosis Margherita Lerone 1, Marzia Ognibene 1 , Annalisa Pezzolo 2 , Giuseppe Martucciello 3,4 , Federico Zara 1,4, Martina Morini 5,*,† and Katia Mazzocco 6,† 1 Unit of Medical Genetics, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] (M.L.); [email protected] (M.O.); [email protected] (F.Z.) 2 IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] 3 Department of Pediatric Surgery, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] 4 Dipartimento di Neuroscienze, Riabilitazione, Oftalmologia, Genetica e Scienze Materno-Infantili, University of Genova, 16132 Genova, Italy 5 Laboratory of Molecular Biology, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy 6 Department of Pathology, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] * Correspondence: [email protected]; Tel.: +39-010-5636-2633 † Authors share senior authorship. Abstract: In recent years, much research has been carried out to identify the biological and genetic characteristics of the neuroblastoma (NB) tumor in order to precisely define the prognostic subgroups for improving treatment stratification. This review will describe the major genetic features and the recent scientific advances, focusing on their impact on diagnosis, prognosis, and therapeutic solutions in NB clinical management. Keywords: neuroblastoma; genetics; TRK; liquid biopsy; exosomes; telomere maintenance; hypoxia Citation: Lerone, M.; Ognibene, M.; Pezzolo, A.; Martucciello, G.; Zara, F.; 1. Introduction Morini, M.; Mazzocco, K. Molecular Genetics in Neuroblastoma Prognosis. Neuroblastoma (NB) is a pediatric heterogeneous disease with a median age of Children 2021, 8, 456. https:// 17 months at diagnosis, which can evolve with a benign course or fatal illness, with a doi.org/10.3390/children8060456 natural history ranging from a benign course to a terminal illness [1–3]. -
FGFR1OP (Human) Recombinant Protein (P01)
FGFR1OP (Human) Recombinant Protein (P01) Catalog # : H00011116-P01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human FGFR1OP full-length ORF ( AAH11902, 1 a.a. - 379 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEK protein) VENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETST LQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGAL Antibody Production DLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLH LLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTY Protein Array GLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKD LKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEID DINTSDKLDDLTQDLTVSQLSDVADYLEDVA Host: Wheat Germ (in vitro) Theoretical MW 67.43 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Publication Reference 1. Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer. Page 1 of 2 2016/5/23 Mano Y, Takahashi K, Ishikawa N, Takano A, Yasui W, Inai K, Nishimura H, Tsuchiya E, Nakamura Y, Daigo Y.Cancer Sci. 2007 Dec;98(12):1902-13. Epub 2007 Sep 18. Applications Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array Gene Information Entrez GeneID: 11116 GeneBank BC011902 Accession#: Protein AAH11902 Accession#: Gene Name: FGFR1OP Gene Alias: FOP Gene FGFR1 oncogene partner Description: Omim ID: 605392 Gene Ontology: Hyperlink Gene Summary: This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. -
Strain-Specific Differences in Brain Gene Expression in a Hydrocephalic
www.nature.com/scientificreports OPEN Strain-specifc diferences in brain gene expression in a hydrocephalic mouse model with motile cilia Received: 18 June 2018 Accepted: 22 August 2018 dysfunction Published: xx xx xxxx Casey W. McKenzie1, Claudia C. Preston2, Rozzy Finn1, Kathleen M. Eyster3, Randolph S. Faustino2,4 & Lance Lee1,4 Congenital hydrocephalus results from cerebrospinal fuid accumulation in the ventricles of the brain and causes severe neurological damage, but the underlying causes are not well understood. It is associated with several syndromes, including primary ciliary dyskinesia (PCD), which is caused by dysfunction of motile cilia. We previously demonstrated that mouse models of PCD lacking ciliary proteins CFAP221, CFAP54 and SPEF2 all have hydrocephalus with a strain-dependent severity. While morphological defects are more severe on the C57BL/6J (B6) background than 129S6/SvEvTac (129), cerebrospinal fuid fow is perturbed on both backgrounds, suggesting that abnormal cilia-driven fow is not the only factor underlying the hydrocephalus phenotype. Here, we performed a microarray analysis on brains from wild type and nm1054 mice lacking CFAP221 on the B6 and 129 backgrounds. Expression diferences were observed for a number of genes that cluster into distinct groups based on expression pattern and biological function, many of them implicated in cellular and biochemical processes essential for proper brain development. These include genes known to be functionally relevant to congenital hydrocephalus, as well as formation and function of both motile and sensory cilia. Identifcation of these genes provides important clues to mechanisms underlying congenital hydrocephalus severity. Hydrocephalus is a complex disorder with both genetic and environmental causes1. -
Polymorphisms of the Centrosomal Gene (FGFR1OP) and Lung Cancer
Carcinogenesis, 2016, Vol. 37, No. 3, 280–289 doi:10.1093/carcin/bgw014 Advance Access publication February 10, 2016 Original Manuscript original manuscript Polymorphisms of the centrosomal gene (FGFR1OP) and lung cancer risk: a meta-analysis of 14 463 cases and Downloaded from 44 188 controls Xiaozheng Kang1,2,3,†, Hongliang Liu1,4,†, Mark W.Onaitis1,2, Zhensheng Liu1,4, Kouros Owzar1,5,Younghun Han6, Li Su7,8, Yongyue Wei7,8, Rayjean J.Hung9, http://carcin.oxfordjournals.org/ Yonathan Brhane9, John McLaughlin10, Paul Brennan11, Heike Bickeböller12, Albert Rosenberger12, Richard S.Houlston13, Neil Caporaso14, Maria Teresa Landi14, Joachim Heinrich15, Angela Risch16, Xifeng Wu17, Yuanqing Ye17, David C.Christiani7,8, Christopher I.Amos6 and Qingyi Wei1,4,*; Transdisciplinary Research in Cancer of the Lung (TRICL) Research Team 1Duke Cancer Institute and 2Division of Cardiovascular and Thoracic Surgery, Department of Surgery, Duke University Medical Center, 905 S. LaSalle Street, Durham, NC 27710, USA, 3Key Laboratory of Carcinogenesis and Translational Research (Ministry of Education), Department of Thoracic Surgery I, Peking University Cancer Hospital and Institute, Beijing 100142, at Helmholtz Zentrum Muenchen on February 29, 2016 China, 4Department of Medicine, Duke University School of Medicine, Durham, NC 27710, USA, 5Department of Biostatistics and Bioinformatics, Duke University Medical Center, Durham, NC 27710, USA, 6Community and Family Medicine, Geisel School of Medicine, Dartmouth College, Hanover, NH 03755, USA, 7Massachusetts -
Coexpression Networks Based on Natural Variation in Human Gene Expression at Baseline and Under Stress
University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations Fall 2010 Coexpression Networks Based on Natural Variation in Human Gene Expression at Baseline and Under Stress Renuka Nayak University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Computational Biology Commons, and the Genomics Commons Recommended Citation Nayak, Renuka, "Coexpression Networks Based on Natural Variation in Human Gene Expression at Baseline and Under Stress" (2010). Publicly Accessible Penn Dissertations. 1559. https://repository.upenn.edu/edissertations/1559 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/1559 For more information, please contact [email protected]. Coexpression Networks Based on Natural Variation in Human Gene Expression at Baseline and Under Stress Abstract Genes interact in networks to orchestrate cellular processes. Here, we used coexpression networks based on natural variation in gene expression to study the functions and interactions of human genes. We asked how these networks change in response to stress. First, we studied human coexpression networks at baseline. We constructed networks by identifying correlations in expression levels of 8.9 million gene pairs in immortalized B cells from 295 individuals comprising three independent samples. The resulting networks allowed us to infer interactions between biological processes. We used the network to predict the functions of poorly-characterized human genes, and provided some experimental support. Examining genes implicated in disease, we found that IFIH1, a diabetes susceptibility gene, interacts with YES1, which affects glucose transport. Genes predisposing to the same diseases are clustered non-randomly in the network, suggesting that the network may be used to identify candidate genes that influence disease susceptibility. -
FGFR1 Oncogene Partner (FGFR1OP) (NM 194429) Human Tagged ORF Clone – RC204229 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC204229 FGFR1 Oncogene Partner (FGFR1OP) (NM_194429) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: FGFR1 Oncogene Partner (FGFR1OP) (NM_194429) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CEP43 Synonyms: FGFR1OP; FOP Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC204229 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGCGACGGCGGCCGCAGTGGTGGCCGAGGAGGACACGGAGCTGCGGGACCTGCTGGTGCAGACGC TGGAGAACAGCGGGGTCCTGAACCGCATCAAGGCTGAACTCCGAGCAGCTGTGTTTTTAGCACTAGAGGA GCAAGAAAAAGTAGAGAACAAAACTCCTTTAGTTAATGAGAGCCTGAGAAAGTTTTTAAATACCAAAGAC GGTCGTTTAGTGGCTAGTCTTGTTGCAGAATTTCTTCAGTTTTTTAACCTTGACTTTACTTTGGCTGTTT TTCAACCTGAAACTAGCACACTGCAAGGTCTCGAAGGTCGAGAGAATTTAGCCCGAGATTTAGGTATAAT TGAAGCAGAAGGTACTGTGGGTGGACCCTTATTATTAGAAGTGATCAGGCGCTGTCAACAGAAAGAAAAA GGGCCAACCACTGGGGAAGGTGCACTTGATCTATCTGATGTACATTCTCCACCAAAGTCACCAGAGGGAA AAACAAGTGCACAGACAACACCAAGTAAGAAGGCCAATGATGAGGCCAATCAGAGTGATACAAGTGTCTC CTTGTCAGAACCCAAGAGCAAAAGCAGCCTTCACTTACTGTCCCATGAAACAAAAATTGGATCTTTTCTA AGCAACAGAACTTTAGATGGCAAAGACAAAGCTGGCCTTTGTCCAGATGAAGATGATATGGAAGGAGATT CTTTCTTTGATGATCCCATTCCTAAGCCAGAGAAAACTTACGGTTTGAGGAATGAACCTAGGAAGCAAGC AGGAAGTCTGGCCTCGCTCTCGGATGCACCCCCCTTAAAAAGTGGACTCAGCTCCCTGGCGGGAGCCCCT -
Ontology-Based Methods for Disease Similarity Estimation and Drug
ONTOLOGY-BASED METHODS FOR DISEASE SIMILARITY ESTIMATION AND DRUG REPOSITIONING A DISSERTATION IN Computer Science and Mathematics Presented to the Faculty of the University of Missouri Kansas City in partial fulfillment of the requirements for the degree DOCTOR OF PHILOSOPHY by SACHIN MATHUR B.Tech., Computer Science, Jawaharlal Nehru Technological University, 2001 M.S., Computer Science, University of Missouri-Kansas City, 2004 Kansas City, Missouri 2012 ONTOLOGY-BASED METHODS FOR DISEASE SIMILARITY ESTIMATION AND DRUG REPOSITIONING SACHIN MATHUR, Candidate for the Doctor of Philosophy Degree University of Missouri-Kansas City, 2012 ABSTRACT Human genome sequencing and new biological data generation techniques have provided an opportunity to uncover mechanisms in human disease. Using gene-disease data, recent research has increasingly shown that many seemingly dissimilar diseases have similar/common molecular mechanisms. Understanding similarity between diseases aids in early disease diagnosis and development of new drugs. The growing collection of gene- function and gene-disease data has instituted a need for formal knowledge representation in order to extract information. Ontologies have been successfully applied to represent such knowledge, and data mining techniques have been applied on them to extract information. Informatics methods can be used with ontologies to find similarity between diseases which can yield insight into how they are caused. This can lead to therapies which can actually cure diseases rather than merely treating symptoms. Estimating disease similarity solely on the basis of shared genes can be misleading as variable combinations of genes may be associated with similar diseases, especially for complex diseases. This deficiency can be potentially overcome by looking for common or similar biological processes rather than only explicit gene matches between diseases. -
Download and May While the KEGG Database [18] Was Used As a Basis for the Be Installed As a Local Source Package
BMC Bioinformatics BioMed Central Methodology article Open Access Identifying differential correlation in gene/pathway combinations Rosemary Braun*1, Leslie Cope2 and Giovanni Parmigiani2 Address: 1National Cancer Institute, National Institutes of Health, Bethesda, MD 20892, USA and 2The Sydney Kimmel Comprehensive Cancer Center, Johns Hopkins University, Baltimore, MD 21205, USA Email: Rosemary Braun* - [email protected]; Leslie Cope - [email protected]; Giovanni Parmigiani - [email protected] * Corresponding author Published: 18 November 2008 Received: 3 April 2008 Accepted: 18 November 2008 BMC Bioinformatics 2008, 9:488 doi:10.1186/1471-2105-9-488 This article is available from: http://www.biomedcentral.com/1471-2105/9/488 © 2008 Braun et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: An important emerging trend in the analysis of microarray data is to incorporate known pathway information a priori. Expression level "summaries" for pathways, obtained from the expression data for the genes constituting the pathway, permit the inclusion of pathway information, reduce the high dimensionality of microarray data, and have the power to elucidate gene-interaction dependencies which are not already accounted for through known pathway identification. Results: We present a novel method for the analysis of microarray data that identifies joint differential expression in gene-pathway pairs. This method takes advantage of known gene pathway memberships to compute a summary expression level for each pathway as a whole. -
Prioritizing Risk Genes for Neurodevelopmental Disorders Using Pathway Information
bioRxiv preprint doi: https://doi.org/10.1101/410100; this version posted September 9, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Prioritizing risk genes for neurodevelopmental disorders using pathway information Author List: Hoang T. Nguyen1*, Amanda Dobbyn1,2, Alex Charney1, Julien Bryois3, Nathan G. Skene4, Laura M. Huckins1, Weiqing Wang1, Douglas M Ruderfer5, Xinyi Xu6, Menachem Fromer7, Shaun M Purcell8, Matthijs Verhage9, August B. Smit10, Jens Hjerling-Leffler4, Joseph D. Buxbaum6, Dalila Pinto6,11,12, Xin He13, Patrick F Sullivan14, Eli A. Stahl1,15* Author Affiliations: 1. Division of Psychiatric Genomics, Department of Genetics and Genomic Sciences, Institute for Genomics and Multiscale Biology, Icahn School of Medicine at Mount Sinai, New York, NY, USA. 2. Charles Bronfman Institute for Personalized Medicine, Icahn School of Medicine at Mount Sinai, New York, NY, USA. 3. Department of Medical Epidemiology and Biostatistics, Karolinska Institutet, Stockholm, Sweden. 4. Laboratory of Molecular Neurobiology, Department of Medical Biochemistry and Biophysics, Karolinska Institutet, Stockholm, Sweden. 5. Division of Genetic Medicine, Departments of Medicine, Psychiatry and Biomedical Informatics, Vanderbilt Genetics Institute, Vanderbilt University Medical Center, Nashville, TN, USA. 6. Seaver Autism Center, Department of Psychiatry, Icahn School of Medicine at Mount Sinai, New York, NY, USA. 7. Verily Life Sciences, 269 E Grand Ave, South San Francisco, CA. 8. Sleep Center, Brigham and Women's Hospital, Harvard Medical School, Boston, Massachusetts, USA. 9. Department of Functional Genomics, The Center for Neurogenomics and Cognitive Research, VU University and VU Medical Center, Amsterdam, The Netherlands. -
Identification of CDK1 As a Candidate Marker in Cutaneous Squamous Cell Carcinoma by Integrated Bioinformatics Analysis
478 Original Article Identification of CDK1 as a candidate marker in cutaneous squamous cell carcinoma by integrated bioinformatics analysis Si Qin1,2#, Yu Yang2,3#, Hao-Bin Zhang4, Xiao-Huan Zheng5, Hua-Run Li1,2, Ju Wen1,2 1Department of Dermatology, Guangdong Second Provincial General Hospital, Guangzhou, China; 2The Second School of Clinical Medicine, Southern Medical University, Guangzhou, China; 3Department of Urology, Peking University Shenzhen Hospital, Shenzhen, China; 4The Big Data Institute, Guangdong Create Environmental Technology Company Limited, Guangzhou, China; 5Nanhai District People’s Hospital, Foshan, China Contributions: (I) Conception and design: S Qin, Y Yang, HB Zhang; (II) Administrative support: J Wen; (III) Provision of study materials or patients: S Qin; (IV) Collection and assembly of data: XH Zheng, HR Li; (V) Data analysis and interpretation: S Qin, Y Yang, HB Zhang; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #The authors contributed equally to this work. Correspondence to: Ju Wen. Department of Dermatology, Guangdong Second Provincial General Hospital, Guangzhou 510317, China. Email: [email protected]. Background: Cutaneous squamous cell carcinoma (cSCC) is a relatively common cancer that accounts for nearly 50% of non-melanoma skin cancer cases. However, the genotypes that are linked with poor prognosis and/or high relapse rates and pathogenic mechanisms of cSCC are not fully understood. To address these points, three gene expression datasets were analyzed to identify candidate biomarker genes in cSCC. Methods: The GSE117247, GSE32979, and GSE98767 datasets comprising a total of 32 cSCC samples and 31 normal skin tissue samples were obtained from the National Center for Biotechnology Information Gene Expression Omnibus database.