AP1M1 polyclonal antibody (A01) References: 1. A novel GTP-binding protein-adaptor protein complex Catalog Number: H00008907-A01 responsible for export of Vangl2 from the trans Golgi network. Guo Y, Zanetti G, Schekman R. elife. Regulatory Status: For research use only (RUO) 2013;2:e00160. doi: 10.7554/eLife.00160. Epub 2013 Jan 8. Product Description: Mouse polyclonal antibody raised 2. Human kidney anion exchanger 1 interacts with against a partial recombinant AP1M1. adaptor-related protein complex 1 u1A (AP-1 mu1A). Sawasdee N, Junking M, Ngaojanlar P, Sukomon N, Immunogen: AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) Ungsupravate D, Limjindaporn T, Akkarapatumwong V, partial recombinant protein with GST tag. Noisakran S, Yenchitsomanus PT. Biochem Biophys Res Commun. 2010 Oct 8;401(1):85-91. Epub 2010 Sep Sequence: 15. MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPIL MEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN Host: Mouse Reactivity: Human Applications: ELISA, WB-Ce, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: 50 % glycerol Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 8907 Gene Symbol: AP1M1 Gene Alias: AP47, CLAPM2, CLTNM, MU-1A Gene Summary: The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq] Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-