Aviva Systems Biology MEF2C antibody - N-terminal region (ARP37342_T100) Product Number ARP37342_T100 Product Page http://www.avivasysbio.com/mef2c-antibody-n-terminal-region-arp37342-t100.html Product Name MEF2C antibody - N-terminal region (ARP37342_T100) Size 100 ul Gene Symbol MEF2C Alias Symbols Mef2, AV011172, 5430401D19Rik, 9930028G15Rik Protein Size (# AA) 432 amino acids Molecular Weight 48kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 17260 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Myocyte enhancer factor 2C Name Description This is a rabbit polyclonal antibody against MEF2C. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK Target Reference Shen,H., et al., (2006) Genes Dev. 20 (6), 675-688 Description of MEF2C is a transcription regulator of slow fiber Target Protein Interactions Vgll2; Hdac4; Nkx2-5; Hdac5; Phb2; KDM1A; Carm1; Ifrd1; Ncoa3; Ncoa2; Foxh1; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 1-2 days delivery International: 1-2 days *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-MEF2C (ARP37342_T100) antibody is Catalog # AAP37342 (Previous Catalog # AAPP09440) Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C Complete Anti-MEF2C (ARP37342_T100) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MEF2C.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Swissprot Id Q8CFN5-4 Protein Name Myocyte-specific enhancer factor 2C Publications Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). ICC/IF, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 18772864 Lombardi, R. et al. Genetic fate mapping identifies second heart field progenitor cells as a source of adipocytes in arrhythmogenic right ventricular cardiomyopathy. Circ. Res. 104, 1076-84 (2009). IHC, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 19359597 Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9- dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). ICC/IF, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 20335662 Escher, P., Schorderet, D. F. & Cottet, S. Altered expression of the transcription factor Mef2c during retinal degeneration in Rpe65-/- mice. Invest. Ophthalmol. Vis. Sci. 52, 5933-40 (2011). WB, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 21715356 Inagawa, K. et al. Induction of cardiomyocyte-like cells in infarct hearts by gene transfer of Gata4, Mef2c, and Tbx5. Circ. Res. 111, 1147-56 (2012). WB, ICC/IF, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 22931955 Law, S. K. et al. Regulation of multiple transcription factors by reactive oxygen species and effects of pro-inflammatory cytokines released during myocardial infarction on cardiac differentiation of embryonic stem cells. Int. J. Cardiol. 168, 3458-72 (2013). WB, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 23706318 Protein Accession NP_079558 # Purification Protein A purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MEF2C. Nucleotide NM_025282 Accession # Replacement Item This antibody may replace item sc-10794 from Santa Cruz Biotechnology. Conjugation ARP37342_T100-FITC Conjugated Options ARP37342_T100-HRP Conjugated ARP37342_T100-Biotin Conjugated CB Replacement sc-10794; sc-121588; sc-13266; sc-13268; sc-13917; sc-17785; sc-313; sc-365862; sc-55500 Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish Application WB Predicted Cow: 86%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: Homology Based 100%; Rat: 100%; Zebrafish: 86% on Immunogen Sequence
Image 1: Human Fetal Brain Host: Rabbit Target Name: MEF2C Sample Tissue: Human Fetal Brain Antibody Dilution: 1.0ug/ml
AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2