Download Author Version (PDF)
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Analysis of Trans Esnps Infers Regulatory Network Architecture
Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Anat Kreimer All rights reserved ABSTRACT Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer eSNPs are genetic variants associated with transcript expression levels. The characteristics of such variants highlight their importance and present a unique opportunity for studying gene regulation. eSNPs affect most genes and their cell type specificity can shed light on different processes that are activated in each cell. They can identify functional variants by connecting SNPs that are implicated in disease to a molecular mechanism. Examining eSNPs that are associated with distal genes can provide insights regarding the inference of regulatory networks but also presents challenges due to the high statistical burden of multiple testing. Such association studies allow: simultaneous investigation of many gene expression phenotypes without assuming any prior knowledge and identification of unknown regulators of gene expression while uncovering directionality. This thesis will focus on such distal eSNPs to map regulatory interactions between different loci and expose the architecture of the regulatory network defined by such interactions. We develop novel computational approaches and apply them to genetics-genomics data in human. We go beyond pairwise interactions to define network motifs, including regulatory modules and bi-fan structures, showing them to be prevalent in real data and exposing distinct attributes of such arrangements. We project eSNP associations onto a protein-protein interaction network to expose topological properties of eSNPs and their targets and highlight different modes of distal regulation. -
An Insight Into the Promoter Methylation of PHF20L1 and the Gene Association with Metastasis in Breast Cancer
Original papers An insight into the promoter methylation of PHF20L1 and the gene association with metastasis in breast cancer Jose Alfredo Sierra-Ramirez1,B,F, Emmanuel Seseña-Mendez2,E,F, Marycarmen Godinez-Victoria1,B,F, Marta Elena Hernandez-Caballero2,A,C–E 1 Medical School, Graduate Section, National Polytechnic Institute, Mexico City, Mexico 2 Department of Biomedicine, Faculty of Medicine, Meritorious Autonomous University of Puebla (BUAP), Puebla, Mexico A – research concept and design; B – collection and/or assembly of data; C – data analysis and interpretation; D – writing the article; E – critical revision of the article; F – final approval of the article Advances in Clinical and Experimental Medicine, ISSN 1899–5276 (print), ISSN 2451–2680 (online) Adv Clin Exp Med. 2021;30(5):507–515 Address for correspondence Abstract Marta Elena Hernandez-Caballero E-mail: [email protected] Background. Plant homeodomain finger protein 20-like 1 PHF20L1( ) is a protein reader involved in epi- genetic regulation that binds monomethyl-lysine. An oncogenic function has been attributed to PHF20L1 Funding sources This work was supported by the Instituto Politécnico but its role in breast cancer (BC) is not clear. Nacional (SIP20195078) and Benemérita Universidad Objectives. To explore PHF20L1 promoter methylation and comprehensive bioinformatics analysis to improve Autónoma de Puebla PRODEP (BUAP-CA-159). understanding of the role of PHF20L1 in BC. Conflict of interest Materials and methods. Seventy-four BC samples and 16 control samples were converted using sodium None declared bisulfite treatment and analyzed with methylation-specific polymerase chain reaction (PCR). Bioinformatic Acknowledgements analysis was performed in the BC dataset using The Cancer Genome Atlas (TCGA) trough data visualized and We thank Efrain Atenco for assistance with R software. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Genome-Wide DNA Methylation Profiling Identifies Differential Methylation in Uninvolved Psoriatic Epidermis
Genome-Wide DNA Methylation Profiling Identifies Differential Methylation in Uninvolved Psoriatic Epidermis Deepti Verma, Anna-Karin Ekman, Cecilia Bivik Eding and Charlotta Enerbäck The self-archived postprint version of this journal article is available at Linköping University Institutional Repository (DiVA): http://urn.kb.se/resolve?urn=urn:nbn:se:liu:diva-147791 N.B.: When citing this work, cite the original publication. Verma, D., Ekman, A., Bivik Eding, C., Enerbäck, C., (2018), Genome-Wide DNA Methylation Profiling Identifies Differential Methylation in Uninvolved Psoriatic Epidermis, Journal of Investigative Dermatology, 138(5), 1088-1093. https://doi.org/10.1016/j.jid.2017.11.036 Original publication available at: https://doi.org/10.1016/j.jid.2017.11.036 Copyright: Elsevier http://www.elsevier.com/ Genome-Wide DNA Methylation Profiling Identifies Differential Methylation in Uninvolved Psoriatic Epidermis Deepti Verma*a, Anna-Karin Ekman*a, Cecilia Bivik Edinga and Charlotta Enerbäcka *Authors contributed equally aIngrid Asp Psoriasis Research Center, Department of Clinical and Experimental Medicine, Division of Dermatology, Linköping University, Linköping, Sweden Corresponding author: Charlotta Enerbäck Ingrid Asp Psoriasis Research Center, Department of Clinical and Experimental Medicine, Linköping University SE-581 85 Linköping, Sweden Phone: +46 10 103 7429 E-mail: [email protected] Short title Differential methylation in psoriasis Abbreviations CGI, CpG island; DMS, differentially methylated site; RRBS, reduced representation bisulphite sequencing Keywords (max 6) psoriasis, epidermis, methylation, Wnt, susceptibility, expression 1 ABSTRACT Psoriasis is a chronic inflammatory skin disease with both local and systemic components. Genome-wide approaches have identified more than 60 psoriasis-susceptibility loci, but genes are estimated to explain only one third of the heritability in psoriasis, suggesting additional, yet unidentified, sources of heritability. -
Arp37342 T100
Aviva Systems Biology MEF2C antibody - N-terminal region (ARP37342_T100) Product Number ARP37342_T100 Product Page http://www.avivasysbio.com/mef2c-antibody-n-terminal-region-arp37342-t100.html Product Name MEF2C antibody - N-terminal region (ARP37342_T100) Size 100 ul Gene Symbol MEF2C Alias Symbols Mef2, AV011172, 5430401D19Rik, 9930028G15Rik Protein Size (# AA) 432 amino acids Molecular Weight 48kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 17260 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Myocyte enhancer factor 2C Name Description This is a rabbit polyclonal antibody against MEF2C. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK Target Reference Shen,H., et al., (2006) Genes Dev. 20 (6), 675-688 Description of MEF2C is a transcription regulator of slow fiber Target Protein Interactions Vgll2; Hdac4; Nkx2-5; Hdac5; Phb2; KDM1A; Carm1; Ifrd1; Ncoa3; Ncoa2; Foxh1; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 1-2 days delivery International: 1-2 days *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. -
Regulation of Neuronal Gene Expression and Survival by Basal NMDA Receptor Activity: a Role for Histone Deacetylase 4
The Journal of Neuroscience, November 12, 2014 • 34(46):15327–15339 • 15327 Cellular/Molecular Regulation of Neuronal Gene Expression and Survival by Basal NMDA Receptor Activity: A Role for Histone Deacetylase 4 Yelin Chen,1 Yuanyuan Wang,1 Zora Modrusan,3 Morgan Sheng,1 and Joshua S. Kaminker1,2 Departments of 1Neuroscience, 2Bioinformatics and Computational Biology, and 3Molecular Biology, Genentech Inc., South San Francisco, California 94080 Neuronal gene expression is modulated by activity via calcium-permeable receptors such as NMDA receptors (NMDARs). While gene expression changes downstream of evoked NMDAR activity have been well studied, much less is known about gene expression changes that occur under conditions of basal neuronal activity. In mouse dissociated hippocampal neuronal cultures, we found that a broad NMDAR antagonist, AP5, induced robust gene expression changes under basal activity, but subtype-specific antagonists did not. While some of the gene expression changes are also known to be downstream of stimulated NMDAR activity, others appear specific to basal NMDARactivity.ThegenesalteredbyAP5treatmentofbasalcultureswereenrichedforpathwaysrelatedtoclassIIahistonedeacetylases (HDACs), apoptosis, and synapse-related signaling. Specifically, AP5 altered the expression of all three class IIa HDACs that are highly expressed in the brain, HDAC4, HDAC5, and HDAC9, and also induced nuclear accumulation of HDAC4. HDAC4 knockdown abolished a subset of the gene expression changes induced by AP5, and led to neuronal death under -
Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice
University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia. -
TASOR Is a Pseudo-PARP That Directs HUSH Complex Assembly and Epigenetic Transposon Control
Lawrence Berkeley National Laboratory Recent Work Title TASOR is a pseudo-PARP that directs HUSH complex assembly and epigenetic transposon control. Permalink https://escholarship.org/uc/item/6021r2cd Journal Nature communications, 11(1) ISSN 2041-1723 Authors Douse, Christopher H Tchasovnikarova, Iva A Timms, Richard T et al. Publication Date 2020-10-02 DOI 10.1038/s41467-020-18761-6 Peer reviewed eScholarship.org Powered by the California Digital Library University of California ARTICLE https://doi.org/10.1038/s41467-020-18761-6 OPEN TASOR is a pseudo-PARP that directs HUSH complex assembly and epigenetic transposon control Christopher H. Douse 1,4,9, Iva A. Tchasovnikarova2,5,9, Richard T. Timms 2,9, Anna V. Protasio 2,6, Marta Seczynska2, Daniil M. Prigozhin 1,7, Anna Albecka1,2,8, Jane Wagstaff3, James C. Williamson2, ✉ ✉ Stefan M. V. Freund3, Paul J. Lehner 2 & Yorgo Modis 1,2 1234567890():,; The HUSH complex represses retroviruses, transposons and genes to maintain the integrity of vertebrate genomes. HUSH regulates deposition of the epigenetic mark H3K9me3, but how its three core subunits — TASOR, MPP8 and Periphilin — contribute to assembly and targeting of the complex remains unknown. Here, we define the biochemical basis of HUSH assembly and find that its modular architecture resembles the yeast RNA-induced tran- scriptional silencing complex. TASOR, the central HUSH subunit, associates with RNA pro- cessing components. TASOR is required for H3K9me3 deposition over LINE-1 repeats and repetitive exons in transcribed genes. In the context of previous studies, this suggests that an RNA intermediate is important for HUSH activity. We dissect the TASOR and MPP8 domains necessary for transgene repression. -
Noelia Díaz Blanco
Effects of environmental factors on the gonadal transcriptome of European sea bass (Dicentrarchus labrax), juvenile growth and sex ratios Noelia Díaz Blanco Ph.D. thesis 2014 Submitted in partial fulfillment of the requirements for the Ph.D. degree from the Universitat Pompeu Fabra (UPF). This work has been carried out at the Group of Biology of Reproduction (GBR), at the Department of Renewable Marine Resources of the Institute of Marine Sciences (ICM-CSIC). Thesis supervisor: Dr. Francesc Piferrer Professor d’Investigació Institut de Ciències del Mar (ICM-CSIC) i ii A mis padres A Xavi iii iv Acknowledgements This thesis has been made possible by the support of many people who in one way or another, many times unknowingly, gave me the strength to overcome this "long and winding road". First of all, I would like to thank my supervisor, Dr. Francesc Piferrer, for his patience, guidance and wise advice throughout all this Ph.D. experience. But above all, for the trust he placed on me almost seven years ago when he offered me the opportunity to be part of his team. Thanks also for teaching me how to question always everything, for sharing with me your enthusiasm for science and for giving me the opportunity of learning from you by participating in many projects, collaborations and scientific meetings. I am also thankful to my colleagues (former and present Group of Biology of Reproduction members) for your support and encouragement throughout this journey. To the “exGBRs”, thanks for helping me with my first steps into this world. Working as an undergrad with you Dr. -
RNA Editing at Baseline and Following Endoplasmic Reticulum Stress
RNA Editing at Baseline and Following Endoplasmic Reticulum Stress By Allison Leigh Richards A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Human Genetics) in The University of Michigan 2015 Doctoral Committee: Professor Vivian G. Cheung, Chair Assistant Professor Santhi K. Ganesh Professor David Ginsburg Professor Daniel J. Klionsky Dedication To my father, mother, and Matt without whom I would never have made it ii Acknowledgements Thank you first and foremost to my dissertation mentor, Dr. Vivian Cheung. I have learned so much from you over the past several years including presentation skills such as never sighing and never saying “as you can see…” You have taught me how to think outside the box and how to create and explain my story to others. I would not be where I am today without your help and guidance. Thank you to the members of my dissertation committee (Drs. Santhi Ganesh, David Ginsburg and Daniel Klionsky) for all of your advice and support. I would also like to thank the entire Human Genetics Program, and especially JoAnn Sekiguchi and Karen Grahl, for welcoming me to the University of Michigan and making my transition so much easier. Thank you to Michael Boehnke and the Genome Science Training Program for supporting my work. A very special thank you to all of the members of the Cheung lab, past and present. Thank you to Xiaorong Wang for all of your help from the bench to advice on my career. Thank you to Zhengwei Zhu who has helped me immensely throughout my thesis even through my panic. -
Usbiological Datasheet
ABI2 (ABI-2, ABI2B, AblBP3, AIP-1, argBPIA, SSH3BP2, ARGBPIA, Abl interactor 2) Catalog number 144114 Supplier United States Biological ABI2 (ABL Interactor 2), is a protein that in humans is encoded by the ABI2 gene. By analysis of a YAC and a BAC, Machado et al. (2000) mapped the ABI2 gene to 2q31-q33. ABI2 possesses a basic N terminus with homology to a homeodomain protein; a central serine-rich region; 3 PEST sequences, which are implicated in susceptibility to protein degradation; several proline-rich stretches; and an acidic C terminus with multiple phosphorylation sites and an SH3 domain. Dai and Pendergast (1995) suggested that the ABI proteins may function to coordinate the cytoplasmic and nuclear functions of the ABL1 tyrosine kinase. UniProt Number Q9NYB9 Gene ID ABI2 Applications Suitable for use in Western Blot. Recommended Dilution Optimal dilutions to be determined by the researcher. Storage and Handling Store at -20˚C for one year. After reconstitution, store at 4˚C for one month. Can also be aliquoted and stored frozen at -20˚C for long term. Avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human ABI2, identical to the related mouse and rat sequences. Formulation Supplied as a lyophilized powder. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3. Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. -
Quantitative Genetics of Gene Expression and Methylation in the Chicken
Andrey Höglund Linköping Studies In Science and Technology Dissertation No. 2097 FACULTY OF SCIENCE AND ENGINEERING Linköping Studies in Science and Technology, Dissertation No. 2097, 2020 Quantitative genetics Department of Physics, Chemistry and Biology Linköping University SE-581 83 Linköping, Sweden of gene expression Quantitative genetics of gene expression and methylation the in chicken www.liu.se and methylation in the chicken Andrey Höglund 2020 Linköping studies in science and technology, Dissertation No. 2097 Quantitative genetics of gene expression and methylation in the chicken Andrey Höglund IFM Biology Department of Physics, Chemistry and Biology Linköping University, SE-581 83, Linköping, Sweden Linköping 2020 Cover picture: Hanne Løvlie Cover illustration: Jan Sulocki During the course of the research underlying this thesis, Andrey Höglund was enrolled in Forum Scientium, a multidisciplinary doctoral program at Linköping University, Sweden. Linköping studies in science and technology, Dissertation No. 2097 Quantitative genetics of gene expression and methylation in the chicken Andrey Höglund ISSN: 0345-7524 ISBN: 978-91-7929-789-3 Printed in Sweden by LiU-tryck, Linköping, 2020 Abstract In quantitative genetics the relationship between genetic and phenotypic variation is investigated. The identification of these variants can bring improvements to selective breeding, allow for transgenic techniques to be applied in agricultural settings and assess the risk of polygenic diseases. To locate these variants, a linkage-based quantitative trait locus (QTL) approach can be applied. In this thesis, a chicken intercross population between wild and domestic birds have been used for QTL mapping of phenotypes such as comb, body and brain size, bone density and anxiety behaviour.