DOCSLIB.ORG

Arp39015 P050

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Arp39015 P050 Aviva Systems Biology PPARGC1A antibody - N-terminal region (ARP39015_P050) Product Number ARP39015_P050 Product Page http://www.avivasysbio.com/ppargc1a-antibody-n-terminal-region-arp39015-p050.html Product Name PPARGC1A antibody - N-terminal region (ARP39015_P050) Size 100 ul Gene Symbol PPARGC1A Alias Symbols LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1 Protein Size (# AA) 798 amino acids Molecular Weight 91kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 10891 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha Name Description This is a rabbit polyclonal antibody against PPARGC1A. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS Description of The protein encoded by this gene is a transcriptional coactivator that regulates the genes Target involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Protein Interactions NRIP1; SUMO1; UBE2I; UBC; SIRT1; PPARG; PRKAA1; KAT2A; EGFR; CDK6; CAPNS1; PARK7; PIAS1; SFPQ; ESRRG; RNF2; TP53; HNF4A; CREBZF; NR3C1; ESRRA; RNF34; NR1I2; ESR2; BCL6; SF1; NR5A2; MYEF2; NCOA6; IQGAP1; MYOD1; EP300; LRPPRC; THRB; MYBBP1A; MED1; NR1I3; NC Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Blocking Peptide For anti-PPARGC1A (ARP39015_P050) antibody is Catalog # AAP39015 (Previous Catalog # AAPS03708) Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A Complete Anti-PPARGC1A (ARP39015_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PPARGC1A. Swissprot Id Q9UBK2 Protein Name Peroxisome proliferator-activated receptor gamma coactivator 1-alpha Protein Accession NP_037393 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PPARGC1A. Nucleotide NM_013261 Accession # Replacement Item This antibody may replace item sc-13067 from Santa Cruz Biotechnology. Conjugation ARP39015_P050-FITC Conjugated Options ARP39015_P050-HRP Conjugated ARP39015_P050-Biotin Conjugated CB Replacement sc-13067; sc-293168; sc-38884; sc-38885; sc-5815; sc-5816 Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish Application WB Predicted Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Homology Based Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90% on Immunogen Sequence Image 1: transfected SH-SY5Y PPARGC1A antibody - N-terminal region (ARP39015_P050) validated by WB using transfected SH-SY5Y lysate at 1:15000. Image 2: Transfected Melanoma PPARGC1A antibody - N-terminal region (ARP39015_P050) validated by WB using Transfected Melanoma Cell at 1:1000. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2 Image 3: Human , Rat, Mouse Lanes: Lane1: 30 ug Human liver Lane2: 30 ug Rat liver Lane3: 30 ug Mouse (wild-type) liver Lane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver Lane5: 30 ug Human muscle Lane6: 30 ug Rat muscle Lane7: 30 ug Mouse muscle Primary Antibody Dilution: 1:1000 Secondary Antibody: Secondary Antibody Dilution: 1:10000 Gene Name: PPARGC1A Submitted by: Dr. Bruno Guigas, PhD, Dept. of Molecular Cell Biology, Leiden University Medical Center Image 4: Human ACHN WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: ACHN cell lysate AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 3.
Load more

Recommended publications
  • Table 2. Functional Classification of Genes Differentially Regulated After HOXB4 Inactivation in HSC/Hpcs
    Table 2. Functional classification of genes differentially regulated after HOXB4 inactivation in HSC/HPCs Symbol Gene description Fold-change (mean ± SD) Signal transduction Adam8 A disintegrin and metalloprotease domain 8 1.91 ± 0.51 Arl4 ADP-ribosylation factor-like 4 - 1.80 ± 0.40 Dusp6 Dual specificity phosphatase 6 (Mkp3) - 2.30 ± 0.46 Ksr1 Kinase suppressor of ras 1 1.92 ± 0.42 Lyst Lysosomal trafficking regulator 1.89 ± 0.34 Mapk1ip1 Mitogen activated protein kinase 1 interacting protein 1 1.84 ± 0.22 Narf* Nuclear prelamin A recognition factor 2.12 ± 0.04 Plekha2 Pleckstrin homology domain-containing. family A. (phosphoinosite 2.15 ± 0.22 binding specific) member 2 Ptp4a2 Protein tyrosine phosphatase 4a2 - 2.04 ± 0.94 Rasa2* RAS p21 activator protein 2 - 2.80 ± 0.13 Rassf4 RAS association (RalGDS/AF-6) domain family 4 3.44 ± 2.56 Rgs18 Regulator of G-protein signaling - 1.93 ± 0.57 Rrad Ras-related associated with diabetes 1.81 ± 0.73 Sh3kbp1 SH3 domain kinase bindings protein 1 - 2.19 ± 0.53 Senp2 SUMO/sentrin specific protease 2 - 1.97 ± 0.49 Socs2 Suppressor of cytokine signaling 2 - 2.82 ± 0.85 Socs5 Suppressor of cytokine signaling 5 2.13 ± 0.08 Socs6 Suppressor of cytokine signaling 6 - 2.18 ± 0.38 Spry1 Sprouty 1 - 2.69 ± 0.19 Sos1 Son of sevenless homolog 1 (Drosophila) 2.16 ± 0.71 Ywhag 3-monooxygenase/tryptophan 5- monooxygenase activation protein. - 2.37 ± 1.42 gamma polypeptide Zfyve21 Zinc finger. FYVE domain containing 21 1.93 ± 0.57 Ligands and receptors Bambi BMP and activin membrane-bound inhibitor - 2.94 ± 0.62
    [Show full text]
  • Cisplatin and Phenanthriplatin Modulate Long-Noncoding
    www.nature.com/scientificreports OPEN Cisplatin and phenanthriplatin modulate long‑noncoding RNA expression in A549 and IMR90 cells revealing regulation of microRNAs, Wnt/β‑catenin and TGF‑β signaling Jerry D. Monroe1,2, Satya A. Moolani2,3, Elvin N. Irihamye2,4, Katheryn E. Lett1, Michael D. Hebert1, Yann Gibert1* & Michael E. Smith2* The monofunctional platinum(II) complex, phenanthriplatin, acts by blocking transcription, but its regulatory efects on long‑noncoding RNAs (lncRNAs) have not been elucidated relative to traditional platinum‑based chemotherapeutics, e.g., cisplatin. Here, we treated A549 non‑small cell lung cancer and IMR90 lung fbroblast cells for 24 h with either cisplatin, phenanthriplatin or a solvent control, and then performed microarray analysis to identify regulated lncRNAs. RNA22 v2 microRNA software was subsequently used to identify microRNAs (miRNAs) that might be suppressed by the most regulated lncRNAs. We found that miR‑25‑5p, ‑30a‑3p, ‑138‑5p, ‑149‑3p, ‑185‑5p, ‑378j, ‑608, ‑650, ‑708‑5p, ‑1253, ‑1254, ‑4458, and ‑4516, were predicted to target the cisplatin upregulated lncRNAs, IMMP2L‑1, CBR3‑1 and ATAD2B‑5, and the phenanthriplatin downregulated lncRNAs, AGO2‑1, COX7A1‑2 and SLC26A3‑1. Then, we used qRT‑PCR to measure the expression of miR‑25‑5p, ‑378j, ‑4516 (A549) and miR‑149‑3p, ‑608, and ‑4458 (IMR90) to identify distinct signaling efects associated with cisplatin and phenanthriplatin. The signaling pathways associated with these miRNAs suggests that phenanthriplatin may modulate Wnt/β‑catenin and TGF‑β signaling through the MAPK/ ERK and PTEN/AKT pathways diferently than cisplatin. Further, as some of these miRNAs may be subject to dissimilar lncRNA targeting in A549 and IMR90 cells, the monofunctional complex may not cause toxicity in normal lung compared to cancer cells by acting through distinct lncRNA and miRNA networks.
    [Show full text]
  • In Acute Myeloid Leukemia
    7283 Original Article Comprehensively analyze the expression and prognostic role for ten-eleven translocations (TETs) in acute myeloid leukemia Yan Huang1#, Jie Wei1#, Xunjun Huang1, Weijie Zhou1, Yuling Xu2, Dong-Hong Deng2, Peng Cheng2 1Department of Hematology and Rheumatology, People’s Hospital of Baise, Baise, China; 2Department of Hematology, the First Affiliated Hospital of Guangxi Medical University, Nanning, China Contributions: (I) Conception and design: J Wei, Y Huang; (II) Administrative support: X Huang, Y Xu; (III) Provision of study materials or patients: W Zhou; (IV) Collection and assembly of data: J Wei, Y Huang; (V) Data analysis and interpretation: DH Deng, P Cheng; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #These authors contributed equally to this work. Correspondence to: Yuling Xu. Department of Hematology, The First Affiliated Hospital of Guangxi Medical University, Nanning, China. Email: [email protected]; Dong-Hong Deng. Department of Hematology, The First Affiliated Hospital of Guangxi Medical University, Nanning, China. Email: [email protected]; Peng Cheng. Department of Hematology, The First Affiliated Hospital of Guangxi Medical University, Nanning 530000, China. Email: [email protected]. Background: The ten-eleven translocation (TET) family oxidize 5-methylcytosines (5mCs) and promote the locus-specific reversal of DNA. The role of TETs in acute myeloid leukemia (AML) is mostly unknown. Methods: TETs mRNA expression levels were analyzed via Gene Expression Profiling Interactive Analysis (GEPIA). The association TETs expression levels and methylation with prognosis by UALCAN GenomicScape, and METHsurv. We analyzed TETs’ aberration types, located mutations, and structures via cBioPortal. GeneMANIA performed the functional network. Gene ontology (GO) enrichment was analyzed via LinkedOmics.
    [Show full text]
  • Transcriptome Analyses of Rhesus Monkey Pre-Implantation Embryos Reveal A
    Downloaded from genome.cshlp.org on September 23, 2021 - Published by Cold Spring Harbor Laboratory Press Transcriptome analyses of rhesus monkey pre-implantation embryos reveal a reduced capacity for DNA double strand break (DSB) repair in primate oocytes and early embryos Xinyi Wang 1,3,4,5*, Denghui Liu 2,4*, Dajian He 1,3,4,5, Shengbao Suo 2,4, Xian Xia 2,4, Xiechao He1,3,6, Jing-Dong J. Han2#, Ping Zheng1,3,6# Running title: reduced DNA DSB repair in monkey early embryos Affiliations: 1 State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223, China 2 Key Laboratory of Computational Biology, CAS Center for Excellence in Molecular Cell Science, Collaborative Innovation Center for Genetics and Developmental Biology, Chinese Academy of Sciences-Max Planck Partner Institute for Computational Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200031, China 3 Yunnan Key Laboratory of Animal Reproduction, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223, China 4 University of Chinese Academy of Sciences, Beijing, China 5 Kunming College of Life Science, University of Chinese Academy of Sciences, Kunming, Yunnan 650204, China 6 Primate Research Center, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, 650223, China * Xinyi Wang and Denghui Liu contributed equally to this work 1 Downloaded from genome.cshlp.org on September 23, 2021 - Published by Cold Spring Harbor Laboratory Press # Correspondence: Jing-Dong J. Han, Email: [email protected]; Ping Zheng, Email: [email protected] Key words: rhesus monkey, pre-implantation embryo, DNA damage 2 Downloaded from genome.cshlp.org on September 23, 2021 - Published by Cold Spring Harbor Laboratory Press ABSTRACT Pre-implantation embryogenesis encompasses several critical events including genome reprogramming, zygotic genome activation (ZGA) and cell fate commitment.
    [Show full text]
  • Estrogen-Related Receptor Alpha: an Under-Appreciated Potential Target for the Treatment of Metabolic Diseases
    International Journal of Molecular Sciences Review Estrogen-Related Receptor Alpha: An Under-Appreciated Potential Target for the Treatment of Metabolic Diseases Madhulika Tripathi, Paul Michael Yen and Brijesh Kumar Singh * Laboratory of Hormonal Regulation, Cardiovascular and Metabolic Disorders Program, Duke-NUS Medical School, Singapore 169857, Singapore; [email protected] (M.T.); [email protected] (P.M.Y.) * Correspondence: [email protected] Received: 7 February 2020; Accepted: 24 February 2020; Published: 28 February 2020 Abstract: The estrogen-related receptor alpha (ESRRA) is an orphan nuclear receptor (NR) that significantly influences cellular metabolism. ESRRA is predominantly expressed in metabolically-active tissues and regulates the transcription of metabolic genes, including those involved in mitochondrial turnover and autophagy. Although ESRRA activity is well-characterized in several types of cancer, recent reports suggest that it also has an important role in metabolic diseases. This minireview focuses on the regulation of cellular metabolism and function by ESRRA and its potential as a target for the treatment of metabolic disorders. Keywords: estrogen-related receptor alpha; mitophagy; mitochondrial turnover; metabolic diseases; non-alcoholic fatty liver disease (NAFLD); adipogenesis; adaptive thermogenesis 1. Introduction When the estrogen-related receptor alpha (ESRRA) was first cloned, it was found to be a nuclear receptor (NR) that had DNA sequence homology to the estrogen receptor alpha (ESR1) [1]. There are several examples of estrogen-related receptor (ESRR) and estrogen-signaling cross-talk via mutual transcriptional regulation or reciprocal binding to each other’s response elements of common target genes in a context-specific manner [2,3].
    [Show full text]
  • The Structure-Function Relationship of Angular Estrogens and Estrogen Receptor Alpha to Initiate Estrogen-Induced Apoptosis in Breast Cancer Cells S
    Supplemental material to this article can be found at: http://molpharm.aspetjournals.org/content/suppl/2020/05/03/mol.120.119776.DC1 1521-0111/98/1/24–37$35.00 https://doi.org/10.1124/mol.120.119776 MOLECULAR PHARMACOLOGY Mol Pharmacol 98:24–37, July 2020 Copyright ª 2020 The Author(s) This is an open access article distributed under the CC BY Attribution 4.0 International license. The Structure-Function Relationship of Angular Estrogens and Estrogen Receptor Alpha to Initiate Estrogen-Induced Apoptosis in Breast Cancer Cells s Philipp Y. Maximov, Balkees Abderrahman, Yousef M. Hawsawi, Yue Chen, Charles E. Foulds, Antrix Jain, Anna Malovannaya, Ping Fan, Ramona F. Curpan, Ross Han, Sean W. Fanning, Bradley M. Broom, Daniela M. Quintana Rincon, Jeffery A. Greenland, Geoffrey L. Greene, and V. Craig Jordan Downloaded from Departments of Breast Medical Oncology (P.Y.M., B.A., P.F., D.M.Q.R., J.A.G., V.C.J.) and Computational Biology and Bioinformatics (B.M.B.), University of Texas, MD Anderson Cancer Center, Houston, Texas; King Faisal Specialist Hospital and Research (Gen.Org.), Research Center, Jeddah, Kingdom of Saudi Arabia (Y.M.H.); The Ben May Department for Cancer Research, University of Chicago, Chicago, Illinois (R.H., S.W.F., G.L.G.); Center for Precision Environmental Health and Department of Molecular and Cellular Biology (C.E.F.), Mass Spectrometry Proteomics Core (A.J., A.M.), Verna and Marrs McLean Department of Biochemistry and Molecular Biology, Mass Spectrometry Proteomics Core (A.M.), and Dan L. Duncan molpharm.aspetjournals.org
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • TAZ-CAMTA1 and YAP-TFE3 Alter the TAZ/YAP Transcriptome By
    RESEARCH ARTICLE TAZ-CAMTA1 and YAP-TFE3 alter the TAZ/YAP transcriptome by recruiting the ATAC histone acetyltransferase complex Nicole Merritt1†, Keith Garcia1,2†, Dushyandi Rajendran3, Zhen-Yuan Lin3, Xiaomeng Zhang4, Katrina A Mitchell4,5, Nicholas Borcherding6, Colleen Fullenkamp1, Michael S Chimenti7, Anne-Claude Gingras3, Kieran F Harvey4,5,8, Munir R Tanas1,2,9,10* 1Department of Pathology, University of Iowa, Iowa City, United States; 2Cancer Biology Graduate Program, University of Iowa, Iowa City, United States; 3Lunenfeld- Tanenbaum Research Institute, Mount Sinai Hospital, Toronto, United States; 4Peter MacCallum Cancer Centre, Melbourne, Australia; 5Sir Peter MacCallum Department of Oncology, The University of Melbourne, Parkville, Australia; 6Department of Pathology and Immunology, Washington University, St. Louis, United States; 7Iowa Institute of Human Genetics, Carver College of Medicine, University of Iowa, Iowa City, United States; 8Department of Anatomy and Developmental Biology and Biomedicine Discovery Institute, Monash University, Clayton, Australia; 9Holden Comprehensive Cancer Center, University of Iowa, Iowa City, United States; 10Pathology and Laboratory Medicine, Veterans Affairs Medical Center, Iowa City, United States *For correspondence: Abstract Epithelioid hemangioendothelioma (EHE) is a vascular sarcoma that metastasizes early [email protected] in its clinical course and lacks an effective medical therapy. The TAZ-CAMTA1 and YAP-TFE3 fusion proteins are chimeric transcription factors and initiating oncogenic drivers of EHE. A combined †These authors contributed proteomic/genetic screen in human cell lines identified YEATS2 and ZZZ3, components of the equally to this work Ada2a-containing histone acetyltransferase (ATAC) complex, as key interactors of both fusion Competing interests: The proteins despite the dissimilarity of the C terminal fusion partners CAMTA1 and TFE3.
    [Show full text]
  • Supplementary Figures and Table Legends
    Supplementary Information Supplementary Figure Legends Figure S1. CARM1 is required for estrogen-induced gene transcriptional activation. (A) Box plot showing the expression of CARM1 (FPKM) in a cohort of clinical breast cancer (n=1,102) and normal (n=113) samples from TCGA (The Cancer Genome Atlas). (B, C) Kaplan Meier survival analyses for DMFS (distal metastasis free survival) (n=1,747) and OS (overall survival) (n=1,402) of breast cancer patients using CARM1 as input. (D, E) RNA-seq as described in Figure 1A for specific genes were shown as indicated. (F) Correlation of CARM1’s effects on whole transcriptome in response to estrogen between two RNA-seq biological repeats (n=11,816). (G) Correlation of CARM1 effects on whole transcriptome in response to estrogen based on RNA- seq between two independent siRNAs targeting CARM1 (siCARM1 (1) and siCARM1 (2)) (n=12,234). (H, I) MCF7 cells as described in (G) were subjected to immunoblotting (IB) (H) and RT-qPCR (I) analysis to examine the levels of indicated protein and mRNA, respectively. Actin was served as a loading control. (J) MCF7 cells as described in Figure 1E were subjected to RT-qPCR analysis to examine the expression of genes as indicated. (K) MCF7 cells as described in Figure 1E were subjected to immunoblotting (IB) analysis to examine the protein levels of CARM1. Actin was served as a loading control. (L) Genomic DNA was extracted from CARM1 knockout cells, followed by PCR using specific primer sets spanning gRNA targeting region (boxed in blue). The resultant PCR products were subjected to Sanger sequencing as shown.
    [Show full text]
  • Transcriptomic and Proteomic Profiling Provides Insight Into
    BASIC RESEARCH www.jasn.org Transcriptomic and Proteomic Profiling Provides Insight into Mesangial Cell Function in IgA Nephropathy † † ‡ Peidi Liu,* Emelie Lassén,* Viji Nair, Celine C. Berthier, Miyuki Suguro, Carina Sihlbom,§ † | † Matthias Kretzler, Christer Betsholtz, ¶ Börje Haraldsson,* Wenjun Ju, Kerstin Ebefors,* and Jenny Nyström* *Department of Physiology, Institute of Neuroscience and Physiology, §Proteomics Core Facility at University of Gothenburg, University of Gothenburg, Gothenburg, Sweden; †Division of Nephrology, Department of Internal Medicine and Department of Computational Medicine and Bioinformatics, University of Michigan, Ann Arbor, Michigan; ‡Division of Molecular Medicine, Aichi Cancer Center Research Institute, Nagoya, Japan; |Department of Immunology, Genetics and Pathology, Uppsala University, Uppsala, Sweden; and ¶Integrated Cardio Metabolic Centre, Karolinska Institutet Novum, Huddinge, Sweden ABSTRACT IgA nephropathy (IgAN), the most common GN worldwide, is characterized by circulating galactose-deficient IgA (gd-IgA) that forms immune complexes. The immune complexes are deposited in the glomerular mesangium, leading to inflammation and loss of renal function, but the complete pathophysiology of the disease is not understood. Using an integrated global transcriptomic and proteomic profiling approach, we investigated the role of the mesangium in the onset and progression of IgAN. Global gene expression was investigated by microarray analysis of the glomerular compartment of renal biopsy specimens from patients with IgAN (n=19) and controls (n=22). Using curated glomerular cell type–specific genes from the published literature, we found differential expression of a much higher percentage of mesangial cell–positive standard genes than podocyte-positive standard genes in IgAN. Principal coordinate analysis of expression data revealed clear separation of patient and control samples on the basis of mesangial but not podocyte cell–positive standard genes.
    [Show full text]
  • Histone Demethylases at the Center of Cellular Differentiation and Disease
    Downloaded from genesdev.cshlp.org on September 30, 2021 - Published by Cold Spring Harbor Laboratory Press REVIEW Erasing the methyl mark: histone demethylases at the center of cellular differentiation and disease Paul A.C. Cloos,2 Jesper Christensen, Karl Agger, and Kristian Helin1 Biotech Research and Innovation Centre (BRIC) and Centre for Epigenetics, University of Copenhagen, DK-2200 Copenhagen, Denmark The enzymes catalyzing lysine and arginine methylation impacts on the transcriptional activity of the underlying of histones are essential for maintaining transcriptional DNA by acting as a recognition template for effector programs and determining cell fate and identity. Until proteins modifying the chromatin environment and lead- recently, histone methylation was regarded irreversible. ing to either repression or activation. Thus, histone However, within the last few years, several families of methylation can be associated with either activation or histone demethylases erasing methyl marks associated repression of transcription depending on which effector with gene repression or activation have been identified, protein is being recruited. It should be noted that the underscoring the plasticity and dynamic nature of his- unmodified residues can also serve as a binding template tone methylation. Recent discoveries have revealed that for effector proteins leading to specific chromatin states histone demethylases take part in large multiprotein (Lan et al. 2007b). complexes synergizing with histone deacetylases, histone Arginine residues can be modified by one or two meth- methyltransferases, and nuclear receptors to control de- yl groups; the latter form in either a symmetric or asym- velopmental and transcriptional programs. Here we re- metric conformation (Rme1, Rme2s, and Rme2a), per- view the emerging biochemical and biological functions mitting a total of four states: one unmethylated and of the histone demethylases and discuss their potential three methylated forms.
    [Show full text]
  • Stromule Extension Along Microtubules Coordinated with Actin
    RESEARCH ARTICLE Stromule extension along microtubules coordinated with actin-mediated anchoring guides perinuclear chloroplast movement during innate immunity Amutha Sampath Kumar1†, Eunsook Park2,3†‡, Alexander Nedo1,4, Ali Alqarni1,4,5, Li Ren5, Kyle Hoban1,4, Shannon Modla1, John H McDonald4, Chandra Kambhamettu5,6, Savithramma P Dinesh-Kumar2,3*, Jeffrey Lewis Caplan1,4,5* 1Delaware Biotechnology Institute, University of Delaware, Newark, United States; 2Department of Plant Biology, College of Biological Sciences, University of California, Davis, Davis, United States; 3The Genome Center, College of Biological Sciences, University of California, Davis, Davis, United States; 4Department of Biological Sciences, College of Arts and Sciences, University of Delaware, Newark, United States; 5Department of Plant and Soil Sciences, College of Agriculture and Natural Resources, University of Delaware, Newark, United States; 6Department of Computer and Information Sciences, College of Engineering, University of *For correspondence: Delaware, Newark, United States [email protected] (SPD-K); [email protected] (JLC) † These authors contributed Abstract Dynamic tubular extensions from chloroplasts called stromules have recently been equally to this work shown to connect with nuclei and function during innate immunity. We demonstrate that stromules Present address: ‡Department extend along microtubules (MTs) and MT organization directly affects stromule dynamics since of Plant Sciences, College of stabilization of MTs chemically or genetically
    [Show full text]