PBF, a Proto-Oncogene in Esophageal Carcinoma Received November 18, 2018; Accepted July 26, 2019 1 Introduction
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement. -
Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation
BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in -
(PTTG1IP/PBF) Predicts Breast Cancer Survival
Repo et al. BMC Cancer (2017) 17:705 DOI 10.1186/s12885-017-3694-6 RESEARCHARTICLE Open Access PTTG1-interacting protein (PTTG1IP/PBF) predicts breast cancer survival Heli Repo1* , Natalia Gurvits1, Eliisa Löyttyniemi2, Marjukka Nykänen3, Minnamaija Lintunen1, Henna Karra4, Samu Kurki5, Teijo Kuopio3, Kati Talvinen1, Mirva Söderström1 and Pauliina Kronqvist1 Abstract Background: PTTG1-interacting protein (PTTG1IP) is an oncogenic protein, which participates in metaphase-anaphase transition of the cell cycle through activation of securin (PTTG1). PTTG1IP promotes the shift of securin from the cell cytoplasm to the nucleus, allowing the interaction between separase and securin. PTTG1IP overexpression has been previously observed in malignant disease, e.g. in breast carcinoma. However, the prognostic value of PTTG1IP in breast carcinoma patients has not previously been revealed. Methods: A total of 497 breast carcinoma patients with up to 22-year follow-up were analysed for PTTG1IP and securin immunoexpression. The results were evaluated for correlations with the clinical prognosticators and patient survival. Results: In our material, negative PTTG1IP immunoexpression predicted a 1.5-fold risk of breast cancer death (p =0.02). However, adding securin immunoexpression to the analysis indicated an even stronger and independent prognostic power in the patient material (HR = 2.5, p < 0.0001). The subcellular location of securin was found with potential prognostic value also among the triple-negative breast carcinomas (n = 96, p = 0.052). Conclusions: PTTG1IP-negativity alone and in combination with high securin immunoexpression indicates a high risk of breast cancer death, resulting in up to 14-year survival difference in our material. Keywords: PTTG1IP, PBF, Immunohistochemistry, Breast cancer, Prognosis Background nucleus, allowing the interaction between separase and Pituitary tumour transforming gene 1 interacting pro- securin [1]. -
Nuclear Localization of PTTG1 Promotes Migration and Invasion of Seminoma Tumor Through Activation of MMP-2
Nuclear Localization of PTTG1 Promotes Migration and Invasion of Seminoma Tumor Through Activation of MMP-2. Emanuela Teveroni International Scientic Institute "Paul VI", ISI, Fondazione Policlinico "A.Gemelli" IRCCS Fiorella Di Nicuolo International Scientic Institute "Paul VI", ISI, Fondazione Policlinico "A.Gemelli" IRCCS Giada Bianchetti Department of Neuroscience, section of Biophysics, Università Cattolica del Sacro Cuore Alan L. Epstein Department of Pathology, Keck school of medicine, University of Southern California, Los Angeles Giuseppe Grande International Scientic Institute "Paul VI", ISI, Fondazione Policlinico "A.Gemelli" IRCCS Giuseppe Maulucci Department of Neuroscience, section of Biophysics, Università Cattolica del Sacro Cuore Marco De Spirito Università Cattolica del Sacro Cuore: Universita Cattolica del Sacro Cuore Alfredo Pontecorvi Division of Endocrinology, Fondazione policlinico "A.Gemelli" IRCCS Domenico Milardi Division of Endocrinology, Fondazione policlinico "A.Gemelli" IRCCS Francesca Mancini ( [email protected] ) International Scientic Institute "Paul VI", ISI, Fondazione Policlinico 'A. Gemelli' IRCCS, Rome, Italy https://orcid.org/0000-0002-2459-8815 Research Keywords: PTTG1, seminoma cell lines, testicular cancer, PBF, MMP-2, invasiveness Posted Date: December 15th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-125309/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/53 Abstract Background: Seminoma is the most common subtype of testicular germ cell tumors (TGCTs) and its molecular patterns have not been fully claried. The pituitary tumor-transforming gene 1 (PTTG1) is a securin, inhibitor of premature sister chromatid segregation during mitosis and is overexpressed in many cancers. PTTG1 shows the ability to sustain the invasiveness of several cancer types through its transcriptional activity. -
Dissecting the DNA Binding Landscape and Gene Regulatory Network of P63 and P53
bioRxiv preprint doi: https://doi.org/10.1101/2020.06.11.145540; this version posted June 12, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Dissecting the DNA binding landscape and gene regulatory network of p63 and p53 Konstantin Riege1, Helene Kretzmer2, Simon S. McDade3, Steve Hoffmann1, Martin Fischer1,# 1 Computational Biology Group, Leibniz Institute on Aging – Fritz Lipmann Institute (FLI), Beutenbergstraße 11, 07745 Jena, Germany 2 Department of Genome Regulation, Max Planck Institute for Molecular Genetics, Ihnestraße 63-73, 14195 Berlin, Germany 3 Patrick G Johnston Centre for Cancer Research, Queen's University Belfast, 97 Lisburn Road, Belfast BT9 7AE, UK Running title: p63 GRN vs p53 GRN #To whom correspondence should be addressed. Email: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2020.06.11.145540; this version posted June 12, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract The transcription factor (TF) p53 is the best-known tumor suppressor, but its ancient sibling p63 (ΔNp63) is a master regulator of epidermis development and a key oncogenic driver in squamous cell carcinomas (SCC). Despite multiple gene expression studies becoming available in recent years, the limited overlap of reported p63-dependent genes has made it difficult to decipher the p63 gene regulatory network (GRN). -
Atlas Journal
Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 12, Number 5, Sep-Oct 2008 Previous Issue / Next Issue Genes XAF1 (XIAP associated factor-1) (17p13.2). Stéphanie Plenchette, Wai Gin Fong, Robert G Korneluk. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 668-673. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/XAF1ID44095ch17p13.html WWP1 (WW domain containing E3 ubiquitin protein ligase 1) (8q21.3). Ceshi Chen. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 674-680. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/WWP1ID42993ch8q21.html TSPAN1 (tetraspanin 1) (1p34.1). David Murray, Peter Doran. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 681-683. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/TSPAN1ID44178ch1p34.html TCL1B (T-cell leukemia/lymphoma 1B) (14q32.13). Herbert Eradat, Michael A Teitell. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 684-686. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/TCL1BID354ch14q32.html PVRL4 (poliovirus receptor-related 4) (1q23.3). Marc Lopez. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 687-690. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/PVRL4ID44141ch1q23.html PTTG1IP (pituitary tumor-transforming 1 interacting protein) (21q22.3). Vicki Smith, Chris McCabe. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 691-694. -
Downloaded from Bioscientifica.Com at 09/28/2021 12:16:49AM Via Free Access
249 W Imruetaicharoenchoke et al. Mutations in PTTG1IP 24:9 459–474 Research Functional consequences of the first reported mutations of the proto-oncogene PTTG1IP/PBF W Imruetaicharoenchoke1,2,3, A Fletcher1,2, W Lu1,2, R J Watkins4, B Modasia1,2, V L Poole1,2, H R Nieto1,2, R J Thompson1,2, K Boelaert1,2, M L Read1,2, V E Smith1,2,* and C J McCabe1,2,* 1Institute of Metabolism and Systems Research, University of Birmingham, Birmingham, UK 2 Centre for Endocrinology, Diabetes and Metabolism, Birmingham Health Partners, Birmingham, UK Correspondence 3 Department of Surgery, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok, Thailand should be addressed 4 Institute of Cancer and Genomic Sciences, University of Birmingham, Birmingham, UK to C J McCabe *(V E Smith and C J McCabe contributed equally to this work) Email [email protected] Abstract Pituitary tumor-transforming gene 1-binding factor (PTTG1IP; PBF) is a multifunctional Key Words glycoprotein, which is overexpressed in a wide range of tumours, and significantly f COSMIC associated with poorer oncological outcomes, such as early tumour recurrence, distant f TCGA metastasis, extramural vascular invasion and decreased disease-specific survival. f PTTG1IP PBF transforms NIH 3T3 fibroblasts and induces tumours in nude mice, while mice f mutation harbouring transgenic thyroidal PBF expression show hyperplasia and macrofollicular f proliferation Endocrine-Related Cancer Endocrine-Related lesions. Our assumption that PBF becomes an oncogene purely through increased expression has been challenged by the recent report of mutations in PBF within the Catalogue of Somatic Mutations in Cancer (COSMIC) database. -
Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands That Promote Axonal Growth
Research Article: New Research Development Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands that Promote Axonal Growth Jeremy S. Toma,1 Konstantina Karamboulas,1,ª Matthew J. Carr,1,2,ª Adelaida Kolaj,1,3 Scott A. Yuzwa,1 Neemat Mahmud,1,3 Mekayla A. Storer,1 David R. Kaplan,1,2,4 and Freda D. Miller1,2,3,4 https://doi.org/10.1523/ENEURO.0066-20.2020 1Program in Neurosciences and Mental Health, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada, 2Institute of Medical Sciences University of Toronto, Toronto, Ontario M5G 1A8, Canada, 3Department of Physiology, University of Toronto, Toronto, Ontario M5G 1A8, Canada, and 4Department of Molecular Genetics, University of Toronto, Toronto, Ontario M5G 1A8, Canada Abstract Peripheral nerves provide a supportive growth environment for developing and regenerating axons and are es- sential for maintenance and repair of many non-neural tissues. This capacity has largely been ascribed to paracrine factors secreted by nerve-resident Schwann cells. Here, we used single-cell transcriptional profiling to identify ligands made by different injured rodent nerve cell types and have combined this with cell-surface mass spectrometry to computationally model potential paracrine interactions with peripheral neurons. These analyses show that peripheral nerves make many ligands predicted to act on peripheral and CNS neurons, in- cluding known and previously uncharacterized ligands. While Schwann cells are an important ligand source within injured nerves, more than half of the predicted ligands are made by nerve-resident mesenchymal cells, including the endoneurial cells most closely associated with peripheral axons. At least three of these mesen- chymal ligands, ANGPT1, CCL11, and VEGFC, promote growth when locally applied on sympathetic axons. -
An Integrative Genomic Analysis of the Longshanks Selection Experiment for Longer Limbs in Mice
bioRxiv preprint doi: https://doi.org/10.1101/378711; this version posted August 19, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Title: 2 An integrative genomic analysis of the Longshanks selection experiment for longer limbs in mice 3 Short Title: 4 Genomic response to selection for longer limbs 5 One-sentence summary: 6 Genome sequencing of mice selected for longer limbs reveals that rapid selection response is 7 due to both discrete loci and polygenic adaptation 8 Authors: 9 João P. L. Castro 1,*, Michelle N. Yancoskie 1,*, Marta Marchini 2, Stefanie Belohlavy 3, Marek 10 Kučka 1, William H. Beluch 1, Ronald Naumann 4, Isabella Skuplik 2, John Cobb 2, Nick H. 11 Barton 3, Campbell Rolian2,†, Yingguang Frank Chan 1,† 12 Affiliations: 13 1. Friedrich Miescher Laboratory of the Max Planck Society, Tübingen, Germany 14 2. University of Calgary, Calgary AB, Canada 15 3. IST Austria, Klosterneuburg, Austria 16 4. Max Planck Institute for Cell Biology and Genetics, Dresden, Germany 17 Corresponding author: 18 Campbell Rolian 19 Yingguang Frank Chan 20 * indicates equal contribution 21 † indicates equal contribution 22 Abstract: 23 Evolutionary studies are often limited by missing data that are critical to understanding the 24 history of selection. Selection experiments, which reproduce rapid evolution under controlled 25 conditions, are excellent tools to study how genomes evolve under strong selection. Here we 1 bioRxiv preprint doi: https://doi.org/10.1101/378711; this version posted August 19, 2018. -
The Blessing Effect of an Extra Copy of Chromosome 21
The Egyptian Journal of Medical Human Genetics (2014) 15, 209–210 Ain Shams University The Egyptian Journal of Medical Human Genetics www.ejmhg.eg.net www.sciencedirect.com EDITORIAL The blessing effect of an extra copy of chromosome 21 It has long been known that Down syndrome (DS) children These data suggested that endostatin is a good candidate have an increased risk of leukaemia. On the other hand, for cancer therapy in humans. A phase III clinical trial was reports of solid malignancies are rare. Large population-based carried out on 493 histology or cytology confirmed stage IIIB and/or tumour registries have shown that solid tumours occur and IV none small cell lung patients. Patients were treated with significantly less frequently in DS children and adults in Endostar, a recombinant endostatin product in combination comparison with individuals without trisomy 21. Among with the standard chemotherapeutic regimen. This addition 2814 individuals from different age groups with DS registered resulted in significant and clinically meaningful improvement in a Danish study, only 24 cases of solid tumours were in response rate, median time to progression, and clinical identified, whereas 47.7% cases would have been expected benefit rate compared with the chemotherapeutic regimen [1]. A British registry of 11,000 childhood solid tumour cases alone [8]. identified only seven tumours in DS children [lymphoma (3), The extra copy of chromosome 21 protects also against teratoma (1), glioma (2), and fibrosarcoma (1)] [2]. This is true tumour progression through another two genes: Down syndrome also in adult tumours. Among 1278 women with DS registered critical region 1 (DSCR-1, also known as RCAN1) gene and in the Danish Cytogenetic and Danish Cancer Registries, no dual-specificity tyrosine-phosphorylated and -regulated kinase cases of breast cancer were identified, while at least seven cases 1A (Dyrk1a) which play a crucial role in inhibiting the growth would have been expected [1]. -
Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses by a Synthetic TLR3 Ligand Mitigates
Downloaded from http://www.jimmunol.org/ by guest on September 28, 2021 Inducing is online at: average * The Journal of Immunology published online 16 August 2013 from submission to initial decision 4 weeks from acceptance to publication http://www.jimmunol.org/content/early/2013/08/16/jimmun ol.1300376 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol Submit online. Every submission reviewed by practicing scientists ? is published twice each month by http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 28, 2021. Published August 16, 2013, doi:10.4049/jimmunol.1300376 The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN. -
PTTG1IP (NM 001286822) Human Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG235997 PTTG1IP (NM_001286822) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: PTTG1IP (NM_001286822) Human Tagged ORF Clone Tag: TurboGFP Symbol: PTTG1IP Synonyms: C21orf1; C21orf3; PBF Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG235997 representing NM_001286822. Sequence: Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGGCGCCCGGAGTGGCCCGCGGGCCGACGCCGTACTGGAGGTTGCGCCTCGGTGGCGCCGCGCTGCTC CTGCTGCTCATCCCGGTGGCCGCCGCGCAGGAGCCTCCCGGAGCTGCTTGTTCTCAGAACACAAACAAA ACCTGTGAAGAGTGCCTGAAGAACGTCTCCGCCTGTTTAAAGAAGAAAACCCGTATGCTAGATTTGAAA ACAACTAAAGCGCTCCAGCACATCAGTCCCGACGCTTCCTGTGAGGTGCACGCTCCGCAGCCCAGCCCA GCCGGGAGACCACGTGGCCATTGCGGTCTCCTGACCTTGGCCAGTGAACCTGCCAGCCTTCCAGGACAG GCGGCCGGAGAGCTGCCCCTGAAGGACAGTCCTCTCGTCTTGCAGACTGGTGACCTTCTATTCCCTGTT CATCTCTGTTTC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC Protein Sequence: >Peptide sequence encoded by RG235997 Blue=ORF Red=Cloning site Green=Tag(s) MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSACLKKKTRMLDLK TTKALQHISPDASCEVHAPQPSPAGRPRGHCGLLTLASEPASLPGQAAGELPLKDSPLVLQTGDLLFPV HLCF TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED