KATNA1 Purified Maxpab Mouse Polyclonal Antibody (B01P)

Total Page：16

File Type：pdf, Size：1020Kb

KATNA1 purified MaxPab mouse polyclonal antibody (B01P) Catalog # : H00011104-B01P 規格 : [ 50 ug ] List All Specification Application Image Product Mouse polyclonal antibody raised against a full-length human KATNA1 Western Blot (Cell lysate) Description: protein. Immunogen: KATNA1 (AAH50428.1, 1 a.a. ~ 311 a.a) full-length human protein. Sequence: MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQ QKWQQVWQEINVEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVW enlarge SMPVPVERRPSPGPRKRQSSQYSDPKSHGNRPSTTVRVHRSSAQNVHN DRGKAVRCREKKEQNKGREEKGVLMVGPPGTGKTLLAKAVATECKTTF Western Blot (Cell lysate) FNVSSSTLTSKYRGESEKLVRLLFEMARFYSPATIFIDEIDSICSRRGTSEE HEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATNFPWDIDEALR RRLEKRIYIPLPSGMRP Host: Mouse Reactivity: Human, Mouse, Rat enlarge Quality Control Antibody reactive against mammalian transfected lysate. Western Blot (Cell lysate) Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: enlarge MSDS: Download Western Blot (Transfected lysate) Datasheet: Download Applications Western Blot (Cell lysate) enlarge KATNA1 MaxPab polyclonal antibody. Western Blot analysis of KATNA1 expression in PC- 12. Protocol Download Western Blot (Cell lysate) Page 1 of 3 2016/5/23 KATNA1 MaxPab polyclonal antibody. Western Blot analysis of KATNA1 expression in Raw 264.7. Protocol Download Western Blot (Cell lysate) KATNA1 MaxPab polyclonal antibody. Western Blot analysis of KATNA1 expression in NIH/3T3. Protocol Download Western Blot (Transfected lysate) Western Blot analysis of KATNA1 expression in transfected 293T cell line (H00011104- T03) by KATNA1 MaxPab polyclonal antibody. Lane 1: KATNA1 transfected lysate(34.32 KDa). Lane 2: Non-transfected lysate. Protocol Download Gene Information Entrez GeneID: 11104 GeneBank BC050428.1 Accession#: Protein AAH50428.1 Accession#: Gene Name: KATNA1 Page 2 of 3 2016/5/23 Gene Alias: - Gene katanin p60 (ATPase-containing) subunit A 1 Description: Omim ID: 606696 Gene Ontology: Hyperlink Gene Summary: Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. This gene encodes the p80 subunit. This protein is a member of the AAA family of ATPases. [provided by RefSeq Other OTTHUMP00000017392,katanin p60 subunit A 1 Designations: 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 3 of 3 2016/5/23.

Copy Link

Recommended publications

KIAA0556 Is a Novel Ciliary Basal Body Component Mutated in Joubert Syndrome Anna A
Sanders et al. Genome Biology (2015) 16:293 DOI 10.1186/s13059-015-0858-z RESEARCH Open Access KIAA0556 is a novel ciliary basal body component mutated in Joubert syndrome Anna A. W. M. Sanders1†, Erik de Vrieze2,3†, Anas M. Alazami4†, Fatema Alzahrani4, Erik B. Malarkey5, Nasrin Sorusch6, Lars Tebbe6, Stefanie Kuhns1, Teunis J. P. van Dam7, Amal Alhashem8, Brahim Tabarki8, Qianhao Lu9,10, Nils J. Lambacher1, Julie E. Kennedy1, Rachel V. Bowie1, Lisette Hetterschijt2,3, Sylvia van Beersum3,11, Jeroen van Reeuwijk3,11, Karsten Boldt12, Hannie Kremer2,3,11, Robert A. Kesterson13, Dorota Monies4, Mohamed Abouelhoda4, Ronald Roepman3,11, Martijn H. Huynen7, Marius Ueffing12, Rob B. Russell9,10, Uwe Wolfrum6, Bradley K. Yoder5, Erwin van Wijk2,3*, Fowzan S. Alkuraya4,14* and Oliver E. Blacque1* Abstract Background: Joubert syndrome (JBTS) and related disorders are defined by cerebellar malformation (molar tooth sign), together with neurological symptoms of variable expressivity. The ciliary basis of Joubert syndrome related disorders frequently extends the phenotype to tissues such as the eye, kidney, skeleton and craniofacial structures. Results: Using autozygome and exome analyses, we identified a null mutation in KIAA0556 in a multiplex consanguineous family with hallmark features of mild Joubert syndrome. Patient-derived fibroblasts displayed reduced ciliogenesis potential and abnormally elongated cilia. Investigation of disease pathophysiology revealed that Kiaa0556-/- null mice possess a Joubert syndrome-associated brain-restricted phenotype. Functional studies in Caenorhabditis elegans nematodes and cultured human cells support a conserved ciliary role for KIAA0556 linked to microtubule regulation. First, nematode KIAA0556 is expressed almost exclusively in ciliated cells, and the worm and human KIAA0556 proteins are enriched at the ciliary base.
[Show full text]
Dual Proteome-Scale Networks Reveal Cell-Specific Remodeling of the Human Interactome
bioRxiv preprint doi: https://doi.org/10.1101/2020.01.19.905109; this version posted January 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Dual Proteome-scale Networks Reveal Cell-specific Remodeling of the Human Interactome Edward L. Huttlin1*, Raphael J. Bruckner1,3, Jose Navarrete-Perea1, Joe R. Cannon1,4, Kurt Baltier1,5, Fana Gebreab1, Melanie P. Gygi1, Alexandra Thornock1, Gabriela Zarraga1,6, Stanley Tam1,7, John Szpyt1, Alexandra Panov1, Hannah Parzen1,8, Sipei Fu1, Arvene Golbazi1, Eila Maenpaa1, Keegan Stricker1, Sanjukta Guha Thakurta1, Ramin Rad1, Joshua Pan2, David P. Nusinow1, Joao A. Paulo1, Devin K. Schweppe1, Laura Pontano Vaites1, J. Wade Harper1*, Steven P. Gygi1*# 1Department of Cell Biology, Harvard Medical School, Boston, MA, 02115, USA. 2Broad Institute, Cambridge, MA, 02142, USA. 3Present address: ICCB-Longwood Screening Facility, Harvard Medical School, Boston, MA, 02115, USA. 4Present address: Merck, West Point, PA, 19486, USA. 5Present address: IQ Proteomics, Cambridge, MA, 02139, USA. 6Present address: Vor Biopharma, Cambridge, MA, 02142, USA. 7Present address: Rubius Therapeutics, Cambridge, MA, 02139, USA. 8Present address: RPS North America, South Kingstown, RI, 02879, USA. *Correspondence: [email protected] (E.L.H.), [email protected] (J.W.H.), [email protected] (S.P.G.) #Lead Contact: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2020.01.19.905109; this version posted January 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder.
[Show full text]
Microtubule-Severing Enzymes at the Cutting Edge
Commentary 2561 Microtubule-severing enzymes at the cutting edge David J. Sharp1,* and Jennifer L. Ross2 1Department of Physiology and Biophysics, Albert Einstein College of Medicine, 1300 Morris Park Avenue, Bronx, NY 10461, USA 2Department of Physics, University of Massachusetts-Amherst, 302 Hasbrouck Laboratory, Amherst, MA 01003, USA *Author for correspondence ([email protected]) Journal of Cell Science 125, 2561–2569 ß 2012. Published by The Company of Biologists Ltd doi: 10.1242/jcs.101139 Summary ATP-dependent severing of microtubules was first reported in Xenopus laevis egg extracts in 1991. Two years later this observation led to the purification of the first known microtubule-severing enzyme, katanin. Katanin homologs have now been identified throughout the animal kingdom and in plants. Moreover, members of two closely related enzyme subfamilies, spastin and fidgetin, have been found to sever microtubules and might act alongside katanins in some contexts (Roll-Mecak and McNally, 2010; Yu et al., 2008; Zhang et al., 2007). Over the past few years, it has become clear that microtubule-severing enzymes contribute to a wide range of cellular activities including mitosis and meiosis, morphogenesis, cilia biogenesis and disassembly, and migration. Thus, this group of enzymes is revealing itself to be among the most important of the microtubule regulators. This Commentary focuses on our growing understanding of how microtubule-severing enzymes contribute to the organization and dynamics of diverse microtubule arrays, as well as the structural and biophysical characteristics that afford them the unique capacity to catalyze the removal of tubulin from the interior microtubule lattice. Our goal is to provide a broader perspective, focusing on a limited number of particularly informative, representative and/or timely findings.
[Show full text]
Chromosome Substitution Strain Assessment of a Huntington's
Mamm Genome DOI 10.1007/s00335-014-9552-9 Chromosome substitution strain assessment of a Huntington’s disease modifier locus Eliana Marisa Ramos • Marina Kovalenko • Jolene R. Guide • Jason St. Claire • Tammy Gillis • Jayalakshmi S. Mysore • Jorge Sequeiros • Vanessa C. Wheeler • Isabel Alonso • Marcy E. MacDonald Received: 26 August 2014 / Accepted: 3 December 2014 Ó The Author(s) 2015. This article is published with open access at Springerlink.com Abstract Huntington’s disease (HD) is a dominant neu- with the human 6q23–24 region, is derived from the A/J rodegenerative disorder that is due to expansion of an (AJ) strain. Crosses were performed to assess the possi- unstable HTT CAG repeat for which genome-wide genetic bility of dominantly acting chr10 AJ-B6J variants of strong scans are now revealing chromosome regions that contain effect that may modulate CAG-dependent HdhQ111/? phe- disease-modifying genes. We have explored a novel notypes. Testing of F1 progeny confirmed that a single AJ human–mouse cross-species functional prioritisation chromosome had a significant effect on the rate of body approach, by evaluating the HD modifier 6q23–24 linkage weight gain and in HdhQ111 mice the AJ chromosome was interval. This unbiased strategy employs C57BL/6J (B6J) associated subtle alterations in somatic CAG instability in HdhQ111 knock-in mice, replicates of the HD mutation, and the liver and the formation of intra-nuclear inclusions, as the C57BL/6J-chr10A/J/NaJ chromosome substitution strain well as DARPP-32 levels, in the striatum. These findings in (CSS10), in which only chromosome 10 (chr10), in synteny relatively small cohorts are suggestive of dominant chr10 AJ-B6 variants that may modify effects of the CAG expansion, and encourage a larger study with CSS10 and sub-strains.
[Show full text]
Aspm (NM 009791) Mouse Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR219160 Aspm (NM_009791) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Aspm (NM_009791) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Aspm Synonyms: Calmbp1; D330028K02Rik; MCPH5; Sha1 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MR219160 representing NM_009791 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGACGATGCAGGCAGCCTCCTGCCCAGAGGAGAGGGGGCGGCGGGCGCGACCAGATCCTGAGGCCG GGGACCCGTCTCCGCCGGTGCTGTTGCTCAGCCACTTCTGCGGCGTTCCCTTCCTCTGCTTCGGGGATGT CCGCGTGGGCACGTCGCGGACGCGGTCTCTGGTCCTGCACAACCCGCACGAGGAACCTCTGCAGGTGGAG CTGTCGCTGCTGCGCGCCGCAGGCCAGGGCTTCAGCGTGGCGCCGAACCGCTGCGAGCTGAAGCCTAAAG AAAAACTTACCATTTCCGTTACCTGGACGCCACTGCGAGAAGGGGGAGTGAGGGAGATTGTCACATTTCT TGTAAATGATTTCCTGAAGCACCAGGCTATATTACTAGGAAATGCAGAAGAGCCTAAGAAGAAAAAGAGA AGTCTTTGGAATACCAGTAAGAAGATTCCAGCCTCTTCAAAACATACAAAAAGGACTTCCAAAAACCAAC ATTTTAATGAATCATTTACTATTTCACAAAAAGACAGAATTAGGAGCCCACTGCAGCCTTGTGAAAATCT GGCTATGAGTGAATGCTCTTCCCCAACAGAAAACAAAGTCCCCACCCCATCCATTAGTCCTATTAGAGAA TGCCAGAGTGAAACTTGCTTGCCACTGTTTTTACGCGAGTCCACTGCCTATTCATCTCTTCATGAATCTG AAAATACACAAAATTTAAAAGTACAAGATGCCAGCATTTCACAAACTTTTGATTTTAATGAGGAAGTCGC AAATGAAACTTTTATTAATCCCATTAGTGTCTGTCACCAGAGTGAAGGGGATAGGAAACTCACGCTTGCC CCAAACTGTTCTTCACCTTTGAATAGTACACAGACCCAAATACACTTTCTAAGTCCAGATTCTTTTGTAA
[Show full text]
Genetic and Chemical Modulation of Spastin-Dependent Axon Outgrowth
Disease Models & Mechanisms 3, 743-751 (2010) doi:10.1242/dmm.004002 © 2010. Published by The Company of Biologists Ltd RESEARCH ARTICLE Genetic and chemical modulation of spastin-dependent axon outgrowth in zebrafish embryos indicates a role for impaired microtubule dynamics in hereditary spastic paraplegia Richard Butler1,*,‡, Jonathan D. Wood1,2,*,§, Jennifer A. Landers1 and Vincent T. Cunliffe1,§ SUMMARY Mutations in the SPAST (SPG4) gene, which encodes the microtubule-severing protein spastin, are the most common cause of autosomal dominant hereditary spastic paraplegia (HSP). Following on from previous work in our laboratory showing that spastin is required for axon outgrowth, we report here that the related microtubule-severing protein katanin is also required for axon outgrowth in vivo. Using confocal time-lapse imaging, we have identified requirements for spastin and katanin in maintaining normal axonal microtubule dynamics and growth cone motility in vivo, supporting a model in which microtubule severing is required for concerted growth of neuronal microtubules. Simultaneous knockdown of spastin and katanin caused a more severe phenotype than did individual knockdown of either gene, suggesting that they have different but related functions in supporting axon outgrowth. In addition, the microtubule-destabilising drug nocodazole abolished microtubule dynamics and growth cone motility, and enhanced phenotypic severity in spast-knockdown zebrafish embryos. Thus, disruption of microtubule dynamics might underlie neuronal DMM dysfunction
[Show full text]
Models, Regulations, and Functions of Microtubule Severing by Katanin
International Scholarly Research Network ISRN Molecular Biology Volume 2012, Article ID 596289, 14 pages doi:10.5402/2012/596289 Review Article Models, Regulations, and Functions of Microtubule Severing by Katanin Debasish Kumar Ghosh, Debdeep Dasgupta, and Abhishek Guha Department of Biological Sciences, Indian Institute of Science Education and Research, Kolkata, Mohanpur, Nadia 741252, India Correspondence should be addressed to Debasish Kumar Ghosh, [email protected] Received 1 August 2012; Accepted 20 August 2012 Academic Editors: H. Hashimoto, A. J. Molenaar, and A. Montecucco Copyright © 2012 Debasish Kumar Ghosh et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Regulation of microtubule dynamics depends on stochastic balance between polymerization and severing process which lead to differential spatiotemporal abundance and distribution of microtubules during cell development, differentiation, and morphogenesis. Microtubule severing by a conserved AAA family protein Katanin has emerged as an important microtubule architecture modulating process in cellular functions like division, migration, shaping and so on. Regulated by several factors, Katanin manifests connective crosstalks in network motifs in regulation of anisotropic severing pattern of microtubule protofilaments in cell type and stage dependent way. Mechanisms of structural disintegration of microtubules by Katanin involve heterogeneous mechanochemical processes and sensitivity of microtubules to Katanin plays significant roles in mitosis/meiosis, neurogenesis, cilia/flagella formation, cell wall development and so on. Deregulated and uncoordinated expression of Katanin has been shown to have implications in pathophysiological conditions. In this paper, we highlight mechanistic models and regulations of microtubule severing by Katanin in context of structure and various functions of Katanin in different organisms.
[Show full text]
Rhoa-Gtpase Modulates Neurite Outgrowth by Regulating the Expression of Spastin and P60-Katanin
cells Article RhoA-GTPase Modulates Neurite Outgrowth by Regulating the Expression of Spastin and p60-Katanin Dandan Tan 1,2,3, Haowen Zhang 1,2, Junyao Deng 1,2, Jingmin Liu 1,2, Jinkun Wen 1,2, Lixia Li 1,2, Xianghai Wang 1,2,4, Mengjie Pan 1,2, Xiaofang Hu 1,2 and Jiasong Guo 1,2,4,5,* 1 Guangdong Provincial Key Laboratory of Construction and Detection in Tissue Engineering, Southern Medical University, Guangzhou 510515, China; [email protected] (D.T.); [email protected] (H.Z.); [email protected] (J.D.); [email protected] (J.L.); [email protected] (J.W.); [email protected] (L.L.); [email protected] (X.W.); [email protected] (M.P.); [email protected] (X.H.) 2 Department of Histology and Embryology, Southern Medical University, Guangzhou 510515, China 3 Department of Human Anatomy, Guangdong Medical University, Zhanjiang 524023, China 4 Guangzhou Regenerative Medicine and Health Guangdong Laboratory, Guangzhou 510515, China 5 Key Laboratory of Mental Health of the Ministry of Education, Guangdong-Hong Kong-Macao Greater Bay Area Center for Brain Science and Brain-Inspired Intelligence, Guangdong Province Key Laboratory of Psychiatric Disorders, Guangzhou 510515, China * Correspondence: [email protected]; Tel.: +86-20-6164-8210 Received: 18 November 2019; Accepted: 14 January 2020; Published: 16 January 2020 Abstract: RhoA-GTPase (RhoA) is widely regarded as a key molecular switch to inhibit neurite outgrowth by rigidifying the actin cytoskeleton. However, during neurite outgrowth, whether and how microtubule dynamics are regulated by RhoA remains to be elucidated. Herein, CT04 and Y27632 were used to inactivate RhoA and its downstream eﬀector Rho-associated coiled coil-forming kinase (ROCK), while the RhoAQ63L lentiviral vector was utilized to overexpress the constitutively activated RhoA in dorsal root ganglion (DRG) neurons or neuronal diﬀerentiated PC12 cells.
[Show full text]
UCLA Previously Published Works
UCLA UCLA Previously Published Works Title A unique insertion in STARD9's motor domain regulates its stability. Permalink https://escholarship.org/uc/item/8km7v0gk Journal Molecular biology of the cell, 26(3) ISSN 1059-1524 Authors Senese, Silvia Cheung, Keith Lo, Yu-Chen et al. Publication Date 2015-02-01 DOI 10.1091/mbc.e14-03-0829 Peer reviewed eScholarship.org Powered by the California Digital Library University of California M BoC | ARTICLE A unique insertion in STARD9’s motor domain regulates its stability Silvia Senesea, Keith Cheunga, Yu-Chen Loa,b, Ankur A. Gholkara, Xiaoyu Xiaa, James A. Wohlschlegelc,d,e, and Jorge Z. Torresa,d,e aDepartment of Chemistry and Biochemistry, bProgram in Bioengineering, cDepartment of Biological Chemistry, David Geffen School of Medicine, dJonsson Comprehensive Cancer Center, and eMolecular Biology Institute, University of California, Los Angeles, Los Angeles, CA 90095 ABSTRACT STARD9 is a largely uncharacterized mitotic kinesin and putative cancer target Monitoring Editor that is critical for regulating pericentriolar material cohesion during bipolar spindle assembly. Mark J. Solomon To begin to understand the mechanisms regulating STARD9 function and their importance to Yale University cell division, we took a multidisciplinary approach to define the cis and trans factors that Received: Mar 24, 2014 regulate the stability of the STARD9 motor domain. We show that, unlike the other ∼50 mam- Revised: Nov 21, 2014 malian kinesins, STARD9 contains an insertion in loop 12 of its motor domain (MD). Working Accepted: Dec 2, 2014 with the STARD9-MD, we show that it is phosphorylated in mitosis by mitotic kinases that include Plk1.
[Show full text]
Transient Tetraploidy As a Route to Chromosomal Instability
Dissertation zur Erlangung des Doktorgrades der Fakultät für Biologie der Ludwig-Maximilians-Universität München Transient tetraploidy as a route to chromosomal instability vorgelegt von Anastasia Yurievna Kuznetsova aus Moskau, Russland 2013 Erklärung Die vorliegende Arbeit wurde zwischen October 2008 und Mai 2013 unter Anleitung von Frau. Dr. Zuzana Storchova - - Martinsried Wesentliche Teile dieser Arbeit sind in folgenden Publikationen veröffentlicht: Abnormal mitosis triggers p53-dependent cell cycle arrest in human tetraploid cells Kuffer C, Kuznetsova AY, Zuzana Storchova. Chromosoma. DOI 10.1007/s00412-013-0414-0 2 Ehrenwörtliche Versicherung Diese Dissertation wurde selbstständig, ohne unerlaubte Hilfe erarbeitet. Martinsried, am Anastasia Kuznetsova Dissertation eingereicht am: 1. Gutachter: Herr Prof. Dr. Stefan Jentsch 2. Gutachter: Herr Prof. Dr. Peter Becker Mündliche Prüfung am: 3 Table of Contents Summary ......................................................................................................................... 7 Introduction ..................................................................................................................... 8 1. Tetraploidy: causes and proliferation control. ....................................................... 8 2. Tetraploid state as an intermediate to aneuploidy, chromosomal instability and tumorigenesis. ........................................................................................................... 11 3. Molecular mechanisms triggering CIN. ..............................................................
[Show full text]
SPEF2 Functions in Microtubule-Mediated Transport in Elongating Spermatids to Ensure Proper Male Germ Cell Differentiation Mari S
© 2017. Published by The Company of Biologists Ltd | Development (2017) 144, 2683-2693 doi:10.1242/dev.152108 RESEARCH ARTICLE SPEF2 functions in microtubule-mediated transport in elongating spermatids to ensure proper male germ cell differentiation Mari S. Lehti1,2,*, Fu-Ping Zhang2,3,*, Noora Kotaja2,* and Anu Sironen1,‡,§ ABSTRACT 2006, 2002). Mutations in the Spef2 gene (an amino acid substitution Sperm differentiation requires specific protein transport for correct within exon 3 and a nonsense mutation within exon 28) in the big giant sperm tail formation and head shaping. A transient microtubular head (bgh) mouse model caused a primary ciliary dyskinesia (PCD)- structure, the manchette, appears around the differentiating like phenotype, including hydrocephalus, sinusitis and male infertility spermatid head and serves as a platform for protein transport to the (Sironen et al., 2011). Detailed analysis of spermatogenesis in both pig growing tail. Sperm flagellar 2 (SPEF2) is known to be essential for and mouse models revealed axonemal abnormalities, including defects sperm tail development. In this study we investigated the function of in central pair (CP) structure and the complete disorganization of the SPEF2 during spermatogenesis using a male germ cell-specific sperm tail (Sironen et al., 2011). A role of SPEF2 in protein transport Spef2 knockout mouse model. In addition to defects in sperm tail has been postulated owing to its known interaction and colocalization development, we observed a duplication of the basal body and failure with intraflagellar transport 20 (IFT20). During spermatogenesis, in manchette migration resulting in an abnormal head shape. We IFT20 and SPEF2 colocalize in the Golgi complex of late identified cytoplasmic dynein 1 and GOLGA3 as novel interaction spermatocytes and round spermatids and in the manchette and basal partners for SPEF2.
[Show full text]
Distinct Effects of Ionizing Radiation on in Vivo Murine Kidney and Brain Normal Tissue Gene Expression Weiling Zhao,1Eric Y
Cancer Therapy: Preclinical Distinct Effects of Ionizing Radiation on In vivo Murine Kidney and Brain Normal Tissue Gene Expression Weiling Zhao,1Eric Y. Chuang,2 Mark Mishra,3 Rania Awwad,3 Kheem Bisht,3 Lunching Sun,3 Phuongmai Nguyen,3 J. Daniel Pennington, 3 Tony Jau Cheng Wang,3 C. Matthew Bradbury, 3 Lei Huang,3 Zhijun Chen,3 Gil Bar-Sela,3 Michael E.C. Robbins,1and David Gius3 Abstract Purpose: There is a growing awareness that radiation-induced normal tissue injury in late- responding organs, such as the brain, kidney, and lung, involves complex and dynamic responses between multiple cell types that not only lead to targeted cell death but also acute and chronic alterations in cell function.The specific genes involved in the acute and chronic responses of these late-responding normal tissues remain ill defined; understanding these changes is critical to understanding the mechanism of organ damage. As such, the aim of the present study was to identify candidate genes involved in the development of radiation injury in the murine kidney and brain using microarray analysis. Experimental Design: A multimodality experimental approach combined with a comprehen- sive expression analysis was done to determine changes in normal murine tissue gene expression at 8 and 24 hours after irradiation. Results: A comparison of the gene expression patterns in normal mouse kidney and brain was strikingly different. This observation was surprising because it has been long assumed that the changes in irradiation-induced gene expression in normal tissues are preprogrammed genetic changes that are not affected by tissue-specific origin.
[Show full text]