
PCDHGC3 monoclonal antibody suggesting that a novel mechanism may be involved in (M01), clone 3F10 their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Catalog Number: H00005098-M01 Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly Regulatory Status: For research use only (RUO) related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a Product Description: Mouse monoclonal antibody constant region, containing 3 exons shared by all genes raised against a partial recombinant PCDHGC3. in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin Clone Name: 3F10 ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. Immunogen: PCDHGC3 (NP_002579, 71 a.a. ~ 178 These neural cadherin-like cell adhesion proteins most a.a) partial recombinant protein with GST tag. MW of the likely play a critical role in the establishment and function GST tag alone is 26 KDa. of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster Sequence: genes. [provided by RefSeq] GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVT LELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISE AVAPGTRFPLESAHDPDVGSNSLQTYELSRNE Host: Mouse Reactivity: Human Applications: ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 5098 Gene Symbol: PCDHGC3 Gene Alias: PC43, PCDH-GAMMA-C3, PCDH2 Gene Summary: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-