Aviva Systems Biology PPARGC1A antibody - N-terminal region (ARP39015_P050) Product Number ARP39015_P050 Product Page http://www.avivasysbio.com/ppargc1a-antibody-n-terminal-region-arp39015-p050.html Product Name PPARGC1A antibody - N-terminal region (ARP39015_P050) Size 100 ul Gene Symbol PPARGC1A Alias Symbols LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1 Protein Size (# AA) 798 amino acids Molecular Weight 91kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 10891 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha Name Description This is a rabbit polyclonal antibody against PPARGC1A. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS Description of The protein encoded by this gene is a transcriptional coactivator that regulates the genes Target involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Protein Interactions NRIP1; SUMO1; UBE2I; UBC; SIRT1; PPARG; PRKAA1; KAT2A; EGFR; CDK6; CAPNS1; PARK7; PIAS1; SFPQ; ESRRG; RNF2; TP53; HNF4A; CREBZF; NR3C1; ESRRA; RNF34; NR1I2; ESR2; BCL6; SF1; NR5A2; MYEF2; NCOA6; IQGAP1; MYOD1; EP300; LRPPRC; THRB; MYBBP1A; MED1; NR1I3; NC Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Blocking Peptide For anti-PPARGC1A (ARP39015_P050) antibody is Catalog # AAP39015 (Previous Catalog # AAPS03708) Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A Complete Anti-PPARGC1A (ARP39015_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PPARGC1A. Swissprot Id Q9UBK2 Protein Name Peroxisome proliferator-activated receptor gamma coactivator 1-alpha Protein Accession NP_037393 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PPARGC1A. Nucleotide NM_013261 Accession # Replacement Item This antibody may replace item sc-13067 from Santa Cruz Biotechnology. Conjugation ARP39015_P050-FITC Conjugated Options ARP39015_P050-HRP Conjugated ARP39015_P050-Biotin Conjugated CB Replacement sc-13067; sc-293168; sc-38884; sc-38885; sc-5815; sc-5816 Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish Application WB Predicted Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Homology Based Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90% on Immunogen Sequence
Image 1: transfected SH-SY5Y PPARGC1A antibody - N-terminal region (ARP39015_P050) validated by WB using transfected SH-SY5Y lysate at 1:15000.
Image 2: Transfected Melanoma PPARGC1A antibody - N-terminal region (ARP39015_P050) validated by WB using Transfected Melanoma Cell at 1:1000.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2 Image 3: Human , Rat, Mouse Lanes: Lane1: 30 ug Human liver Lane2: 30 ug Rat liver Lane3: 30 ug Mouse (wild-type) liver Lane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver Lane5: 30 ug Human muscle Lane6: 30 ug Rat muscle Lane7: 30 ug Mouse muscle Primary Antibody Dilution: 1:1000 Secondary Antibody:
Secondary Antibody Dilution: 1:10000 Gene Name: PPARGC1A Submitted by: Dr. Bruno Guigas, PhD, Dept. of Molecular Cell Biology, Leiden University Medical Center Image 4: Human ACHN WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: ACHN cell lysate
AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 3