AP1M1 Polyclonal Antibody (A01) References: 1

Total Page：16

File Type：pdf, Size：1020Kb

AP1M1 polyclonal antibody (A01) References: 1. A novel GTP-binding protein-adaptor protein complex Catalog Number: H00008907-A01 responsible for export of Vangl2 from the trans Golgi network. Guo Y, Zanetti G, Schekman R. elife. Regulatory Status: For research use only (RUO) 2013;2:e00160. doi: 10.7554/eLife.00160. Epub 2013 Jan 8. Product Description: Mouse polyclonal antibody raised 2. Human kidney anion exchanger 1 interacts with against a partial recombinant AP1M1. adaptor-related protein complex 1 u1A (AP-1 mu1A). Sawasdee N, Junking M, Ngaojanlar P, Sukomon N, Immunogen: AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) Ungsupravate D, Limjindaporn T, Akkarapatumwong V, partial recombinant protein with GST tag. Noisakran S, Yenchitsomanus PT. Biochem Biophys Res Commun. 2010 Oct 8;401(1):85-91. Epub 2010 Sep Sequence: 15. MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPIL MEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN Host: Mouse Reactivity: Human Applications: ELISA, WB-Ce, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: 50 % glycerol Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 8907 Gene Symbol: AP1M1 Gene Alias: AP47, CLAPM2, CLTNM, MU-1A Gene Summary: The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq] Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Global-Scale Analysis of the Dynamic Transcriptional Adaptations Within Skeletal Muscle During Hypertrophic Growth
University of Kentucky UKnowledge Theses and Dissertations--Physiology Physiology 2015 GLOBAL-SCALE ANALYSIS OF THE DYNAMIC TRANSCRIPTIONAL ADAPTATIONS WITHIN SKELETAL MUSCLE DURING HYPERTROPHIC GROWTH Tyler Kirby University of Kentucky, [email protected] Right click to open a feedback form in a new tab to let us know how this document benefits ou.y Recommended Citation Kirby, Tyler, "GLOBAL-SCALE ANALYSIS OF THE DYNAMIC TRANSCRIPTIONAL ADAPTATIONS WITHIN SKELETAL MUSCLE DURING HYPERTROPHIC GROWTH" (2015). Theses and Dissertations--Physiology. 22. https://uknowledge.uky.edu/physiology_etds/22 This Doctoral Dissertation is brought to you for free and open access by the Physiology at UKnowledge. It has been accepted for inclusion in Theses and Dissertations--Physiology by an authorized administrator of UKnowledge. For more information, please contact [email protected]. STUDENT AGREEMENT: I represent that my thesis or dissertation and abstract are my original work. Proper attribution has been given to all outside sources. I understand that I am solely responsible for obtaining any needed copyright permissions. I have obtained needed written permission statement(s) from the owner(s) of each third-party copyrighted matter to be included in my work, allowing electronic distribution (if such use is not permitted by the fair use doctrine) which will be submitted to UKnowledge as Additional File. I hereby grant to The University of Kentucky and its agents the irrevocable, non-exclusive, and royalty-free license to archive and make accessible my work in whole or in part in all forms of media, now or hereafter known. I agree that the document mentioned above may be made available immediately for worldwide access unless an embargo applies.
[Show full text]
Mechanisms of Synaptic Plasticity Mediated by Clathrin Adaptor-Protein Complexes 1 and 2 in Mice
Mechanisms of synaptic plasticity mediated by Clathrin Adaptor-protein complexes 1 and 2 in mice Dissertation for the award of the degree “Doctor rerum naturalium” at the Georg-August-University Göttingen within the doctoral program “Molecular Biology of Cells” of the Georg-August University School of Science (GAUSS) Submitted by Ratnakar Mishra Born in Birpur, Bihar, India Göttingen, Germany 2019 1 Members of the Thesis Committee Prof. Dr. Peter Schu Institute for Cellular Biochemistry, (Supervisor and first referee) University Medical Center Göttingen, Germany Dr. Hans Dieter Schmitt Neurobiology, Max Planck Institute (Second referee) for Biophysical Chemistry, Göttingen, Germany Prof. Dr. med. Thomas A. Bayer Division of Molecular Psychiatry, University Medical Center, Göttingen, Germany Additional Members of the Examination Board Prof. Dr. Silvio O. Rizzoli Department of Neuro-and Sensory Physiology, University Medical Center Göttingen, Germany Dr. Roland Dosch Institute of Developmental Biochemistry, University Medical Center Göttingen, Germany Prof. Dr. med. Martin Oppermann Institute of Cellular and Molecular Immunology, University Medical Center, Göttingen, Germany Date of oral examination: 14th may 2019 2 Table of Contents List of abbreviations ................................................................................. 5 Abstract ................................................................................................... 7 Chapter 1: Introduction ............................................................................
[Show full text]
Role of Stromal Caveolin-1 (CAV1) Levels in Breast Cancer Angiogenesis
Universidad Autónoma de Madrid Programa de Doctorado en Biociencias Moleculares Role of stromal Caveolin-1 (CAV1) levels in breast cancer angiogenesis Alberto Díez Sánchez Madrid, 2018 0 1 Departamento de Bioquímica Facultad de Medicina Universidad Autónoma de Madrid Role of stromal Caveolin-1 (CAV1) levels in breast cancer angiogenesis Doctorando: Alberto Díez Sánchez, Licenciado en Biotecnología Director: Miguel Ángel del Pozo Barriuso, MD, PhD. Fundación Centro Nacional de Investigaciones Cardiovasculares Carlos III (CNIC) Madrid, 2018 1 2 CERTIFICADO DEL DIRECTOR DE TESIS El doctor Miguel Ángel del Pozo Barriuso CERTIFICA que el doctorando Alberto Díez Sánchez ha desarrollado y concluido su trabajo de tesis doctoral “Role of stromal Caveolin-1 (CAV1) levels in breast cancer angiogenesis” bajo su supervisión, en el Centro Nacional de Investigaciones Cardiovasculares (CNIC). Y para que así conste lo firma en Madrid, a 10 de Julio de 2018, Fdo. Dr. Miguel Ángel del Pozo Barriuso Centro Nacional de Investigaciones Cardiovasculares (CNIC) 3 4 ACKNOWLEDGMENTS It is said that scientific knowledge is built on top of the shoulder of giants, in more practical terms, I consider all these people below my personal giants. First ones I encountered, were my parents and grandparents, everything I have achieved has been done on top of their previous efforts, to them I dedicate my most sincere gratitude for teaching this once lazy kid the value of effort. Next, I have to thank all those high-school teachers and university professors that during my education have been able to spark in me the sense of amazement derived from understanding how nature works.
[Show full text]
Ykt6 Membrane-To-Cytosol Cycling Regulates Exosomal Wnt Secretion
bioRxiv preprint doi: https://doi.org/10.1101/485565; this version posted December 3, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Ykt6 membrane-to-cytosol cycling regulates exosomal Wnt secretion Karen Linnemannstöns1,2, Pradhipa Karuna1,2, Leonie Witte1,2, Jeanette Kittel1,2, Adi Danieli1,2, Denise Müller1,2, Lena Nitsch1,2, Mona Honemann-Capito1,2, Ferdinand Grawe3,4, Andreas Wodarz3,4 and Julia Christina Gross1,2* Affiliations: 1Hematology and Oncology, University Medical Center Goettingen, Goettingen, Germany. 2Developmental Biochemistry, University Medical Center Goettingen, Goettingen, Germany. 3Molecular Cell Biology, Institute I for Anatomy, University of Cologne Medical School, Cologne, Germany 4Cluster of Excellence-Cellular Stress Response in Aging-Associated Diseases (CECAD), Cologne, Germany *Correspondence: Dr. Julia Christina Gross, Hematology and Oncology/Developmental Biochemistry, University Medical Center Goettingen, Justus-von-Liebig Weg 11, 37077 Goettingen Germany Abstract Protein trafficking in the secretory pathway, for example the secretion of Wnt proteins, requires tight regulation. These ligands activate Wnt signaling pathways and are crucially involved in development and disease. Wnt is transported to the plasma membrane by its cargo receptor Evi, where Wnt/Evi complexes are endocytosed and sorted onto exosomes for long-range secretion. However, the trafficking steps within the endosomal compartment are not fully understood. The promiscuous SNARE Ykt6 folds into an auto-inhibiting conformation in the cytosol, but a portion associates with membranes by its farnesylated and palmitoylated C-terminus. Here, we demonstrate that membrane detachment of Ykt6 is essential for exosomal Wnt secretion.
[Show full text]
An Integrated Approach to Comprehensively Map the Molecular Context of Proteins
bioRxiv preprint doi: https://doi.org/10.1101/264788; this version posted February 13, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Liu et al. An integrated approach to comprehensively map the molecular context of proteins Xiaonan Liu1,2, Kari Salokas1,2, Fitsum Tamene1,2,3 and Markku Varjosalo1,2,3* 1Institute of Biotechnology, University of Helsinki, Helsinki 00014, Finland 2Helsinki Institute of Life Science, University of Helsinki, Helsinki 00014, Finland 3Proteomics Unit, University of Helsinki, Helsinki 00014, Finland *Corresponding author Abstract: Protein-protein interactions underlie almost all cellular functions. The comprehensive mapping of these complex cellular networks of stable and transient associations has been made available by affi nity purifi cation mass spectrometry (AP-MS) and more recently by proximity based labelling methods such as BioID. Due the advancements in both methods and MS instrumentation, an in-depth analysis of the whole human proteome is at grasps. In order to facilitate this, we designed and optimized an integrated approach utilizing MAC-tag combining both AP-MS and BioID in a single construct. We systematically applied this approach to 18 subcellular localization markers and generated a molecular context database, which can be used to defi ne molecular locations for any protein of interest. In addition, we show that by combining the AP-MS and BioID results we can also obtain interaction distances within a complex. Taken together, our combined strategy off ers comprehensive approach for mapping physical and functional protein interactions. Introduction: Majority of proteins do not function in isolation geting the endogenous bait protein, allowing and their interactions with other proteins defi ne purifi cation of the bait protein together with the their cellular functions.
[Show full text]
A Peripheral Blood Gene Expression Signature to Diagnose Subclinical Acute Rejection
CLINICAL RESEARCH www.jasn.org A Peripheral Blood Gene Expression Signature to Diagnose Subclinical Acute Rejection Weijia Zhang,1 Zhengzi Yi,1 Karen L. Keung,2 Huimin Shang,3 Chengguo Wei,1 Paolo Cravedi,1 Zeguo Sun,1 Caixia Xi,1 Christopher Woytovich,1 Samira Farouk,1 Weiqing Huang,1 Khadija Banu,1 Lorenzo Gallon,4 Ciara N. Magee,5 Nader Najaﬁan,5 Milagros Samaniego,6 Arjang Djamali ,7 Stephen I. Alexander,2 Ivy A. Rosales,8 Rex Neal Smith,8 Jenny Xiang,3 Evelyne Lerut,9 Dirk Kuypers,10,11 Maarten Naesens ,10,11 Philip J. O’Connell,2 Robert Colvin,8 Madhav C. Menon,1 and Barbara Murphy1 Due to the number of contributing authors, the afﬁliations are listed at the end of this article. ABSTRACT Background In kidney transplant recipients, surveillance biopsies can reveal, despite stable graft function, histologic features of acute rejection and borderline changes that are associated with undesirable graft outcomes. Noninvasive biomarkers of subclinical acute rejection are needed to avoid the risks and costs associated with repeated biopsies. Methods We examined subclinical histologic and functional changes in kidney transplant recipients from the prospective Genomics of Chronic Allograft Rejection (GoCAR) study who underwent surveillance biopsies over 2 years, identifying those with subclinical or borderline acute cellular rejection (ACR) at 3 months (ACR-3) post-transplant. We performed RNA sequencing on whole blood collected from 88 indi- viduals at the time of 3-month surveillance biopsy to identify transcripts associated with ACR-3, developed a novel sequencing-based targeted expression assay, and validated this gene signature in an independent cohort.
[Show full text]
Supplementary Material Table of Contents
Supplementary M aterial Table of Contents 1 - Online S u pplementary Methods ………………………………………………...… . …2 1.1 Study population……………………………………………………………..2 1.2 Quality control and principal component analysis …………………………..2 1.3 Statistical analyses………………………………………… ………………...3 1.3.1 Disease - specific association testing ……………………………… ..3 1.3.2 Cross - phenotype meta - analysis …………………………………… .3 1.3.3 Model search ……………………………………………………… .4 1.3.4 Novelty of the variants …………………………………………… ..4 1.3.5 Functional Enrichment Analy sis ………………………………… ...4 1.3.6 Drug Target Enrichment Analysis ………………………………… 5 2 - Supplementary Figures………………………………………...………………… . …. 7 3 - Members of the Myositis Genetics Consortium (MYOGEN) ……………………. ..16 4 - Members of the Scleroderma Genetics Consortium ………………… ……………...17 5 - Supplementary References………………………………………………………… . .18 6 - Supplementary Tables………………………………………………………… . ……22 1 Online supplementary m ethods Study population This study was conducted using 12,132 affected subjects and 23 ,260 controls of European des cent population and all of them have been included in previously published GWAS as summarized in Table S1. [1 - 6] Briefly, a total of 3,255 SLE cases and 9,562 ancestry matched controls were included from six countrie s across Europe and North America (Spain, Germany, Netherlands, Italy, UK, and USA). All of the included patients were diagnosed based on the standard American College of Rheumatology (ACR) classification criteria. [7] Previously described GWAS data from 2,363 SSc cases and 5,181 ancestry
[Show full text]
Drosophila and Human Transcriptomic Data Mining Provides Evidence for Therapeutic
Drosophila and human transcriptomic data mining provides evidence for therapeutic mechanism of pentylenetetrazole in Down syndrome Author Abhay Sharma Institute of Genomics and Integrative Biology Council of Scientific and Industrial Research Delhi University Campus, Mall Road Delhi 110007, India Tel: +91-11-27666156, Fax: +91-11-27662407 Email: [email protected] Nature Precedings : hdl:10101/npre.2010.4330.1 Posted 5 Apr 2010 Running head: Pentylenetetrazole mechanism in Down syndrome 1 Abstract Pentylenetetrazole (PTZ) has recently been found to ameliorate cognitive impairment in rodent models of Down syndrome (DS). The mechanism underlying PTZ’s therapeutic effect is however not clear. Microarray profiling has previously reported differential expression of genes in DS. No mammalian transcriptomic data on PTZ treatment however exists. Nevertheless, a Drosophila model inspired by rodent models of PTZ induced kindling plasticity has recently been described. Microarray profiling has shown PTZ’s downregulatory effect on gene expression in fly heads. In a comparative transcriptomics approach, I have analyzed the available microarray data in order to identify potential mechanism of PTZ action in DS. I find that transcriptomic correlates of chronic PTZ in Drosophila and DS counteract each other. A significant enrichment is observed between PTZ downregulated and DS upregulated genes, and a significant depletion between PTZ downregulated and DS dowwnregulated genes. Further, the common genes in PTZ Nature Precedings : hdl:10101/npre.2010.4330.1 Posted 5 Apr 2010 downregulated and DS upregulated sets show enrichment for MAP kinase pathway. My analysis suggests that downregulation of MAP kinase pathway may mediate therapeutic effect of PTZ in DS. Existing evidence implicating MAP kinase pathway in DS supports this observation.
[Show full text]
Exploration of the Relationships Between Tumor Mutation Burden with Immune Infiltrates in Clear Cell Renal Cell Carcinoma
648 Original Article Page 1 of 16 Exploration of the relationships between tumor mutation burden with immune infiltrates in clear cell renal cell carcinoma Chuanjie Zhang1#, Zongtai Li2#, Feng Qi3#, Xin Hu4, Jun Luo5 1Department of Urology, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai 200025, China; 2Department of Medical Oncology, Gaozhou People’s Hospital, Gaozhou 525200, China; 3Department of Urology, the First Affiliated Hospital of Nanjing Medical University, Nanjing 210029, China; 4First Clinical Medical College of Nanjing Medical University, Nanjing 210029, China; 5Department of Urology, Shanghai Fourth People’s Hospital affiliated to Tongji University School of Medicine, Shanghai 200081, China Contributions: (I) Conception and design: J Luo, C Zhang; (II) Administrative support: C Zhang; (III) Provision of study materials or patients: Z Li, F Qi; (IV) Collection and assembly of data: X Hu; (V) Data analysis and interpretation: J Luo, C Zhang; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #These authors contributed equally to this article. Correspondence to: Jun Luo. Department of Urology, Shanghai Fourth People’s Hospital affiliated to Tongji University School of Medicine, No. 1878 North Sichuan Road, Hongkou District, Shanghai 200081, China. Email: [email protected]. Background: Whether tumor mutation burden (TMB) correlated with improved survival outcomes or promotion of immunotherapies remained controversy in various malignancies. We aimed to investigate the prognosis of TMB and the potential association with immune infiltrates in clear cell renal cell carcinoma (ccRCC). Methods: We downloaded the somatic mutation data of 336 ccRCC patients from the Cancer Genome Atlas (TCGA) database, and analyzed the mutation profiles with “maftools” package.
[Show full text]
Differential Radiation Response Between Normal and Glioma Cell
Supplementary information ORIGINAL RESEARCH Short running header: Differential radiation response between normal and glioma cell Liang Gong et al Differential radiation response between normal and glioma cell revealed by comparative transcriptome analysis Liang Gong2 Jiacheng Gu1 Jianwei Ge1 Weiji Weng1 Guoyi Gao1 Junfeng Feng1 Qing Mao1 1 Department of Neurosurgery, Renji Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai 200127, P.R. China; 2 Department of Neurosurgery, Punan Hospital of Shanghai, Shanghai 200125, P.R. China Correspondence: Qing Mao Department of Neurosurgery, Ren Ji Hospital, School of Medicine, Shanghai Jiao Tong University, No. 160, Pujian road, Pudong new zone, Shanghai 200127, P.R. China. Tel: +86 2168383740 Fax: +86 2168383739 Email : [email protected] 1 Supplementary Figures Figure S1 Distribution of read length. Notes: Read length distribution of the RNA sequencing data from normal HA cell (A), radiation-treated HA cell (B), normal U251 cell (C), radiation-treated U251 cell (D). (Left: read 1, Right: read 2). 2 Figure S2 Nucleotide distribution across all reads. Notes: Nucleotide distribution of the RNA sequencing data from normal HA cell (A), radiation-treated HA cell (B), normal U251 cell (C), radiation-treated U251 cell (D). (Left: read 1, Right: read 2). 3 Figure S3 HA cells are more resistant to radiation than U251 cells. Notes: (A) Growth curves of HA and U251 cells. The cells were plated in the well of 96 well plate at a density of 3,000 cells / well. Every 12 h, the cells in the wells of three parallel plates were subjected to CCK- 8 analysis. (B) CCK-8 assay showed the cell viability of HA and U251 cells after radiation treatment.
[Show full text]
Sputum Proteomics and Airway Cell Transcripts of Current and Ex-Smokers with Severe Asthma in U-BIOPRED
Sputum proteomics and airway cell transcripts of current and ex-smokers with severe asthma in U-BIOPRED: an exploratory analysis Kentaro Takahashi 1,2, Stelios Pavlidis3, Francois Ng Kee Kwong 1, Uruj Hoda 1, Christos Rossios1, Kai Sun3, Matthew Loza4, Fred Baribaud4, Pascal Chanez5, Steve J Fowler6, Ildiko Horvath7, Paolo Montuschi8, Florian Singer9, Jacek Musial10, Barbro Dahlen11, Sven-Eric Dahlen11, N. Krug12, Thomas Sandstrom13, Dominic E. Shaw14, Rene Lutter 15, Per Bakke16, Louise J. Fleming1, Peter H. Howarth17, Massimo Caruso18, Ana R Sousa19, Julie Corfield20, Charles Auffray21, Bertrand De Meulder21, Diane Lefaudeux21, Ratko Djukanovic17, Peter J Sterk16, Yike Guo3, Ian M. Adcock1,3, Kian Fan Chung1,3 on behalf of the U-BIOPRED study group# 1National Heart & Lung Institute, Imperial College London, & Biomedical Research Unit, Biomedical Research Unit, Royal Brompton & Harefield NHS Trust, London, United Kingdom; 2Research Centre for Allergy and Clinical Immunology, Asahi General Hospital, Japan; 3Department of Computing & Data Science Institute, Imperial College London, United Kingdom; 4Janssen Research and Development, High Wycombe, Buckinghamshire, United Kingdom; 5 Assistance Publique des Hôpitaux de Marseille - Clinique des bronches, allergies et sommeil, Aix Marseille Université, Marseille, France 6 Centre for Respiratory Medicine and Allergy, Institute of Inflammation and Repair, University of Manchester and University Hospital of South Manchester, Manchester Academic Health Sciences Centre, Manchester, United Kingdom
[Show full text]
Supplementary Figures Figure S1: A) Distribution of Gene
Supplementary Figures Figure S1: A) Distribution of gene homologs from ClinVar among the species including Pan troglodytes (Chimps), Macaca mulatta (Macaca), Mus musculus (Mouse), Rattus rattus (Rat), Xenopus laevis (Xenopus), Danio rerio (Zebrafish), Drosophila melanogaster (Fruitfly), and Caenorhabditis elegans (worm) Chimp, Macaca, Mouse, Rat, Zebrafish, Xenopus, Drosophila and C. elegans B and C) We identified and categorized homologs of disease-associated genes based on the classifications of DisGeNET disease to display pie charts for mouse and C. elegans. The disease-genes distributions for Chimps, Macaca, Rat, Xenopus, Zebrafish, and Fruitfly can be found on the following website https://convart.org/pages/DiseaseStatistics.php Figure S2: A) Distribution percentage of human genetic variants (792,968 variants) in the ClinVar database (downloaded on January 3, 2021). Single nucleotide variants (SNVs) make up the majority of the human genetic variants in the ClinVar database, followed by deletions. B) Graph displays the percentage breakdown of SNPs (701,905 variants) in the ClinVar database, including pathogenic, benign, and variants of uncertain significance (VUS) Figure S3: Amino sequence of Apm1p from Saccharomyces cerevisiae (NP_015064.1) were retrieved from NCBI and were then submitted to ConVarT for Needleman-Wunsch global alignment. ConVarT has successfully discovered human AP1M1, the human ortholog of S. cerevisiae Apm1p, displaying amino acid variants from humans on the pairwise alignment of human AP1M1 and S. cerevisiae Apm1p. Shown is the p.N180D variant from COSMIC between human AP1M1 and yeast Apm1p. The entry of new variant and phenotypic data ConVarT is an open-access platform, enabling scientists to easily submit variant and/or phenotype data to ConVarT to disseminate the knowledge they produce.
[Show full text]