PCDHGC3 Monoclonal Antibody (M01), Clone 3F10

Total Page：16

File Type：pdf, Size：1020Kb

PCDHGC3 Monoclonal Antibody (M01), Clone 3F10

PCDHGC3 monoclonal antibody suggesting that a novel mechanism may be involved in (M01), clone 3F10 their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Catalog Number: H00005098-M01 Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly Regulatory Status: For research use only (RUO) related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a Product Description: Mouse monoclonal antibody constant region, containing 3 exons shared by all genes raised against a partial recombinant PCDHGC3. in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin Clone Name: 3F10 ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. Immunogen: PCDHGC3 (NP_002579, 71 a.a. ~ 178 These neural cadherin-like cell adhesion proteins most a.a) partial recombinant protein with GST tag. MW of the likely play a critical role in the establishment and function GST tag alone is 26 KDa. of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster Sequence: genes. [provided by RefSeq] GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVT LELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISE AVAPGTRFPLESAHDPDVGSNSLQTYELSRNE Host: Mouse Reactivity: Human Applications: ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 5098 Gene Symbol: PCDHGC3 Gene Alias: PC43, PCDH-GAMMA-C3, PCDH2 Gene Summary: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

PCDHGC3 (NM 032403) Human Tagged ORF Clone Lentiviral Particle – RC211429L4V | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211429L4V PCDHGC3 (NM_032403) Human Tagged ORF Clone Lentiviral Particle Product data: Product Type: Lentiviral Particles Product Name: PCDHGC3 (NM_032403) Human Tagged ORF Clone Lentiviral Particle Symbol: PCDHGC3 Synonyms: PC43; PCDH-GAMMA-C3; PCDH2 Vector: pLenti-C-mGFP-P2A-Puro (PS100093) ACCN: NM_032403 ORF Size: 402 bp ORF Nucleotide The ORF insert of this clone is exactly the same as(RC211429). Sequence: OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_032403.1 RefSeq Size: 2326 bp RefSeq ORF: 405 bp Locus ID: 5098 UniProt ID: Q9BR81 Protein Families: Transmembrane MW: 13.9 kDa This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 PCDHGC3 (NM_032403) Human Tagged ORF Clone Lentiviral Particle – RC211429L4V Gene Summary: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five.
[Show full text]
PCDHGC3 (NM 032402) Human Tagged ORF Clone Lentiviral Particle Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211379L3V PCDHGC3 (NM_032402) Human Tagged ORF Clone Lentiviral Particle Product data: Product Type: Lentiviral Particles Product Name: PCDHGC3 (NM_032402) Human Tagged ORF Clone Lentiviral Particle Symbol: PCDHGC3 Synonyms: PC43; PCDH-GAMMA-C3; PCDH2 Vector: pLenti-C-Myc-DDK-P2A-Puro (PS100092) ACCN: NM_032402 ORF Size: 2589 bp ORF Nucleotide The ORF insert of this clone is exactly the same as(RC211379). Sequence: OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_032402.1 RefSeq Size: 2794 bp RefSeq ORF: 2592 bp Locus ID: 5098 UniProt ID: Q9UN70, Q9BR81 Domains: CA Protein Families: Transmembrane MW: 91.2 kDa This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 PCDHGC3 (NM_032402) Human Tagged ORF Clone Lentiviral Particle – RC211379L3V Gene Summary: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five.
[Show full text]
Supplementary Table 1: Adhesion Genes Data Set
Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
[Show full text]
PCDHGC3 (NM 032403) Human Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211429L4 PCDHGC3 (NM_032403) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: PCDHGC3 (NM_032403) Human Tagged ORF Clone Tag: mGFP Symbol: PCDHGC3 Synonyms: PC43; PCDH-GAMMA-C3; PCDH2 Vector: pLenti-C-mGFP-P2A-Puro (PS100093) E. coli Selection: Chloramphenicol (34 ug/mL) Cell Selection: Puromycin ORF Nucleotide The ORF insert of this clone is exactly the same as(RC211429). Sequence: Restriction Sites: SgfI-MluI Cloning Scheme: ACCN: NM_032403 ORF Size: 402 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 PCDHGC3 (NM_032403) Human Tagged ORF Clone – RC211429L4 OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at [email protected] or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g.
[Show full text]
Learning from Cadherin Structures and Sequences: Affinity Determinants and Protein Architecture
Learning from cadherin structures and sequences: affinity determinants and protein architecture Klára Fels ıvályi Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Klara Felsovalyi All rights reserved ABSTRACT Learning from cadherin structures and sequences: affinity determinants and protein architecture Klara Felsovalyi Cadherins are a family of cell-surface proteins mediating adhesion that are important in development and maintenance of tissues. The family is defined by the repeating cadherin domain (EC) in their extracellular region, but they are diverse in terms of protein size, architecture and cellular function. The best-understood subfamily is the type I classical cadherins, which are found in vertebrates and have five EC domains. Among the five different type I classical cadherins, the binding interactions are highly specific in their homo- and heterophilic binding affinities, though their sequences are very similar. As previously shown, E- and N-cadherins, two prototypic members of the subfamily, differ in their homophilic K D by about an order of magnitude, while their heterophilic affinity is intermediate. To examine the source of the binding affinity differences among type I cadherins, we used crystal structures, analytical ultracentrifugation (AUC), surface plasmon resonance (SPR), and electron paramagnetic resonance (EPR) studies. Phylogenetic analysis and binding affinity behavior show that the type I cadherins can be further divided into two subgroups, with E- and N-cadherin representing each. In addition to the affinity differences in their wild-type binding through the strand-swapped interface, a second interface also shows an affinity difference between E- and N-cadherin.
[Show full text]
CRISPR/Cas9 Interrogation of the Mouse Pcdhg Gene Cluster 4 Reveals a Crucial Isoform-Specific Role for Pcdhgc4
bioRxiv preprint doi: https://doi.org/10.1101/739508; this version posted August 19, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 2 3 CRISPR/Cas9 interrogation of the mouse Pcdhg gene cluster 4 reveals a crucial isoform-specific role for Pcdhgc4 5 6 Andrew M. Garrett1, 3,*, Peter J. Bosch2, David M. Steffen2, Leah C. Fuller2, Charles G. Marcucci2, Alexis A. 7 Koch1, Preeti Bais3, Joshua A. Weiner2,*, and Robert W. Burgess3,* 8 9 1 Wayne State University, Department of Pharmacology, Department of Ophthalmology, Visual, and 10 Anatomical Sciences, Detroit, MI. 11 2 University of Iowa, Department of Biology and Iowa Neuroscience Institute, Iowa City, IA 12 3 The Jackson Laboratory, Bar Harbor, ME 13 * Co-corresponding authors 1 bioRxiv preprint doi: https://doi.org/10.1101/739508; this version posted August 19, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 14 ABSTRACT 15 The mammalian Pcdhg gene cluster encodes a family of 22 cell adhesion molecules, the gamma- 16 Protocadherins (γ-Pcdhs), critical for neuronal survival and neural circuit formation. The extent to which 17 isoform diversity–a γ-Pcdh hallmark–is required for their functions remains unclear. We used a 18 CRISPR/Cas9 approach to reduce isoform diversity, targeting each Pcdhg variable exon with pooled 19 sgRNAs to generate an allelic series of 26 mouse lines with 1 to 21 isoforms disrupted via discrete indels 20 at guide sites and/or larger deletions/rearrangements.
[Show full text]
SZDB: a Database for Schizophrenia Genetic Research
Schizophrenia Bulletin vol. 43 no. 2 pp. 459–471, 2017 doi:10.1093/schbul/sbw102 Advance Access publication July 22, 2016 SZDB: A Database for Schizophrenia Genetic Research Yong Wu1,2, Yong-Gang Yao1–4, and Xiong-Jian Luo*,1,2,4 1Key Laboratory of Animal Models and Human Disease Mechanisms of the Chinese Academy of Sciences and Yunnan Province, Kunming Institute of Zoology, Kunming, China; 2Kunming College of Life Science, University of Chinese Academy of Sciences, Kunming, China; 3CAS Center for Excellence in Brain Science and Intelligence Technology, Chinese Academy of Sciences, Shanghai, China 4YGY and XJL are co-corresponding authors who jointly directed this work. *To whom correspondence should be addressed; Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223, China; tel: +86-871-68125413, fax: +86-871-68125413, e-mail: [email protected] Schizophrenia (SZ) is a debilitating brain disorder with a Introduction complex genetic architecture. Genetic studies, especially Schizophrenia (SZ) is a severe mental disorder charac- recent genome-wide association studies (GWAS), have terized by abnormal perceptions, incoherent or illogi- identified multiple variants (loci) conferring risk to SZ. cal thoughts, and disorganized speech and behavior. It However, how to efficiently extract meaningful biological affects approximately 0.5%–1% of the world populations1 information from bulk genetic findings of SZ remains a and is one of the leading causes of disability worldwide.2–4 major challenge. There is a pressing
[Show full text]
Protocadherin Family: Diversity, Structure, and Function Hirofumi Morishita1 and Takeshi Yagi2
Protocadherin family: diversity, structure, and function Hirofumi Morishita1 and Takeshi Yagi2 Protocadherins are predominantly expressed in the nervous in the cadherin superfamily [3]. The protocadherin sub- system, and constitute the largest subgroup within the cadherin group has only been identified and characterized in superfamily. The recent structural elucidation of the amino- studies from the past decade. These genetic and func- terminal cadherin domain in an archetypal protocadherin tional studies have revealed a divergent cytoplasmic revealed unique and remarkable features: the lack of an domain, as well as six or seven extracellular cadherin interface for homophilic adhesiveness found in classical (EC) domains with low sequence similarities to the EC cadherins, and the presence of loop structures specific to the domains of the classical cadherin subgroup. protocadherin family. The unique features of protocadherins extend to their genomic organization. Recent findings have Knowledge of protocadherin family at the molecular level revealed unexpected allelic and combinatorial gene regulation has increased profoundly in the past few years from for clustered protocadherins, a major subgroup in the publications of the first detailed structural and functional protocadherin family. The unique structural repertoire and findings, as well as identification of unusual gene regu- unusual gene regulation of the protocadherin family may lation for this family. In the following, we shall contex- provide the molecular basis for the extraordinary diversity
[Show full text]
Genome-Wide Analysis of Organ-Preferential Metastasis of Human Small Cell Lung Cancer in Mice
Vol. 1, 485–499, May 2003 Molecular Cancer Research 485 Genome-Wide Analysis of Organ-Preferential Metastasis of Human Small Cell Lung Cancer in Mice Soji Kakiuchi,1 Yataro Daigo,1 Tatsuhiko Tsunoda,2 Seiji Yano,3 Saburo Sone,3 and Yusuke Nakamura1 1Laboratory of Molecular Medicine, Human Genome Center, Institute of Medical Science, The University of Tokyo, Tokyo, Japan; 2Laboratory for Medical Informatics, SNP Research Center, Riken (Institute of Physical and Chemical Research), Tokyo, Japan; and 3Department of Internal Medicine and Molecular Therapeutics, The University of Tokushima School of Medicine, Tokushima, Japan Abstract Molecular interactions between cancer cells and their Although a number of molecules have been implicated in microenvironment(s) play important roles throughout the the process of cancer metastasis, the organ-selective multiple steps of metastasis (5). Blood flow and other nature of cancer cells is still poorly understood. To environmental factors influence the dissemination of cancer investigate this issue, we established a metastasis model cells to specific organs (6). However, the organ specificity of in mice with multiple organ dissemination by i.v. injection metastasis (i.e., some organs preferentially permit migration, of human small cell lung cancer (SBC-5) cells. We invasion, and growth of specific cancer cells, but others do not) analyzed gene-expression profiles of 25 metastatic is a crucial determinant of metastatic outcome, and proteins lesions from four organs (lung, liver, kidney, and bone) involved in the metastatic process are considered to be using a cDNA microarray representing 23,040 genes and promising therapeutic targets. extracted 435 genes that seemed to reflect the organ More than a century ago, Stephen Paget suggested that the specificity of the metastatic cells and the cross-talk distribution of metastases was not determined by chance, but between cancer cells and microenvironment.
[Show full text]
The Pdx1 Bound Swi/Snf Chromatin Remodeling Complex Regulates Pancreatic Progenitor Cell Proliferation and Mature Islet Β Cell
Page 1 of 125 Diabetes The Pdx1 bound Swi/Snf chromatin remodeling complex regulates pancreatic progenitor cell proliferation and mature islet β cell function Jason M. Spaeth1,2, Jin-Hua Liu1, Daniel Peters3, Min Guo1, Anna B. Osipovich1, Fardin Mohammadi3, Nilotpal Roy4, Anil Bhushan4, Mark A. Magnuson1, Matthias Hebrok4, Christopher V. E. Wright3, Roland Stein1,5 1 Department of Molecular Physiology and Biophysics, Vanderbilt University, Nashville, TN 2 Present address: Department of Pediatrics, Indiana University School of Medicine, Indianapolis, IN 3 Department of Cell and Developmental Biology, Vanderbilt University, Nashville, TN 4 Diabetes Center, Department of Medicine, UCSF, San Francisco, California 5 Corresponding author: [email protected]; (615)322-7026 1 Diabetes Publish Ahead of Print, published online June 14, 2019 Diabetes Page 2 of 125 Abstract Transcription factors positively and/or negatively impact gene expression by recruiting coregulatory factors, which interact through protein-protein binding. Here we demonstrate that mouse pancreas size and islet β cell function are controlled by the ATP-dependent Swi/Snf chromatin remodeling coregulatory complex that physically associates with Pdx1, a diabetes- linked transcription factor essential to pancreatic morphogenesis and adult islet-cell function and maintenance. Early embryonic deletion of just the Swi/Snf Brg1 ATPase subunit reduced multipotent pancreatic progenitor cell proliferation and resulted in pancreas hypoplasia. In contrast, removal of both Swi/Snf ATPase subunits, Brg1 and Brm, was necessary to compromise adult islet β cell activity, which included whole animal glucose intolerance, hyperglycemia and impaired insulin secretion. Notably, lineage-tracing analysis revealed Swi/Snf-deficient β cells lost the ability to produce the mRNAs for insulin and other key metabolic genes without effecting the expression of many essential islet-enriched transcription factors.
[Show full text]
Functional Test of PCDHB11, the Most Human-Specific Neuronal Surface Protein Guilherme Braga De Freitas, Rafaella Araújo Gonçalves and Matthias Gralle*
de Freitas et al. BMC Evolutionary Biology (2016) 16:75 DOI 10.1186/s12862-016-0652-x RESEARCHARTICLE Open Access Functional test of PCDHB11, the most human-specific neuronal surface protein Guilherme Braga de Freitas, Rafaella Araújo Gonçalves and Matthias Gralle* Abstract Background: Brain-expressed proteins that have undergone functional change during human evolution may contribute to human cognitive capacities, and may also leave us vulnerable to specifically human diseases, such as schizophrenia, autism or Alzheimer’s disease. In order to search systematically for those proteins that have changed the most during human evolution and that might contribute to brain function and pathology, all proteins with orthologs in chimpanzee, orangutan and rhesus macaque and annotated as being expressed on the surface of cells in the human central nervous system were ordered by the number of human-specific amino acid differences that are fixed in modern populations. Results: PCDHB11, a beta-protocadherin homologous to murine cell adhesion proteins, stood out with 12 substitutions and maintained its lead after normalizing for protein size and applying weights for amino acid exchange probabilities. Human PCDHB11 was found to cause homophilic cell adhesion, but at lower levels than shown for other clustered protocadherins. Homophilic adhesion caused by a PCDHB11 with reversion of human- specific changes was as low as for modern human PCDHB11; while neither human nor reverted PCDHB11 adhered to controls, they did adhere to each other. A loss of function in PCDHB11 is unlikely because intra-human variability did not increase relative to the other human beta-protocadherins. Conclusions: The brain-expressed protein with the highest number of human-specific substitutions is PCDHB11.
[Show full text]
Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands That Promote Axonal Growth
Research Article: New Research Development Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands that Promote Axonal Growth Jeremy S. Toma,1 Konstantina Karamboulas,1,ª Matthew J. Carr,1,2,ª Adelaida Kolaj,1,3 Scott A. Yuzwa,1 Neemat Mahmud,1,3 Mekayla A. Storer,1 David R. Kaplan,1,2,4 and Freda D. Miller1,2,3,4 https://doi.org/10.1523/ENEURO.0066-20.2020 1Program in Neurosciences and Mental Health, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada, 2Institute of Medical Sciences University of Toronto, Toronto, Ontario M5G 1A8, Canada, 3Department of Physiology, University of Toronto, Toronto, Ontario M5G 1A8, Canada, and 4Department of Molecular Genetics, University of Toronto, Toronto, Ontario M5G 1A8, Canada Abstract Peripheral nerves provide a supportive growth environment for developing and regenerating axons and are es- sential for maintenance and repair of many non-neural tissues. This capacity has largely been ascribed to paracrine factors secreted by nerve-resident Schwann cells. Here, we used single-cell transcriptional profiling to identify ligands made by different injured rodent nerve cell types and have combined this with cell-surface mass spectrometry to computationally model potential paracrine interactions with peripheral neurons. These analyses show that peripheral nerves make many ligands predicted to act on peripheral and CNS neurons, in- cluding known and previously uncharacterized ligands. While Schwann cells are an important ligand source within injured nerves, more than half of the predicted ligands are made by nerve-resident mesenchymal cells, including the endoneurial cells most closely associated with peripheral axons. At least three of these mesen- chymal ligands, ANGPT1, CCL11, and VEGFC, promote growth when locally applied on sympathetic axons.
[Show full text]