DOCSLIB.ORG

2017 Bhaloo Shirin Ethesis

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
2017 Bhaloo Shirin Ethesis This electronic thesis or dissertation has been downloaded from the King’s Research Portal at https://kclpure.kcl.ac.uk/portal/ Vascular Stem Cell Migration in Response to Dkk3 in Vascular Diseases The emergence of a novel chemokine-like protein Bhaloo, Shirin Issa Awarding institution: King's College London The copyright of this thesis rests with the author and no quotation from it or information derived from it may be published without proper acknowledgement. END USER LICENCE AGREEMENT Unless another licence is stated on the immediately following page this work is licensed under a Creative Commons Attribution-NonCommercial-NoDerivatives 4.0 International licence. https://creativecommons.org/licenses/by-nc-nd/4.0/ You are free to copy, distribute and transmit the work Under the following conditions: Attribution: You must attribute the work in the manner specified by the author (but not in any way that suggests that they endorse you or your use of the work). Non Commercial: You may not use this work for commercial purposes. No Derivative Works - You may not alter, transform, or build upon this work. Any of these conditions can be waived if you receive permission from the author. Your fair dealings and other rights are in no way affected by the above. Take down policy If you believe that this document breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 09. Oct. 2021 Vascular Stem Cell Migration in Response to Dkk3 in Vascular Diseases The emergence of a novel chemokine-like protein By Shirin Issa Bhaloo A thesis submitted to King’s College London for the degree of Doctor of Philosophy Cardiovascular Division Faculty of Life Sciences & Medicine King’s College London May 2017 0 In dedication to my Family 1 Acknowledgements I wish to express my sincere gratitude to Professor Qingbo Xu for giving me the opportunity to pursue a PhD degree in his laboratory at King’s College London. His support, trust, advice, motivation and encouragement throughout my PhD were invaluable and I will always take them with me. I would like to specially thank Dr. Alexandra Le Bras for her daily supervision, for all the knowledge, expertise and time she shared, for the motivation and support she gave and for her precious advice, not only for my student life but also for my daily life. I also wish to convey my appreciation to Dr. Yanhua Hu for her kind help and suggestions, particularly regarding animal work, and for her valuable support and encouragement during my PhD. I would like to thank Ms. Sherrie King for her indispensable help in so many aspects of my PhD journey and for her daily smile and deeply cherished support and friendship. Many thanks to Zhongyi Zhang for sharing his technical expertise and for his positivity and patience. I also wish to thank my colleagues Ms. Wenduo Gu (Wendy), Mr. Yao Xie, Dr. Xuechong Hong (Stella), Dr. Ka Hou Lao (Raymond), Dr. Ana Moraga, Ms. Peiyi Luo, Mr. Zhichao Ni and Dr. Witold Nowak, for all the memorable moments we shared, including so many dinners, adventures and trips, which I hope they continue for a long and fun time. Most importantly, I would like to thank my dear Parents and Sister, for always believing in me, supporting me and giving me so much love and courage. Finally, I wish to express my appreciation to the Marie Curie Initial Training Network Research Fellowship Program and the British Heart Foundation for funding my PhD project. 2 Declaration I, Shirin Issa Bhaloo, confirm that the work presented in this thesis is my own and I have been involved in the design, planning and conduct of all the experiments and the thesis writing. Expert assistance was provided in some aspects of the project by the following colleagues from the Cardiovascular Division of King’s College London. Dr. Yanhua Hu isolated vascular progenitor cells and smooth muscle cells from murine aorta. For the ex vivo experiments, Dr. Hu also isolated murine aorta vessels. The vector pShuttle-FLAG-HA was kindly provided by Dr. Lingfang Zeng. 3 Abstract Stem/Progenitor cells, such as Sca-1+ cells, are abundant in the vascular adventitia and they can differentiate into SMCs and ECs. These cells participate in the vascular wall remodeling observed in atherosclerosis, injury-induced neointimal hyperplasia and vein graft atherosclerosis. The detailed mechanisms of progenitor cell migration towards the intima have not been fully investigated. We hypothesize that Dkk3 plays an important role in resident Sca-1+ vascular progenitor cell migration. In this work, mouse vascular progenitor cells were isolated from the adventitia and sorted for the Sca-1 marker. Using transwell and wound healing assays, we showed that Dkk3 induced adventitia- derived Sca-1+ vascular progenitor cell (Sca-1+ APCs) migration in vitro. Additionally, the aortic ring assay demonstrated that Dkk3 was also able to induce Sca-1+ cell migration ex vivo. Analysis of the signaling pathways revealed that MAPK kinase signalling cascade, PI3K/AKT pathway and Rho- GTPases family of proteins were involved in the regulation of Dkk3-induced Sca-1+ progenitor cell migration. Our experiments also identified similarities in the migratory response of Sca-1+ cells to Dkk3 and Sdf-1α. Sdf-1α receptors are well established and they include CXCR4 and CXCR7. In contrast, the receptor for Dkk3 has not been identified yet. The current study aimed at identifying the receptor(s) involved in Dkk3-driven migration of Sca-1+ cells. Co-IP analysis and Affinity Binding assay revealed that Dkk3 binds to CXCR7. The downregulation of CXCR7 by SiRNA transfection reduced Dkk3-mediated Sca-1+ APC migration and the activation of the downstream signalling pathways. Overexpression of CXCR7, on the contrary, enhanced cell migration. In order to perform an exhaustive analysis of the potential binding partners of Dkk3 and identify additional receptors, we performed a Yeast Two Hybrid experiment. The results showed that integrin α5 (ITGα5) and integrin β1 (ITGβ1) interacted with Dkk3. Co-IP and Affinity Binding assays confirmed that Dkk3 bound to ITGα5 and ITGβ1. Furthermore, downregulation of these integrins by SiRNA transfection supressed the migration of Sca-1+ APCs triggered by Dkk3. Our work shows for the first time that Dkk3 acts as a chemokine-like protein able to induce the migration of resident Sca-1+ vascular progenitor cells. The pioneer identification of Dkk3 receptors and the elucidation of the signalling pathways involved in Sca-1+ APC migration could be of major interest for the development of novel drug-targeted therapies in vascular diseases. 4 Table of Contents Abstract ................................................................................................................................................... 4 Abbreviations ........................................................................................................................................ 10 List of Figures ........................................................................................................................................ 15 List of Tables ......................................................................................................................................... 19 Chapter 1: Introduction .................................................................................................................. 20 1.1 The Vascular System ............................................................................................................. 21 1.1.1 The evolution on the knowledge of the arterial adventitia .......................................... 22 1.2 Vascular progenitor cells ....................................................................................................... 23 1.2.1 Circulating vascular progenitor cells .................................................................................... 23 1.2.2 Resident vascular progenitor cells ....................................................................................... 25 1.2.3 Sca-1+ Vascular Progenitor Cells ................................................................................... 30 1.3 Atherosclerosis ...................................................................................................................... 31 1.3.1 Pathogenesis of Atherosclerosis ................................................................................... 31 1.3.2 Endothelial cells and Smooth muscle cells in atherosclerosis ...................................... 33 1.3.3 The role of vascular progenitor cells in atherosclerosis ............................................... 35 1.3.4 Treatment of atherosclerosis ........................................................................................ 38 1.3.5 Complications ................................................................................................................ 39 1.4 Cytokines in atherosclerosis ................................................................................................. 41 1.4.1 The Chemokine – Chemokine receptor System ............................................................ 44 1.5 Cell migration ........................................................................................................................ 57 1.5.1 Signalling pathways involved in cell migration ............................................................. 61 1.5.2 The role of integrins in cell migration ..........................................................................
Load more

Recommended publications
  • Supplemental Table S1
    Entrez Gene Symbol Gene Name Affymetrix EST Glomchip SAGE Stanford Literature HPA confirmed Gene ID Profiling profiling Profiling Profiling array profiling confirmed 1 2 A2M alpha-2-macroglobulin 0 0 0 1 0 2 10347 ABCA7 ATP-binding cassette, sub-family A (ABC1), member 7 1 0 0 0 0 3 10350 ABCA9 ATP-binding cassette, sub-family A (ABC1), member 9 1 0 0 0 0 4 10057 ABCC5 ATP-binding cassette, sub-family C (CFTR/MRP), member 5 1 0 0 0 0 5 10060 ABCC9 ATP-binding cassette, sub-family C (CFTR/MRP), member 9 1 0 0 0 0 6 79575 ABHD8 abhydrolase domain containing 8 1 0 0 0 0 7 51225 ABI3 ABI gene family, member 3 1 0 1 0 0 8 29 ABR active BCR-related gene 1 0 0 0 0 9 25841 ABTB2 ankyrin repeat and BTB (POZ) domain containing 2 1 0 1 0 0 10 30 ACAA1 acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiol 0 1 0 0 0 11 43 ACHE acetylcholinesterase (Yt blood group) 1 0 0 0 0 12 58 ACTA1 actin, alpha 1, skeletal muscle 0 1 0 0 0 13 60 ACTB actin, beta 01000 1 14 71 ACTG1 actin, gamma 1 0 1 0 0 0 15 81 ACTN4 actinin, alpha 4 0 0 1 1 1 10700177 16 10096 ACTR3 ARP3 actin-related protein 3 homolog (yeast) 0 1 0 0 0 17 94 ACVRL1 activin A receptor type II-like 1 1 0 1 0 0 18 8038 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 1 0 0 0 0 19 8751 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 1 0 0 0 0 20 8728 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 1 0 0 0 0 21 81792 ADAMTS12 ADAM metallopeptidase with thrombospondin type 1 motif, 12 1 0 0 0 0 22 9507 ADAMTS4 ADAM metallopeptidase with thrombospondin type 1
    [Show full text]
  • Comparison of Gene Expression Profiles in Chromate Transformed BEAS-2B Cells
    Comparison of Gene Expression Profiles in Chromate Transformed BEAS-2B Cells Hong Sun1, Harriet A. Clancy1, Thomas Kluz1, Jiri Zavadil2, Max Costa1* 1 Nelson Institute of Environmental Medicine, New York University School of Medicine, Tuxedo, New York, United States of America, 2 Department of Pathology, NYU Cancer Institute and Center for Health Informatics and Bioinformatics, NYU Langone Medical Center, New York, New York, United States of America Abstract Background: Hexavalent chromium [Cr(VI)] is a potent human carcinogen. Occupational exposure has been associated with increased risk of respiratory cancer. Multiple mechanisms have been shown to contribute to Cr(VI) induced carcinogenesis, including DNA damage, genomic instability, and epigenetic modulation, however, the molecular mechanism and downstream genes mediating chromium’s carcinogenicity remain to be elucidated. Methods/Results: We established chromate transformed cell lines by chronic exposure of normal human bronchial epithelial BEAS-2B cells to low doses of Cr(VI) followed by anchorage-independent growth. These transformed cell lines not only exhibited consistent morphological changes but also acquired altered and distinct gene expression patterns compared with normal BEAS-2B cells and control cell lines (untreated) that arose spontaneously in soft agar. Interestingly, the gene expression profiles of six Cr(VI) transformed cell lines were remarkably similar to each other yet differed significantly from that of either control cell lines or normal BEAS-2B cells. A total of 409 differentially expressed genes were identified in Cr(VI) transformed cells compared to control cells. Genes related to cell-to-cell junction were upregulated in all Cr(VI) transformed cells, while genes associated with the interaction between cells and their extracellular matrices were down-regulated.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Molecular and Cellular Mechanisms of the Angiogenic Effect of Poly(Methacrylic Acid-Co-Methyl Methacrylate) Beads
    Molecular and Cellular Mechanisms of the Angiogenic Effect of Poly(methacrylic acid-co-methyl methacrylate) Beads by Lindsay Elizabeth Fitzpatrick A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Institute of Biomaterials and Biomedical Engineering University of Toronto © Copyright by Lindsay Elizabeth Fitzpatrick 2012 Molecular and Cellular Mechanisms of the Angiogenic Effect of Poly(methacrylic acid-co-methyl methacrylate) Beads Lindsay Elizabeth Fitzpatrick Doctorate of Philosophy Institute of Biomaterials and Biomedical Engineering University of Toronto 2012 Abstract Poly(methacrylic acid -co- methyl methacrylate) beads were previously shown to have a therapeutic effect on wound closure through the promotion of angiogenesis. However, it was unclear how this polymer elicited its beneficial properties. The goal of this thesis was to characterize the host response to MAA beads by identifying molecules of interest involved in MAA-mediated angiogenesis (in comparison to poly(methyl methacrylate) beads, PMMA). Using a model of diabetic wound healing and a macrophage-like cell line (dTHP-1), eight molecules of interest were identified in the host response to MAA beads. Gene and/or protein expression analysis showed that MAA beads increased the expression of Shh, IL-1β, IL-6, TNF- α and Spry2, but decreased the expression of CXCL10 and CXCL12, compared to PMMA and no beads. MAA beads also appeared to modulate the expression of OPN. In vivo, the global gene expression of OPN was increased in wounds treated with MAA beads, compared to PMMA and no beads. In contrast, dTHP-1 decreased OPN gene expression compared to PMMA and no beads, but expressed the same amount of secreted OPN, suggesting that the cells decreased the expression of the intracellular isoform of OPN.
    [Show full text]
  • Gene Alterations Identified by Expression Profiling in Tumor-Associated Endothelial Cells from Invasive Ovarian Carcinoma
    Research Article Gene Alterations Identified by Expression Profiling in Tumor-Associated Endothelial Cells from Invasive Ovarian Carcinoma Chunhua Lu,1 Tomas Bonome,3 Yang Li,1 Aparna A. Kamat,1 Liz Y. Han,1 Rosemarie Schmandt,1 Robert L. Coleman,1 David M. Gershenson,1 Robert B. Jaffe,4 MichaelJ. Birrer, 3 and AnilK. Sood 1,2 Departments of 1Gynecologic Oncology and 2Cancer Biology, University of Texas M. D. Anderson Cancer Center, Houston, Texas; 3Cell and Cancer Biology Branch, National Cancer Institute, Bethesda, Maryland; and 4Center for Reproductive Sciences, University of California, San Francisco, San Francisco, California Abstract the promise of such approaches. However, the full spectrum of Therapeutic strategies based on antiangiogenic approaches differences in the tumor vasculature compared with its normal are beginning to show great promise in clinical studies. counterpart is not known. Identification of additional targets on However, full realization of these approaches requires tumor endothelium may allow opportunities for developing new identification of key differences in gene expression between therapeutic approaches to inhibit angiogenesis in a tumor-specific endothelial cells from tumors versus their normal counter- manner. parts. Here, we examined gene expression differences in Higher levels of proangiogenic cytokines and angiogenesis are purified endothelial cells from 10invasive epithelial ovarian associated with an increased risk of metastasis and poor prognosis cancers and 5 normal ovaries using Affymetrix U133 Plus in ovarian cancer (5, 6). To date, a small number of breast, colon, 2.0microarrays. More than 400differentially expressed genes and brain cancers have been analyzed for gene expression changes were identified in tumor-associated endothelial cells.
    [Show full text]
  • MRFAP1 (NM 033296) Human Tagged ORF Clone – RG206815
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG206815 MRFAP1 (NM_033296) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: MRFAP1 (NM_033296) Human Tagged ORF Clone Tag: TurboGFP Symbol: MRFAP1 Synonyms: PAM14; PGR1 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG206815 representing NM_033296 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGGCCCCTGGACATCGTCGAGCTGGCGGAACCGGAGGAAGTGGAGGTGCTGGAGCCCGAGGAGGATT TCGAGCAGTTTCTGCTCCCGGTCATCAACGAGATGCGCGAGGACATCGCGTCGCTGACGCGCGAGCACGG GCGGGCGTACCTGCGGAACCGGAGCAAGCTGTGGGAGATGGACAATATGCTCATCCAGATCAAAACGCAG GTGGAGGCCTCGGAGGAGAGCGCCCTCAACCACCTCCAGAACCCGGGCGACGCGGCCGAGGGCCGGGCGG CCAAGAGGTGCGAGAAGGCCGAGGAGAAGGCCAAGGAGATTGCGAAGATGGCAGAGATGCTGGTGGAGCT GGTCCGGCGGATAGAGAAGAGCGAGTCGTCG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG206815 representing NM_033296 Red=Cloning site Green=Tags(s) MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQ VEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRRIEKSESS TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville,
    [Show full text]
  • Stroke Genetics and Genomics
    Faculdade de Medicina da Universidade de Lisboa Unidade Neurológica de Investigação Clínica PhD Thesis Stroke Genetics and Genomics Tiago Krug Coelho Host Institution: Instituto Gulbenkian de Ciência Supervisor at Instituto Gulbenkian de Ciência: Doctor Sofia Oliveira Supervisor at Faculdade de Medicina da Universidade de Lisboa: Professor José Ferro PhD in Biomedical Sciences Specialization in Neurosciences 2010 Stroke Genetics and Genomics A ciência tem, de facto, um único objectivo: a verdade. Não esgota perfeitamente a sua tarefa se não descobre a causa do todo. Chiara Lubich i Stroke Genetics and Genomics ii Stroke Genetics and Genomics A impressão desta dissertação foi aprovada pela Comissão Coordenadora do Conselho Científico da Faculdade de Medicina de Lisboa em reunião de 28 de Setembro de 2010. iii Stroke Genetics and Genomics iv Stroke Genetics and Genomics As opiniões expressas são da exclusiva responsabilidade do seu autor. v Stroke Genetics and Genomics vi Stroke Genetics and Genomics Abstract ABSTRACT This project presents a comprehensive approach to the identification of new genes that influence the risk for developing stroke. Stroke is the leading cause of death in Portugal and the third leading cause of death in the developed world. It is even more disabling than lethal, and the persistent neurological impairment and physical disability caused by stroke have a very high socioeconomic cost. Moreover, the number of affected individuals is expected to increase with the current aging of the population. Stroke is a “brain attack” cutting off vital blood and oxygen to the brain cells and it is a complex disease resulting from environmental and genetic factors.
    [Show full text]
  • WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T (51) International Patent Classification: David [US/US]; 13539 N . 95th Way, Scottsdale, AZ C12Q 1/68 (2006.01) 85260 (US). (21) International Application Number: (74) Agent: AKHAVAN, Ramin; Caris Science, Inc., 6655 N . PCT/US20 12/0425 19 Macarthur Blvd., Irving, TX 75039 (US). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 14 June 2012 (14.06.2012) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, English (25) Filing Language: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, Publication Language: English DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, (30) Priority Data: KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, 61/497,895 16 June 201 1 (16.06.201 1) US MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, 61/499,138 20 June 201 1 (20.06.201 1) US OM, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SC, SD, 61/501,680 27 June 201 1 (27.06.201 1) u s SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, 61/506,019 8 July 201 1(08.07.201 1) u s TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW.
    [Show full text]
  • KRAS Mutations Are Negatively Correlated with Immunity in Colon Cancer
    www.aging-us.com AGING 2021, Vol. 13, No. 1 Research Paper KRAS mutations are negatively correlated with immunity in colon cancer Xiaorui Fu1,2,*, Xinyi Wang1,2,*, Jinzhong Duanmu1, Taiyuan Li1, Qunguang Jiang1 1Department of Gastrointestinal Surgery, The First Affiliated Hospital of Nanchang University, Nanchang, Jiangxi, People's Republic of China 2Queen Mary College, Medical Department, Nanchang University, Nanchang, Jiangxi, People's Republic of China *Equal contribution Correspondence to: Qunguang Jiang; email: [email protected] Keywords: KRAS mutations, immunity, colon cancer, tumor-infiltrating immune cells, inflammation Received: March 27, 2020 Accepted: October 8, 2020 Published: November 26, 2020 Copyright: © 2020 Fu et al. This is an open access article distributed under the terms of the Creative Commons Attribution License (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT The heterogeneity of colon cancer tumors suggests that therapeutics targeting specific molecules may be effective in only a few patients. It is therefore necessary to explore gene mutations in colon cancer. In this study, we obtained colon cancer samples from The Cancer Genome Atlas, and the International Cancer Genome Consortium. We evaluated the landscape of somatic mutations in colon cancer and found that KRAS mutations, particularly rs121913529, were frequent and had prognostic value. Using ESTIMATE analysis, we observed that the KRAS-mutated group had higher tumor purity, lower immune score, and lower stromal score than the wild- type group. Through single-sample Gene Set Enrichment Analysis and Gene Set Enrichment Analysis, we found that KRAS mutations negatively correlated with enrichment levels of tumor infiltrating lymphocytes, inflammation, and cytolytic activities.
    [Show full text]
  • Views for Entrez
    BASIC RESEARCH www.jasn.org Phosphoproteomic Analysis Reveals Regulatory Mechanisms at the Kidney Filtration Barrier †‡ †| Markus M. Rinschen,* Xiongwu Wu,§ Tim König, Trairak Pisitkun,¶ Henning Hagmann,* † † † Caroline Pahmeyer,* Tobias Lamkemeyer, Priyanka Kohli,* Nicole Schnell, †‡ †† ‡‡ Bernhard Schermer,* Stuart Dryer,** Bernard R. Brooks,§ Pedro Beltrao, †‡ Marcus Krueger,§§ Paul T. Brinkkoetter,* and Thomas Benzing* *Department of Internal Medicine II, Center for Molecular Medicine, †Cologne Excellence Cluster on Cellular Stress | Responses in Aging-Associated Diseases, ‡Systems Biology of Ageing Cologne, Institute for Genetics, University of Cologne, Cologne, Germany; §Laboratory of Computational Biology, National Heart, Lung, and Blood Institute, National Institutes of Health, Bethesda, Maryland; ¶Faculty of Medicine, Chulalongkorn University, Bangkok, Thailand; **Department of Biology and Biochemistry, University of Houston, Houston, Texas; ††Division of Nephrology, Baylor College of Medicine, Houston, Texas; ‡‡European Molecular Biology Laboratory–European Bioinformatics Institute, Hinxton, Cambridge, United Kingdom; and §§Max Planck Institute for Heart and Lung Research, Bad Nauheim, Germany ABSTRACT Diseases of the kidney filtration barrier are a leading cause of ESRD. Most disorders affect the podocytes, polarized cells with a limited capacity for self-renewal that require tightly controlled signaling to maintain their integrity, viability, and function. Here, we provide an atlas of in vivo phosphorylated, glomerulus- expressed
    [Show full text]
  • Zimmer Cell Calcium 2013 Mammalian S100 Evolution.Pdf
    Cell Calcium 53 (2013) 170–179 Contents lists available at SciVerse ScienceDirect Cell Calcium jo urnal homepage: www.elsevier.com/locate/ceca Evolution of the S100 family of calcium sensor proteins a,∗ b b,1 b Danna B. Zimmer , Jeannine O. Eubanks , Dhivya Ramakrishnan , Michael F. Criscitiello a Center for Biomolecular Therapeutics and Department of Biochemistry & Molecular Biology, University of Maryland School of Medicine, 108 North Greene Street, Baltimore, MD 20102, United States b Comparative Immunogenetics Laboratory, Department of Veterinary Pathobiology, College of Veterinary Medicine & Biomedical Sciences, Texas A&M University, College Station, TX 77843-4467, United States a r t i c l e i n f o a b s t r a c t 2+ Article history: The S100s are a large group of Ca sensors found exclusively in vertebrates. Transcriptomic and genomic Received 4 October 2012 data from the major radiations of mammals were used to derive the evolution of the mammalian Received in revised form 1 November 2012 S100s genes. In human and mouse, S100s and S100 fused-type proteins are in a separate clade from Accepted 3 November 2012 2+ other Ca sensor proteins, indicating that an ancient bifurcation between these two gene lineages Available online 14 December 2012 has occurred. Furthermore, the five genomic loci containing S100 genes have remained largely intact during the past 165 million years since the shared ancestor of egg-laying and placental mammals. Keywords: Nonetheless, interesting births and deaths of S100 genes have occurred during mammalian evolution. Mammals The S100A7 loci exhibited the most plasticity and phylogenetic analyses clarified relationships between Phylogenetic analyses the S100A7 proteins encoded in the various mammalian genomes.
    [Show full text]
  • Content Based Search in Gene Expression Databases and a Meta-Analysis of Host Responses to Infection
    Content Based Search in Gene Expression Databases and a Meta-analysis of Host Responses to Infection A Thesis Submitted to the Faculty of Drexel University by Francis X. Bell in partial fulfillment of the requirements for the degree of Doctor of Philosophy November 2015 c Copyright 2015 Francis X. Bell. All Rights Reserved. ii Acknowledgments I would like to acknowledge and thank my advisor, Dr. Ahmet Sacan. Without his advice, support, and patience I would not have been able to accomplish all that I have. I would also like to thank my committee members and the Biomed Faculty that have guided me. I would like to give a special thanks for the members of the bioinformatics lab, in particular the members of the Sacan lab: Rehman Qureshi, Daisy Heng Yang, April Chunyu Zhao, and Yiqian Zhou. Thank you for creating a pleasant and friendly environment in the lab. I give the members of my family my sincerest gratitude for all that they have done for me. I cannot begin to repay my parents for their sacrifices. I am eternally grateful for everything they have done. The support of my sisters and their encouragement gave me the strength to persevere to the end. iii Table of Contents LIST OF TABLES.......................................................................... vii LIST OF FIGURES ........................................................................ xiv ABSTRACT ................................................................................ xvii 1. A BRIEF INTRODUCTION TO GENE EXPRESSION............................. 1 1.1 Central Dogma of Molecular Biology........................................... 1 1.1.1 Basic Transfers .......................................................... 1 1.1.2 Uncommon Transfers ................................................... 3 1.2 Gene Expression ................................................................. 4 1.2.1 Estimating Gene Expression ............................................ 4 1.2.2 DNA Microarrays ......................................................
    [Show full text]