AP1M1 Polyclonal Antibody (A01) References: 1

AP1M1 Polyclonal Antibody (A01) References: 1

AP1M1 polyclonal antibody (A01) References: 1. A novel GTP-binding protein-adaptor protein complex Catalog Number: H00008907-A01 responsible for export of Vangl2 from the trans Golgi network. Guo Y, Zanetti G, Schekman R. elife. Regulatory Status: For research use only (RUO) 2013;2:e00160. doi: 10.7554/eLife.00160. Epub 2013 Jan 8. Product Description: Mouse polyclonal antibody raised 2. Human kidney anion exchanger 1 interacts with against a partial recombinant AP1M1. adaptor-related protein complex 1 u1A (AP-1 mu1A). Sawasdee N, Junking M, Ngaojanlar P, Sukomon N, Immunogen: AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) Ungsupravate D, Limjindaporn T, Akkarapatumwong V, partial recombinant protein with GST tag. Noisakran S, Yenchitsomanus PT. Biochem Biophys Res Commun. 2010 Oct 8;401(1):85-91. Epub 2010 Sep Sequence: 15. MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPIL MEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN Host: Mouse Reactivity: Human Applications: ELISA, WB-Ce, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: 50 % glycerol Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 8907 Gene Symbol: AP1M1 Gene Alias: AP47, CLAPM2, CLTNM, MU-1A Gene Summary: The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq] Page 1/1 Powered by TCPDF (www.tcpdf.org).

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    1 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us