Prioritizing Risk Genes for Neurodevelopmental Disorders Using Pathway Information
Total Page:16
File Type:pdf, Size:1020Kb
 
											Load more
										Recommended publications
									
								- 
												  Transcriptional Profiling of Breast Cancer Cells in Response to Mevinolin: Evidence of Cell Cycle Arrest, DNA Degradation and Apoptosis1886 INTERNATIONAL JOURNAL OF ONCOLOGY 48: 1886-1894, 2016 Transcriptional profiling of breast cancer cells in response to mevinolin: Evidence of cell cycle arrest, DNA degradation and apoptosis ALI M. MAHMOUD1,2, MOURAD A.M. ABOUL-SOUD1,3, JUNKYU HAN4,5, YAZEED A. AL-SHEIKH3, AHMED M. AL-ABD6 and HANY A. EL-SHEMY1 1Department of Biochemistry, Faculty of Agriculture, Cairo University, Giza 12613; 2Centre for Aging and Associated Diseases, Helmy Institute for Medical Sciences, Zewail City of Science and Technology, Giza 12588, Egypt; 3Chair of Medical and Molecular Genetics Research, Department of Clinical Laboratory Sciences, College of Applied Medical Sciences, King Saud University, Riyadh 11433, Kingdom of Saudi Arabia; 4Graduate School of Life and Environmental Sciences; 5Alliance for Research on North Africa (ARENA), University of Tsukuba, Tsukuba, Ibaraki 305-8572, Japan; 6Department of Pharmacology, Medical Division, National Research Centre, Cairo 21622, Egypt Received January 29, 2015; Accepted March 3, 2016 DOI: 10.3892/ijo.2016.3418 Abstract. The merging of high-throughput gene expression lines. In addition, MVN‑induced transcript abundance profiles techniques, such as microarray, in the screening of natural inferred from microarrays showed significant changes in some products as anticancer agents, is considered the optimal solu- key cell processes. The changes were predicted to induce cell tion for gaining a better understanding of the intervention cycle arrest and reactive oxygen species generation but inhibit mechanism. Red yeast rice (RYR), a Chinese dietary product, DNA repair and cell proliferation. This MVN-mediated contains a mixture of hypocholesterolemia agents such as multi‑factorial stress triggered specific programmed cell death statins.
- 
												  The Drosophila Blood-Brain Barrier: Development and Function of a Glial EndotheliumREVIEW ARTICLE published: 14 November 2014 doi: 10.3389/fnins.2014.00365 The Drosophila blood-brain barrier: development and function of a glial endothelium Stefanie Limmer , Astrid Weiler , Anne Volkenhoff , Felix Babatz and Christian Klämbt* Institut für Neuro- und Verhaltensbiologie, Universität Münster, Münster, Germany Edited by: The efficacy of neuronal function requires a well-balanced extracellular ion homeostasis Norman Ruthven Saunders, and a steady supply with nutrients and metabolites. Therefore, all organisms equipped University of Melbourne, Australia with a complex nervous system developed a so-called blood-brain barrier, protecting it Reviewed by: from an uncontrolled entry of solutes, metabolites or pathogens. In higher vertebrates, Alfredo Ghezzi, The University of Texas at Austin, USA this diffusion barrier is established by polarized endothelial cells that form extensive Brigitte Dauwalder, University of tight junctions, whereas in lower vertebrates and invertebrates the blood-brain barrier is Houston, USA exclusively formed by glial cells. Here, we review the development and function of the glial Marko Brankatschk, Max Planck blood-brain barrier of Drosophila melanogaster. In the Drosophila nervous system, at least Institute of Molecular Cell Biology and Genetics, Germany seven morphologically distinct glial cell classes can be distinguished. Two of these glial *Correspondence: classes form the blood-brain barrier. Perineurial glial cells participate in nutrient uptake and Christian Klämbt, Institut für Neuro- establish a first diffusion barrier. The subperineurial glial (SPG) cells form septate junctions, und Verhaltensbiologie, Universität which block paracellular diffusion and thus seal the nervous system from the hemolymph. Münster, Badestr. 9, We summarize the molecular basis of septate junction formation and address the different 48140 Münster, Germany e-mail: [email protected] transport systems expressed by the blood-brain barrier forming glial cells.
- 
												  Myopia in African Americans Is Significantly Linked to Chromosome 7P15.2-14.2Genetics Myopia in African Americans Is Significantly Linked to Chromosome 7p15.2-14.2 Claire L. Simpson,1,2,* Anthony M. Musolf,2,* Roberto Y. Cordero,1 Jennifer B. Cordero,1 Laura Portas,2 Federico Murgia,2 Deyana D. Lewis,2 Candace D. Middlebrooks,2 Elise B. Ciner,3 Joan E. Bailey-Wilson,1,† and Dwight Stambolian4,† 1Department of Genetics, Genomics and Informatics and Department of Ophthalmology, University of Tennessee Health Science Center, Memphis, Tennessee, United States 2Computational and Statistical Genomics Branch, National Human Genome Research Institute, National Institutes of Health, Baltimore, Maryland, United States 3The Pennsylvania College of Optometry at Salus University, Elkins Park, Pennsylvania, United States 4Department of Ophthalmology, University of Pennsylvania, Philadelphia, Pennsylvania, United States Correspondence: Joan E. PURPOSE. The purpose of this study was to perform genetic linkage analysis and associ- Bailey-Wilson, NIH/NHGRI, 333 ation analysis on exome genotyping from highly aggregated African American families Cassell Drive, Suite 1200, Baltimore, with nonpathogenic myopia. African Americans are a particularly understudied popula- MD 21131, USA; tion with respect to myopia. [email protected]. METHODS. One hundred six African American families from the Philadelphia area with a CLS and AMM contributed equally to family history of myopia were genotyped using an Illumina ExomePlus array and merged this work and should be considered co-first authors. with previous microsatellite data. Myopia was initially measured in mean spherical equiv- JEB-W and DS contributed equally alent (MSE) and converted to a binary phenotype where individuals were identified as to this work and should be affected, unaffected, or unknown.
- 
												  Molecular Genetics in Neuroblastoma Prognosischildren Review Molecular Genetics in Neuroblastoma Prognosis Margherita Lerone 1, Marzia Ognibene 1 , Annalisa Pezzolo 2 , Giuseppe Martucciello 3,4 , Federico Zara 1,4, Martina Morini 5,*,† and Katia Mazzocco 6,† 1 Unit of Medical Genetics, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] (M.L.); [email protected] (M.O.); [email protected] (F.Z.) 2 IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] 3 Department of Pediatric Surgery, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] 4 Dipartimento di Neuroscienze, Riabilitazione, Oftalmologia, Genetica e Scienze Materno-Infantili, University of Genova, 16132 Genova, Italy 5 Laboratory of Molecular Biology, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy 6 Department of Pathology, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] * Correspondence: [email protected]; Tel.: +39-010-5636-2633 † Authors share senior authorship. Abstract: In recent years, much research has been carried out to identify the biological and genetic characteristics of the neuroblastoma (NB) tumor in order to precisely define the prognostic subgroups for improving treatment stratification. This review will describe the major genetic features and the recent scientific advances, focusing on their impact on diagnosis, prognosis, and therapeutic solutions in NB clinical management. Keywords: neuroblastoma; genetics; TRK; liquid biopsy; exosomes; telomere maintenance; hypoxia Citation: Lerone, M.; Ognibene, M.; Pezzolo, A.; Martucciello, G.; Zara, F.; 1. Introduction Morini, M.; Mazzocco, K. Molecular Genetics in Neuroblastoma Prognosis. Neuroblastoma (NB) is a pediatric heterogeneous disease with a median age of Children 2021, 8, 456. https:// 17 months at diagnosis, which can evolve with a benign course or fatal illness, with a doi.org/10.3390/children8060456 natural history ranging from a benign course to a terminal illness [1–3].
- 
												  FGFR1OP (Human) Recombinant Protein (P01)FGFR1OP (Human) Recombinant Protein (P01) Catalog # : H00011116-P01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human FGFR1OP full-length ORF ( AAH11902, 1 a.a. - 379 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEK protein) VENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETST LQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGAL Antibody Production DLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLH LLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTY Protein Array GLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKD LKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEID DINTSDKLDDLTQDLTVSQLSDVADYLEDVA Host: Wheat Germ (in vitro) Theoretical MW 67.43 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Publication Reference 1. Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer. Page 1 of 2 2016/5/23 Mano Y, Takahashi K, Ishikawa N, Takano A, Yasui W, Inai K, Nishimura H, Tsuchiya E, Nakamura Y, Daigo Y.Cancer Sci. 2007 Dec;98(12):1902-13. Epub 2007 Sep 18. Applications Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array Gene Information Entrez GeneID: 11116 GeneBank BC011902 Accession#: Protein AAH11902 Accession#: Gene Name: FGFR1OP Gene Alias: FOP Gene FGFR1 oncogene partner Description: Omim ID: 605392 Gene Ontology: Hyperlink Gene Summary: This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member.
- 
												  Understanding Neurodevelopmental Disorders: the Promise of Regulatory Variation in the 30UtromeBiological Psychiatry Review Understanding Neurodevelopmental Disorders: The Promise of Regulatory Variation in the 30UTRome Kai A. Wanke, Paolo Devanna, and Sonja C. Vernes ABSTRACT Neurodevelopmental disorders have a strong genetic component, but despite widespread efforts, the specific genetic factors underlying these disorders remain undefined for a large proportion of affected individuals. Given the accessibility of exome sequencing, this problem has thus far been addressed from a protein-centric standpoint; however, protein-coding regions only make up w1% to 2% of the human genome. With the advent of whole genome sequencing we are in the midst of a paradigm shift as it is now possible to interrogate the entire sequence of the human genome (coding and noncoding) to fill in the missing heritability of complex disorders. These new technologies bring new challenges, as the number of noncoding variants identified per individual can be overwhelming, making it prudent to focus on noncoding regions of known function, for which the effects of variation can be predicted and directly tested to assess pathogenicity. The 30UTRome is a region of the noncoding genome that perfectly fulfills these criteria and is of high interest when searching for pathogenic variation related to complex neurodevelopmental disorders. Herein, we review the regulatory roles of the 30UTRome as binding sites for microRNAs or RNA binding proteins, or during alternative polyadenylation. We detail existing evidence that these regions contribute to neuro- developmental disorders and outline strategies for identification and validation of novel putatively pathogenic vari- ation in these regions. This evidence suggests that studying the 30UTRome will lead to the identification of new risk factors, new candidate disease genes, and a better understanding of the molecular mechanisms contributing to neurodevelopmental disorders.
- 
												  A Bridge Between Genes and Brain Activities Juko Ando【Grant-in-Aid for Scientific Research(S)】 Humanities and Social Sciences (Social sciences) Title of Project:A Twin Study on Sociability and Mental Health: A Bridge between Genes and Brain Activities Juko Ando (Keio University, Faculty of Letters, Professor ) Research Area:behavioral genetics, psychology, brain science, genomics Keyword:twin, genetics, environment, 【Purpose and Background of the Research】 at home and in campus (3) brain structure/function studies by NIRS and At the coming of the dawn of a behavioral MRI neurogenomics era, it has been becoming (4) molecular genetic studies by whole genome rapidly possible to clarify the mechanism in wide SNP scan which how genes and behavior are connected. 【Expected Research Achievements and This can be realized with the integration work Scientific Significance】 of traditional behavioral genetics, recent Genetic and environmental influences on advances of brain sciences, and molecular adaptive social behavior, mental health, and genetics. learning abilities will be clarified. We focus The purpose of this study is to clarify how specifically on “gene-environment interaction” in which genetic effects are manifested sociability, mental health, and related differently in different environmental psychological traits are being developed situations, and “gene- environment correlation” through interactive processes of genes and in which genes are selected by and/or select environment via neurological structures and specific environmental situations. Brain structure and functioning as well as responsible
- 
												  Rgma) Induces Neuropathological and Behavioral Changes That Closely Resemble Parkinson's DiseaseThis Accepted Manuscript has not been copyedited and formatted. The final version may differ from this version. Research Articles: Neurobiology of Disease Repulsive guidance molecule a (RGMa) induces neuropathological and behavioral changes that closely resemble Parkinson's disease J.a. Korecka1, E. B. Moloney1, R. Eggers1, B. Hobo1, S. Scheffer1, N. Ras-Verloop1, R.j. Pasterkamp2, D.f. Swaab3, A.b. Smit4, R.e. Van Kesteren4, K. Bossers1 and J. Verhaagen1,4 1Department of Regeneration of Sensorimotor Systems, Netherlands Institute for Neuroscience, An Institute of the Royal Netherlands Academy of Arts and Sciences, Meibergdreef 47, 1105 BA, Amsterdam, The Netherlands 2Department of Translational Neuroscience, Brain Center Rudolf Magnus, Utrecht University, Universiteitsweg 100, 3584 CG, Utrecht, The Netherlands 3Department of Neuropsychiatric Disorders, Netherlands Institute for Neuroscience, An Institute of the Royal Netherlands Academy of Arts and Sciences, Meibergdreef 47, 1105 BA, Amsterdam, The Netherlands 4Center for Neurogenomics and Cognitive Research, Neuroscience Campus Amsterdam, Vrije Universiteit Amsterdam, De Boelelaan 1085-1087, 1081 HV, The Netherlands DOI: 10.1523/JNEUROSCI.0084-17.2017 Received: 8 January 2017 Revised: 12 July 2017 Accepted: 11 August 2017 Published: 21 August 2017 Author contributions: JK- experimental design, experimental execution, acquiring data, analyzing data, writing the manuscript; EM- experimental execution, acquiring data, analyzing data, writing the manuscript; RE- experimental execution, experimental design; BH-experimental execution; SS- experimental execution, acquiring data, analyzing data; NRV- experimental execution, acquiring data, analyzing data; RP- experimental design, providing reagents; DS- experimental design,; AS- experimental design, ; RK- experimental design,; KB- experimental design, experimental execution, help with analyzing the data, writing the manuscript; JV- experimental design, writing the manuscript Conflict of Interest: The authors declare no competing financial interests.
- 
												  Depression-Associated Gene Negr1-Fgfr2 Pathway Is Altered by Antidepressant Treatmentcells Article Depression-Associated Gene Negr1-Fgfr2 Pathway Is Altered by Antidepressant Treatment Lucia Carboni 1,* , Francesca Pischedda 2, Giovanni Piccoli 2, Mario Lauria 3,4 , Laura Musazzi 5 , Maurizio Popoli 6, Aleksander A. Mathé 7 and Enrico Domenici 2,4 1 Department of Pharmacy and Biotechnology, Alma Mater Studiorum Università di Bologna, 40126 Bologna, Italy 2 Department of Cellular, Computational and Integrative Biology, University of Trento, 38123 Trento, Italy; [email protected] (F.P.); [email protected] (G.P.); [email protected] (E.D.) 3 Department of Mathematics, University of Trento, 38123 Trento, Italy; [email protected] 4 Fondazione The Microsoft Research—University of Trento Centre for Computational and Systems Biology (COSBI), 38068 Rovereto (Trento), Italy 5 School of Medicine and Surgery, University of Milano-Bicocca, 20900 Monza, Italy; [email protected] 6 Laboratory of Neuropsychopharmacology and Functional Neurogenomics, Dipartimento di Scienze Farmaceutiche, Università degli Studi di Milano, 20133 Milano, Italy; [email protected] 7 Karolinska Institutet, Department of Clinical Neuroscience, SE-11221 Stockholm, Sweden; [email protected] * Correspondence: [email protected]; Tel.: +39-051-209-1793 Received: 30 June 2020; Accepted: 28 July 2020; Published: 31 July 2020 Abstract: The Negr1 gene has been significantly associated with major depression in genetic studies. Negr1 encodes for a cell adhesion molecule cleaved by the protease Adam10, thus activating Fgfr2 and promoting neuronal spine plasticity. We investigated whether antidepressants modulate the expression of genes belonging to Negr1-Fgfr2 pathway in Flinders sensitive line (FSL) rats, in a corticosterone-treated mouse model of depression, and in mouse primary neurons.
- 
												  Neurogenomics Coursework (PDF)Course Curriculum for the Interdisciplinary Graduate Certificate in Neurogenomics This list reflects the currently approved course curriculum for the Interdisciplinary Graduate Certificate in Neurogenomics. Students must complete a total of at least 16 units of coursework including at least 4 units from each of three (3) fields; Neurology, Genetics/Genomics, and Bioinformatics/Computational/Data Analysis. Note: Due to overlapping subject matter, the same course may be listed within multiple fields and may be offered through different departments under a different course number. As students may enter this certificate program via different graduate programs, all such overlapping courses are listed here for completeness. Neurology-Related Courses Neuroscience Graduate Courses M201. Cell, Developmental, and Molecular Neurobiology. (6) Lecture, six hours. Fundamental topics concerning cellular, developmental, and molecular neurobiology, including intracellular signaling, cell-cell communication, neurogenesis and migration, synapse formation and elimination, programmed neuronal death, and neurotropic factors. Letter grading. M203. Anatomy of Central Nervous System. (4) (Same as Bioengineering M263.) Lecture, 75 minutes; discussion/laboratory, two hours. Prior to first laboratory meeting, students must complete Bloodborne Pathogens training course through UCLA Environment, Health and Safety. Study of anatomical locations of and relationships between ascending and descending sensory and motor systems from spinal cord to cerebral cortex. Covers
- 
												  LSD1 Modulates Stress-Evoked Transcription of Immediate Early Genes and Emotional BehaviorLSD1 modulates stress-evoked transcription of immediate early genes and emotional behavior Francesco Rusconia,1, Barbara Grilloa,2, Luisa Ponzonib,2, Silvia Bassanic, Emanuela Toffoloa, Leda Paganinia, Alessandra Malleid, Daniela Braidab, Maria Passafaroc, Maurizio Popolid, Mariaelvina Salab,c, and Elena Battagliolia,c,1 aLaboratory of Neuroepigenetics, Dipartimento di Biotecnologie Mediche e Medicina Traslazionale and Centro di Eccellenza per le Malattie Neurodegenerative (CEND), Università degli Studi di Milano, 20133 Milan, Italy; bDipartimento di Biotecnologie Mediche e Medicina Traslazionale, Università degli Studi di Milano, 20129 Milan, Italy; cNational Research Council Institute of Neuroscience, 20129 Milan, Italy; and dLaboratory of Neuropsychopharmacology and Functional Neurogenomics, Dipartimento di Scienze Farmacologiche e Biomolecolari and CEND, Università degli Studi di Milano, 20133 Milan, Italy Edited by Huda Akil, University of Michigan, Ann Arbor, MI, and approved February 19, 2016 (received for review June 18, 2015) Behavioral changes in response to stressful stimuli can be con- of target genes (12–14) suggests that modulation of exon E8a trolled via adaptive epigenetic changes in neuronal gene expres- splicing may represent a mechanism for fine-tuning the transcrip- sion. Here we indicate a role for the transcriptional corepressor tion of selected targets. The generation of a mouse model lacking Lysine-Specific Demethylase 1 (LSD1) and its dominant-negative microexon E8a (neuroLSD1KO mice) allowed us to characterize
- 
												  The Neuropharmacogenomical Perspectives of Bipolar DisordersTINJAUAN PUSTAKA The Neuropharmacogenomical Perspectives of Bipolar Disorders Dito Anurogo 1S2 Biomedical Sciences, Faculty of Medicine, Universitas Gadjah Mada (FK UGM), Yogyakarta, Indonesia 2Indonesian Literacy Fellowship (ILF), UKM Jurnal Paradigma, FAM, IYHPS, HIMMPAS, ILC, HMP 3Health consultant in detik.com ABSTRACT Bipolar disorder (BD), also known as manic-depressive illness, is a brain disorder causing unusual shifts in mood, energy, activity levels, and the ability to carry out daily tasks, caused by multifactorial and enigmatic etiologies. The main objective of this overview is to review recent findings and critically evaluate BD based on neurogenomics and pharmacogenomics perspectives, through searching appropriate online database sources and relevant bibliographies. Recent studies and references explain genome-wide significant loci for bipolar disorder (polygenetics), potential biomarkers (apoptosis and neurotrophic factors, immuno-inflammatory factors, neurotrophins, BDNF, IGF-1, VEGF, etc.), dysregulation of immuno-inflammatory mechanisms, the role of neuroplasticity in the pathophysiology and treatment of BD, genetic effect of lithium response in BD. Stem cells, omics technologies, and optogenetics is considered to be effective strategies to overcome BD. Keywords: Biomarkers, bipolar disorder (BD), neurogenomics, neuropharmacogenomics, neuroplasticity, optogenetics, pharmacogenomics. ABSTRAK Bipolar disorder (BD), dikenal pula sebagai manic-depressive illness, adalah gangguan otak dengan etiologi enigmatik dan multifaktorial