M V 2>>;2DCB)6ide8Va^[dgc^VX]Z[gZk^kZhi]Z\djgbZihVaVb^q?PVT!(

123 Years of transforming individuals into life-long achievers! www.nyack.edu/dc 202.220.1300

:IN;EB<:MBHGH?  u  EBO> :EE =:R :M PPP'K>:=>QIK>LL'=k:pZo^h_obhe^gm\kbf^lp^^i& [hkahh]lma^r]hghmebo^bg'Ë >Zkeb^k Mn^l]Zr% bg`Z\khll]hpgmhpgPZlabg`mhg%ma^FZee KZfl^rlZb]PZlabg`mhgÍlkZib]^\hghfb\ KZfl^rk^Z\m^]mhZk^\^gm Zg]hma^kZk^Zlhg\^\hglb]^k^]lZ_^bl]n^ `khpmaf^ZglÊfhk^i^hie^Zk^\hfbg`bgmh lnk`^bgahfb\b]^l[r bgiZkmmhZ`khpbg`mk^g]Zfhg`\kbfbgZel ma^\bmrZg]]b__^k^gmZk^ZlZk^[^bg`ihin& ]^\eZkbg`ZÊ\kbf^^f^k& mh`hpa^k^ma^fhg^rbl%='<'Iheb\^

$!.)%,"!2$/5#!.!,0,53!0 Pa^k^Zl\kbfbgZelhg\^lmn\dpbmabgZ :gmahgr:'PbeebZflÍp^^derg^pl\hg_^k& Z]cnlmh__b\^klÍl\a^]ne^l &RANCES:IDANEAPOLOGIZEDFORHISHEADBUTT fbe^h_ma^bkahf^lpa^gma^rl^mhnm_hkZ ^g\^Zmma^Chag:'Pbelhg;nbe]bg`ÉZ]Zr Zg]k^lmkb\mma^bk]Zrlh__' gb`amh_kh[[^krZg][nk`eZkr%KZfl^rlZb] Z_m^klbqi^hie^p^k^kh[[^]hgma^FZeebg ?hnkm^^gi^hie^aZo^[^^gdbee^]lbg\^ CP[ZX]V7TPS)O^YVcZhVnh Zkk^lmiZmm^kglghplahpZÊmk^g]pa^k^fhk^ mphl^iZkZm^bg\b]^gmleZm^Mn^l]Zrgb`am' Cner*bgma^=blmkb\m%bgZeejnZ]kZgmlh_ma^ >iVa^Vc^chjaiZYbdb!h^hiZgq $ Zg]fhk^i^hie^Zk^[^bg`Zkk^lm^]bgg^b`a& Bghg^h_ma^bg\b]^gml%ZphfZgZelhpZl \bmr';>A8<>=C6><4AHC74F0B78=6C>=?>BC

78E1aTPZcWa^dVW);96 D@hi]gZZ"^c"dcZYV^ane^aaq" 8baPT[4]cTab;TQP]^]>eTa¼0Rc^UFPa½ 1[TPRW?Pach) L]^iZ[Vh]^dch ndjXVclZVg ^cid[Vaaq"

B\Pac6Xa[) D]b_gZ^ckZcih ]ZghZa[VhVgdX` YncVbdl^i] VbW^i^dch# 6ahd!9#8#Éh =^e"=de I]ZVigZ;Zhi# --8=B834 /$%$"!,),49!0

>=C74>554=B8E4))SRAELISOLDIERSPREPARETOFIREONSOUTHERN,EBANON7EDNESDAY)SRAELIFORCESENTERED,EBANONOVERTHEABDUCTIONOFTWOSOLDIERSBY (EZBOLLAHGUERRILLASINARAID DEEMEDANhACTOFWARvBY)SRAELI0RIME-INISTER%HUD/LMERT1[^^ShQPcc[T)'8baPT[Xb";TQP]TbTPaTZX[[TSk?PVT( FTPcWTa--7TPehBc^a\

?A><>C8>=BkF^acW8cbFTXVWcX]6^P[0RWPX]^U BP[TbPcA420BC>=?064" _^]bT`dP[X]eP[dTc^cWTR^bc^UcWTCEXU8cP[hf^]cWTF^a[S2d_ P]RTX]RPbT^UP]8cP[heXRc^ah0?4hT>_T]Tabk?PVT! !k4G?A4BBk & "! %kC7DAB30H ThTDeZcZgh CA08=8=6

C427=>;>6H F^^[ 3^f][^PS8cc^ H^daXBRT]cb AXSX]V 0EOPLESTOPPINGTOSMELLTHEROSESCANNOWTAKETHAT 1d[[aXSX]VXb[XZTP]hcWX]VT[bT)H^d SWEETFLORALFRAGRANCEHOMEWITHTHEM OREVENSENDITTO V^ccPbcPacb^\TfWTaTPbBPfhTa AFARAWAYGRANDMOTHER THANKSTOANEWGADGETIN*APAN A^QTab^]¹fW^Wd]V^]fWX[TR^\ THATRECORDSANDREPLICATESTHEWORLDSODORS4HENEW _TcX]VX]cWT

022><>30C8>=B WHICHWILLHOLDFIRST CLASSAND "!2"!2!*0%2%.)#!0 BWTT_»4G?A4BB BUSINESS CLASSSEATS0ASSENGERSWILL ;XVWcD_cWTBZXTb HAVEACCESSTOTELEVISIONS $6$S GOUR !NEWAIRLINEONLYFORSMOKERSISSET METFOODˆAND OFCOURSE ASHTRAYS <>18;47><4B THECOUNTYASBEINGWORTHMILLION NOWTHECOUNTYWILLHAVETORAISEPROP TOMAKEITSFIRSTFLIGHTIN-ARCH THE h!LLOWINGOURGUESTSTOSMOKEISONE ˆTHROWINGTHEENTIRECOUNTYBUDGET ERTYTAXESTOMAKEUPFORTHESHORTFALL 3YDNEY-ORNING(ERALDREPORTED OFTHEFREEDOMSWEAREHAPPILYPRE

The study includes medical and psychiatric evaluations, and Tournament research medication at no cost. Transportation reimbursement Bryans Road Vol. Fire Department provided. 3099 Livingston Road • Bryans Road, MD 20616 Atendemos pacientes de habla hispana. Friday July 14th , 2006 Call: 301-496-5645 (TTY: 1-866-411-1010) Doors Open at 5 PM • Playing Starts at 7:30 PM http://patientinfo.nimh.nih.gov If 200 Seats a re Sold $150 Entry Fee $1800 in Chips w i l l R e c e i v e C or for other studies: www.clinicaltrials.gov r s a s h One Time $40 Buy Back up y e P a r Thru First Hour $1000 in chips l i z P e 5 s The National Institute of Mental Health 2 Top Prize Side Games Provided p

National Institutes of Health, Department of Health & Human Services o 00 T $ BlackJack 10,000. Open Bar • Free Food st Drive you. for 1 place 18 to Play, 21 to Drink “Cars” can put you in the right wheels. Wednesdays. Else prizes awarded and amounts will For Information call 301-375-7055, be determined by number of players X017b 3x1 or 301-375-7135, leave name and phone number. C7DAB30Hk & "! %k4G?A4BBk" Æ>ÉkZa^kZY^ci]Zh]dZhd[VldbVcVcY>ÉkZa^kZY^ci]Zh]dZhd[VbVc#>iÉh XVjhZYbZidgZ[aZXidci]ZWVgg^ZghldbZc[VXZ#LjBcP]U^aS_a^UTbb^a1T]1PaaTb =PcX^] WHOISTRANSGENDERED EXPLAININGTHATPREJUDICEISTHEMAINREASONFORTHELACKOFWOMENINSCIENTIFICFIELDS

Bg;kb^_ 3XbR^eTah0bca^]PdcbCTbcAT_PXab A><460 k^bg_hk\^]\Zk[hgpbg`]nkbg`k^& BcPcT9dSVT1[^RZbE^cTa83 Bgbml_bgZeliZ\^pZed% ^gmkrmh>ZkmaÍlZmfhlia^k^bg 4]U^aRT\T]cU^a4[TRcX^]b lanmme^\k^pikZ\mb\^l +)),%]^lmkhrbg`maZmlanmme^Zg] Ma^lZf^_^]^kZecn]`^pahmak^p iZm\a^lmha^Zmlab^e] dbeebg`bmll^o^gZlmkhgZnml' hnm@^hk`bZÍlohm^kB=eZpeZlmr^Zk Ma^lZf^i^Zgnm[nmm^k&ebd^ [eh\d^]ma^lmZm^P^]g^l]Zr_khf 7>DBC>=kMphliZ\^pZed^kl k^iZbk`hhpZlnl^]Zr^ZkZ`h ^g_hk\bg`bmlk^obl^]eZp]nkbg` la^^iblaerehlmZliZmneZbghk[bm bgZ_bklmm^lmh_ma^lrlm^f%pbma mablr^ZkÍl^e^\mbhgl'Ma^knebg` P^]g^l]Zr';nmG:L:^g`bg^^kl fbq^]k^lneml'MaZmm^lmikh]n\^] \Zf^e^llmaZgmphahnklZ_m^kma^ ]b]gÍmfbg]fn\a%[^\Znl^ma^ fZgr[n[[e^lmaZm\hne]Zeehpdbee^k @^hk`bZLnik^f^78> bg`Zli^\bZefbqmnk^mhk^iZbkma^ pbee`^mZ]Zrh__Mankl]Zr[^_hk^ BcPcT1TVX]b2PaahX]V>dc k^bg_hk\^]\Zk[hge^Z]bg`^]`^lh_ lmZkmbg`mhpbg]nima^fbllbhg% =Tf4gTRdcX^]?a^RTSdaTb ZliZ\^lanmme^%nlbg`fh\d&nilbg ng]h\dbg`_khfma^bgm^kgZmbhgZe

:fZgpahlahmablpb_^mh]^Zma Zlnbm\Zl^' .!3!'%449)-!'%3 liZ\^lmZmbhghgLZmnk]ZrZg]ieZg& pZl^q^\nm^]P^]g^l]Zr%ma^_bklm :\kZ\dZeehp^]_b^kr`Zl^lmh F>A:CA8?)3PACE3HUTTLE$ISCOVERYMISSIONSPECIALISTS-ICHAEL%&OSSUM gbg`mhk^mnkgmh>ZkmahgFhg]Zr' HabhbgfZm^inmmh]^Zmanlbg`g^p i^g^mkZm^liZ\^lanmme^A4=BC48=0? bgc^\mbhg`nb]^ebg^lZ]him^][^\Znl^ ma^eZlm^q^\nmbhgpZlieZ`n^]pbma ikh[e^fl'Kh\dr;ZkmhgpZl\ehl^& BZPZT[0__TP[b er^qZfbg^]l^o^kZembf^l_hklnbm& 5302[TPab>]RT3PX[h78E083B?X[[ Z[e^bgc^\mbhglbm^l[^_hk^a^]b^]' 2^]eXRcX^]c^ Ma^lmZm^Íle^maZebgc^\mbhgikhmh\he ÌA32>==k:mmhkg^rl_hk a^e]ni2)fbgnm^lpa^gikblhg ^Zlb^kmk^Zmf^gmieZg P^]g^l]Zr' ma^^f^k`^g\^ÉZg]nembfZm^er% D^gg^]r\hnlbgFb\aZ^eLdZd^e lmZ__lmkn``e^]mh_bg]ZobZ[e^o^bg Ma^f^]b\bg^pbeelmbee[^^qi^g& mkZglfbllbhgÉh_]kn`&k^lblmZgm _be^]Zi^mbmbhgP^]g^l]ZrZldbg` Zg]hg^ma^rnl^]\heeZil^]'0? F0B78=6C>=kI^hie^bg_^\m^]pbma lbo^3fhk^maZg*%*))_hkZfhgmaÍl lmkZbglh_ma^obknl'Mahl^lmkZbgl ma^N'L'Lnik^f^eTa7X[[Pah \hf[bg^lmak^^]kn`lbgZÊ\h\dmZbeË fhk^ibeelABO&ihlbmbo^iZmb^gml lZb]ChagFZkmbg%a^Z]h_@be^Z] [^\Znl^ZlmZmnm^h_ebfbmZmbhgl ¨.EVERBEFORE(ILLARY#LINTONHAS ma^kZirmaZm\Zg[^lpZeehp^]bgZ ghpfnlmmZd^^Z\a]Zrmhd^^ima^ L\b^g\^lBg\'%ma^fZgn_Z\mnk^kh_ aZ]^qibk^]' APOLITICIANSTEPPEDONTOAPRES lbg`e^]hl^' anfZgbffngh]^_b\b^g\robknlbg mphh_ma^]kn`lbg:mkbieZ' LdZd^e%-.%bll^kobg`+)r^Zklmh IDENTIALSTAGEBEFOREVOTERSWHO ALREADYHAVESOMANYSTRONGOPIN Ma^ibee%\Zee^]:mkbieZ% \a^\d%fZdbg`bmlbfie^kmhlmb\dmh ÊMa^_^p^kibeel%ma^[^mm^k eb_^_hkabl+))+\hgob\mbhgbgma^ IONSABOUTHER\C^SPh0BTRcX^] bg\en]^lmak^^?hh]Zg]=kn` Zmk^Zmf^gmk^`bf^g'Ma^g^pibee ma^rZk^Z[e^mhZ\ab^o^maZm2. *20.[^Zmbg`]^Zmah_abl@k^^gpb\a :]fbgblmkZmbhg&Ziikho^]f^]b& bl^qi^\m^]mh[^ZoZbeZ[e^pbmabg i^k\^gmmak^lahe]%ËFZkmbglZb]' g^b`a[hk%FZkmaZFhqe^r%pa^gma^ \bg^lmaZmZek^Z]r_hkfhg^h_ l^o^g[nlbg^ll]Zrl' 0=3A4F1A8364B0? mphp^k^m^^gZ`^kl'0? Learn to Dance! Ballroom Salsa Swing 4 Weeks Classes Start July 24! Join The Fun! 703-528-9770 $49 www.dancefactory.com

Private & NEXT TO Group Lessons DANCE FACTORY VA SQ METRO ELLEN’S #k4G?A4BBk & "! %kC7DAB30H FUTONS CWTPVT^UcT\_^aPah3IOUX&ALLS#ANARIESBASEBALLPLAYER*IM BIGGEST Selection • LOWEST Prices FUTON =PcX^] %RIOTES4HOUGHTTOBETHEOLDESTPROPLAYERINTHESPORTSHISTORY ® q %RIOTESHADONEAT BATINAGAMELASTWEEK(ESTRUCKOUT HUGE INVENTORY! WHOLESALERS -( • Finest Selection • Discount Prices Stylish • Comfortable • Practical Annapolis 2444 Solomons Is. Rd. 410-573-0088 Laurel 931 Wash. Blvd. (Rte. 1) 301-497-6338 DC-Van Ness 4455 Ave., NW 202-363-1117 DC-Dupont Circle 2XchATeXTfb1XV3XV3TPcW Futon Sets 1728 Connecticut Ave. $250! 202-518-0057 as low as Rockville >gmbk^;hlmhgmkZglbm 1050 Rockville Pike 301-545-6111 lrlm^fng]^kl\knmbgr Alexandria 516-D S. Van Dorn St. 703-823-8127 Z_m^kmngg^e\heeZil^ Arlington 3000 N. 10th Street 1>BC>=kMa^a^Z]h_ma^Z`^g\r 703-527-8318 ho^kl^^bg`;hlmhgÍl;b`=b`ab`apZr Fairfax (2 locations) * 11106 Lee Highway ikhc^\mhk]^k^]Zk^ob^ph_ma^^gmbk^ Save $50 NOW! 703-352-5111 10412 Lee Highway f^mkhab`apZrlrlm^fP^]g^l]Zr Bring this ad for $50. Off a $300 purchase. Expires 7/30/06 703-691-4901 *Not available with other offers Z_m^kbgo^lmb`Zmhklehhdbg`bgmhma^ ALL STORE HOURS: _ZmZe\heeZil^h_\hg\k^m^\^bebg`leZ[l www.ellensfuton.com MON-FRI 11-8, SAT 10-6, SUN 12-5 _hng]/)fhk^jn^lmbhgZ[e^Zk^Zl bglb]^ma^lZf^mngg^e' BgbmbZebgli^\mbhglk^o^Ze^]]hs& ^glh_lb`glh_[hemlehhl^gbg`Zg] hma^kihm^gmbZe_Zbenk^lbgma^^Zlm& Do Do n n’t ’t BreBrea a t th h e e FiFi l l th! th! [hng]\hgg^\mhkmngg^e%Mnkgibd^ :nmahkbmrh__b\bZelZg]ma^;b`=b`

Only $264 Buys ikhc^\mfZgZ`^klZb]' %,)3%!-%.$/,!!0 Clean Air For ÊP^Ík^^oZenZmbg`^Z\ah_ma^l^ CD==4;58G)-ENWORKINSIDETHE) CONNECTORTUNNELIN"OSTONON7EDNESDAY bg]bob]nZelbm^l%ËFZllZ\anl^mml NEARWHEREFALLINGCONCRETECEILINGPANELSKILLEDAWOMANINACARON-ONDAYNIGHT Your Home. Mnkgibd^:nmahkbmr7=B>=0? 3. A properly cleaned duct system can reduce your gas or electric bill up to 25%. Cyprus Air, For Air Duct 0a\hc^4]S3TP[ Cleaning You Can Trust ]6Ph=kMa^:kfrpbee they adhere to strict professional Dust, dirt, mold and other contaminants phne][^mh[eh\d_nmnk^`ZrfZk& k^[b]ma^fnemb[beebhg&]heeZk\hg& removed from a three-year-old townhome. standards and regulations. phne]^g]ikZ\mb\^bg kbZ`^lbgFZllZ\anl^mml'Fhk^maZg mkZ\mng]^kpab\aZAZeeb[nkmhg hgerlmZm^Zeehpbg`bm 1%)))lZf^&l^q\hnie^laZo^mZd^g BC>=kFZllZ\anl^mmleZpfZd^kl FZr+))-' Z_m^kr^Zklh_\hfieZbgmlho^kahp ^g]^]]^[Zm^hgikhihl^]\hglmb& Mh`^mhgma^[Zeehm%ma^jn^lmbhg ma^]^ZeaZlphkd^]bgBkZj' 50 50 % % OFF OFF mnmbhgZeZf^g]f^gmlP^]g^l]Zr fnlmmpb\^pbgma^[Z\dbg`h_+. >:43>=0;30? *)[beebhgmhma^\hfiZgr'0? X017e 2x.5 THURSDAY 7.13.2006 EXPRESS 5

  

%k4G?A4BBk & "! %kC7DAB30H

?>C?A>C4BC)3AN&RANCISCOCITYPLANNERSARECONSIDERINGWHETHERTOISSUEAPERMITFORAMEDICALMARI JUANADISPENSARYINTHEHEARTOFTHECITYSTOURISTHUB &ISHERMANS7HARF DESPITEOUTRAGEFROMNEIGHBORS =PcX^] 4HE'REEN#ROSSISTHEFIRSTCANNABISCLUBTOSEEKAPERMITUNDERSTRICTGUIDELINESTHECITYADOPTEDLASTYEAR

;Ph5d]TaP[3aPfb2a^fS FX[SUXaTbCWaTPcT]>[S =b`gbmZkb^l%_kb^g]l FTbcTa]<^eXTBTcb fhnkg>gkhg_hng]^k *%)))^oZ\nZm^]Zl Zml^\hg]f^fhkbZe [eZs^l[nkgmakhn`a 7>DBC>=k?hkf^kIk^lb]^gm@^hk`^ ablmhkb\gkhg

EZrÍlf^fhkbZel^kob\^]k^plhf^ Z\khll+/%)))Z\k^lh_]^l^kmZg] -!2#)/*/3%3!.#(%:!0 h_ma^ab`a&ikh_be^`n^lmlpahp^k^ ]^lmkhr^],)ahf^lZg][nbe]& 3MOKEFROMAWILDFIREBILLOWSOVERAHILL \ehl^mhabf[^_hk^a^pZl\hgob\m& bg`lbgZgZk^Zpa^k^@^g^:nmkr% IN0ATTERSON #ALIF ON7EDNESDAY ^]bgFZrh__kZn]Zg]\hglibkZ\r KhrKh`^klZg]hma^kl_bef^] _hkerbg`mhbgo^lmhklZg]ma^in[eb\ Aheerphh]P^lm^kgl' _e^]ma^_eZf^lMn^l]Zr%Znmahkbmb^l Z[hnmma^^g^k`r\hfiZgrÍl_bgZg\bZe Ablmhkb\[nbe]bg`lbgma^He] lZb]'?bk^_b`am^klaZ]gh^lmbfZm^ a^Zema[^_hk^bm\heeZil^]bg+))*' P^lmfhob^l^mZk^Zh_Ibhg^^kmhpg P^]g^l]Zrh_pa^gma^rfb`amaZo^

:fhg`ma^hma^kfhnkg^klZm -%,)33!0(),,)0!0 aZ][^^gliZk^][nml^o^kZehma^k ma^[eZs^ng]^k\hgmkhe' ma^]hpgmhpgAhnlmhg\ank\aEZr 8=<>DA=8=6)2EBECCA#ARTER LEFT WIFEOFFORMER%NRON#%/*EFF3KILLING HUGS lmkn\mnk^lp^k^]^lmkhr^]%_bk^h__b& ÊB_p^aZo^fhk^h_ma^lZf^ Zmm^g]^]_hk*+r^Zklp^k^_hkf^k ANUNIDENTIFIEDWOMANAFTERAMEMORIALSERVICEFOR+EN,AYON7EDNESDAY \bZellZb]P^]g^l]Zr' pbmama^ab`apbg]lZg]ab`am^f& L^\k^mZkrh_LmZm^CZf^l:';Zd^k Pbg]^q\^^]bg`-)fia_Zgg^] i^kZmnk^lbm\hne][^mkhn[e^%ËlZb] BBB%Ahnlmhg:lmkhlhpg^k=kZrmhg Ldbeebg`]b]Zmm^g]ZikboZm^l^kob\^ ?hkf^kAhnlmhgFZrhk;h[ ma^_eZf^l%Zg]h__b\bZellZb]ma^r gkhg Ldbeebg`Ílpb_^%_hkf^k>gkhg\hk& EZr%/-%]b^]pabe^oZ\Zmbhg& P^]g^l]Zr_khf\hffngbmb^lbg e^Zlm,)ahf^l'Ma^ablmhkb\mhpg \ab^_^q^\nmbo^C^__k^rLdbeebg`%]b] ihkZm^l^\k^mZkrK^[^\\Z

SUPER Sunday Specials FREE RELAXER w/reg. style at cost $ Learn all 5 applications Or 25 Any Reg. S t yle Only $399 Ask for Phyllis Walk-ins www.rebellconsulting.com Unique Hair Salon Welcome Day/Eve/Wknds 6485 Marlboro Pike • District Heights, MD Hours: Wed.-Fri. 5pm-10pm 240-350-4202 Sat. 6am-12pm Call 301.459.4920 GOOD W/AD ONLY. Long hair extra. Sun. 12pm-5pm

AVOID NECK AND BACK SURGERY WITH NEW TECHNOLOGY! You Can Finally Live Pain Free. Northern VA – If you suffer from low back or neck pain due to a bulging disk, degenerative disc, or sciatica, this free information can give you the details on how you can be pain free without medicine or surgery. This technology is the proven alternative to surgery. If you are serious about avoiding surgery and getting rid of your pain, call for your FREE information. Call the toll- free number anytime at 1-888-802-6137. THURSDAY 7.13.2006 EXPRESS 7 CompleteCare service 2MB RAM to be included will be less. On Dimension, Advanced Exchanged Service for LIMIT 5 DISCOUNTED OR PROMOTIONAL ITEMS PER n the United States and other countries. Microsoft and Windows s only. CompleteCare Accidental Damage Service: ness day service, customer must contact Dell before 5 PM customer time. For a copy of our Guarantees or Limited Warranties, write Dell USA L.P., Attn: † tact your DFS representative for further details. All terms subject to credit approval m. (48/mo., pmts.*) e – which means we can stay focused E-VALUE Code: 08230-S20707b Lease as low as $22 , super-sharp 17" flat panel color monitor. Small Business Server 2003, SERVER ® Limited Warranty: D Processor 950 (3.40GHz, 2x2MB ® 830 Windows Up to 128MB of system memory may be allocated to support graphics, depending on system memory size D Processor and ® ™ ® ability, geographical restrictions and terms of service contract. Service timing dependent upon time of day call ath to success. That’s pure Dell. Pentium es. Your monthly payment may vary, depending on your creditworthiness. Washington DC ExpressLease arranged by Dual-channel memory requires 2 each of the same capacity memory DIMMs. ® 799 D Processor 820 supporting dual-core processing $ Pentium ® ® 2007WFP 20.1" WIDE ASPECT $391 Dual-Channel: Pentium ™ ™ ® (2.80GHz, 2x1MB Cache, 800MHz FSB) Offers expire 7/19/06. Standard Edition* M-F 8am-6pm) Cache, 800MHz FSB) Upgradable to Intel Based on ANSI/NAPM IT7 .228-1997 tests of 55 units, April 2005, with average ANSI Lumens 1384. Bulb brightness degrades with usage. 1397 reg. price after $598 discount Inspiron 1300 Shared Memory: DELL This device has not beenCommission approved for by use the in Federal aand Communications residential may environment. not This be, device offeredresidential is for environment not, sale until or the lease, approval or of sold the or FCC leased has for been use obtained. in a Small Business Value Server • Intel • 3-Yr Basic Enterprise Support (Next Business Day On-Site Service* Dell Recommends: • Dell Remote Access Card, 4th Generation, $299 • 512MB ECC DDR2/533 SDRAM (Up• to 80GB* 8GB) (7200 RPM) SATA Hard• Drive System (Up Includes to Microsoft 2TB*) Microsoft Small Business Server • † POWEREDGE Includes: Intel $ Applications Simultaneously Picture) and PBP (Picture by Picture) with 800:1 Contrast Ratio ULTRASHARP FLAT PANEL LCD MONITOR NEW Advanced Design Ideal for Space-Constrained Environments • Watch DVDs and Run Multiple • Supports Features like PIP (Picture in • Delivers Distortion-Free, Sharp Images reg. price$459 Order Code: after 2007FPW 15% discount Small Business Server must serve as the domain controller and is limited to 75 users. Dell 3400 Projector Lumens: m. (48/mo., pmts.*) Based on currently available information from Microsoft. Requirements subject to change. Microsoft requires that a PC have a modern processor and 51 For hard drives, GB means 1 billion bytes and TB equals 1 trillion bytes; actual capacity varies with preloaded material and operating environment and E-VALUE Code: 08230-s80705b Lease as low as $15 /mo., $30 NOTEBOOK Hard Drives: They gave us the affordable, high-end technology our business needs to go the distance. Great offers like Mobile Technology ® ™ Accidental Damage Service,*Hardware ™ 1300 XP Home Edition Windows Vista Capable: (48 pmts.*) Lease as low as ® Capable* Inside logo, Centrino, Centrino logo, Pentium and Pentium Inside are trademarks or registered trademarks of Intel Corporation or its subsidiaries i Microsoft Windows Small Business Server: ™ M Processor 735 (1.70GHz) 549 ™ Centrino ® 3400MP ® $ ™ PROJECTOR Vista ™ ® dell.com/SnPoffer s. Dell cannot be responsible for pricing or other errors, and reserves the right to cancel orders arising from such errors. PRO/Wireless 2200 802.11b/g Internal Wireless Pentium g charges, are extra, vary and are not subject to discount. May be combined with other select offers or discounts. U.S. Dell Small Business new purchase Component (HD) Inputs DLP DELL Small, Light and Bright for Mobile• Professionals Small and Lightweight at 2.4• lbs.! Bright 1500 ANSI Lumens (Max)* • High 2100:1 Contrast Ratio for• Outstanding Supports Images PC, S-Video, Composite, and • Standard 2-Yr Advanced Exchange Service* $1099 Order Code: 3400mpsapp ® ® defective part or system. Replacements may be refurbished. Defective unit must be returned. Bulbs have a 90 day limited warranty. To receive next busi ated backup space. ons. Please visit www.dell.com/vista for more information. - Intel Warranty Support), add $138 (Mail-In Service, Hardware Warranty Support) Service,*CompleteCare - Intel 739 reg. price after $190 discount An affordable, entry-level solution perfectproductivity for tasks basic – Starting at• 6.66 Featuring lbs.* Intel • Windows • 15.4" Wide Screen XGA• Display 512MB Shared* DDR SDRAM;• 60GB* FREE Hard Upgrade Drive to 8x• CD/DVD 1-Yr Burner Mail-In (DVD+/-RW)* Economy Service Plan Dell Recommends: • 1GB Shared* DDR2 SDRAM,• add 2-Yr $70 On-Site Mobility Service Plan* (Next Business Day On-Site • Genuine Windows INSPIRON Includes: 15.4" Wide Screen DisplayFREE and Upgrade to 8x CD/DVD Burner $ ming the marks and names or their products. Dell disclaims proprietary interest in the marks and names of others. ©2006 Dell Inc. All rights reserved. may be required to return unit to Dell. For complete details, visit www.dell.com/servicecontracts. XP Professional he end of the FMV Washington DC ExpressLease, you can: purchase the equipment for the then FMV, renew the lease or return the equipment to DFS. Please con ® Service may be provided by third party. Technician will be dispatched, if necessary, following phone-based troubleshooting. Subject to parts avail Virtual Surround Sound Monthly payment based on 48-month Fair Market Value (“FMV”) Washington DC ExpressLease and does not include taxes, fees, shipping and handling charg ™ On-Site Service: $1349 Discs burned with this drive may not be compatible with some existing drives and players; using DVD+R media provides maximum compatibility. DESKTOP Leasing: E-VALUE Code: 08230-S50741a W3201C 32" 17" E176FP Flat Panel Display ™ ™ TruSurround XT ® DVD +/- RW: Dual Digital/Analog Tuner (450 cd/m²) SRS 3100 reg. price after $250 discount LCD TV $1599 Order Code: w3201c DELL • High Definition is Easy With Dell’s built-in HD • Excellent Picture Quality - High Brightness • Integrated 30-Watt (total) Stereo Speakers with 0885 ™ XP Home Edition ® 419 Capable* 4 Processor 521 with HT Technology ™ ® $ On-Site Mobility Service Plan includes CompleteCare Accidental Damage Service, and is not available in all states. Vista ® dell.com/smb/expressoffer Pentium ® price of a Dell 15" E156FP Flat Panel Display Hardware Warranty Support) Hardware Warranty Support), add $70 Hard Drive, add $80 (2.80GHz, 1MB L2 Cache, 800MHz FSB) 609 reg. price after $190 discount A Balance of Performance and Value• in Intel a Quiet-Running System • Windows • 512MB Shared* Dual-Channel* DDR2• SDRAM 160GB* SATA Hard Drive (7200• RPM) 48x CD Burner/DVD Combo• Drive FREE Upgrade to Dell 17" E176FP Flat Panel Display• for 1-Yr the Economy Service Plan (Next Business Day On-Site Service,* Dell Recommends: • 3-Yr Economy Service Plan (Next Business Day On-Site Service,* • DataSafe 160GB* (Secured Storage and Data Recovery) • Genuine Windows Includes: FREE Upgrade to Dell $ DIMENSION Dell recommends Windows On-Site Mobility: 1300, that comes with internal wireless that helps keep us connected, wherever we go. Dell solutions also offer fast response times and little downtim 3100, which utilizes the industry-standard BTX design for maximum cooling efficiency and ultra-quiet operation. And includes Dell’s high-contrast ™ ™ Between 32 and 64MB of system memory may be allocated to support graphics, depending on system memory size and other factors. Weight varies by configuration and manufacturing variability. ENHANCE YOUR SYSTEM call 800.766. Dell, the stylized E logo, E-VALUE, Dimension, Inspiron, TrueMobile and PowerEdge are trademarks of Dell Inc. Intel, Intel logo, Intel Inside, Intel Notebook Weight: OUR IDEA OF GREAT TECHNOLOGY? NEVER HAVING TO THINK ABOUT OUR TECHNOLOGY. the Dimension Pricing, specifications, availability, and terms of offer may change without notice. Taxes, fees, shipping, handling and any applicable restockin on our business instead of worrying about technology. With a little help from Dell, our business is more profitable than ever before. That’s the direct p And the Inspiron WE DON’T HAVE TIME TO WORRY ABOUT OUR TECHNOLOGY. That’s why we partnered with Dell. Desktop Shared SDRAM: In case of customers leasing under these promotions, please note that items leased will be subject to applicable end-of-lease options or requirement Replacement system or replacement part will be dispatched, if necessary, following phone-based troubleshooting, in advance of receipt of returned More ideas to boost your system at are registered trademarks of Microsoft Corporation. Other trademarks and trade names may be used in this document to refer to either the entities clai Dell recommends replacing your bulb after 3000 hours of usage (up to 4000 hours in Eco-mode). in the Windows Vista Capable PC program. Since the operating system and driversTrademarks/Copyright are Notices: not final, Windows Vista has not been tested on all user configurati and other factors. placed to Dell. U.S. only. Dell Financial Services L.P. (“DFS”), an independent entity, to qualified Small Business customers. Minimum transaction size of $500 required. At t Warranties, One Dell Way, Round Rock, Texas 78682. For more information, visit http://www.dell.com/warranty. CUSTOMER. Projector: Call: M-F 7a-8p Sat 8a-5pPricing/Availability: CT and availability, and are subject to change without notice. excludes theft, loss, and damage due to fire, flood or other acts of , or intentional damage. CompleteCare not available in all states. Customer XPS, and Inspiron systems, for Norton Ghost 10 and Dell DataSafe users, up to 25% of the stated hard drive capacity may be utilized by your system as dedic 8 EXPRESS 7.13.2006 THURSDAY 4 J.G. Banks,legendaryprobateinvestor thousands ofdollarsinrealestate.” to positionyourselfmaketensof cantakejustacouplehoursofyourtime it canshowyoufromfirsthandexperience, “I Wealth-building Secret Best-kept America’s How toCashInon Workshop Reveals Free Y In every neighborhood,it’s possiblethat what canmake thedifference. you g never thoughtshecouldafford. Butwhen my systemtopurchase thehomeshe singlemomwiththree teenagers used A “estateminingsystem.” easy-to-follow to cashinwithestatesbyfollowing my during asingleevening —youcanlearn time thanmostfolksspendwatching TV hourseachweek—less In justafew the estatebypurchasingitsassets. you’re simplyhelpingbeneficiaries settle estate that’s partofsomeone’s estate, jumbo involved. When youacquirereal scare you. There isnolegal mumbo lettheword “probate” probate. Don’t is thatthey arepartofanestatethat’s in The reasonthesebargain propertiesexist real estate. buildings. Ranchland.Farms. All typesof Apartment buildings. Strip malls. Office houses. Duplexes. Condominiums. You candothiswithsingle-family every investment. about make tensofthousandsdollarsonjust value, sellitquicklyforitsfullprice,and brokers by orregistered JGBIencourages consultation withalicensed representati asadvisors withany federal orstate agency. Unique experiences and pastperformances donotguarantee future resultTestimonials includedmaynotrepresent results. typical JGBIis atraining institute, andindividualperfor BanksInstitute™ ofBusinessSkillsCorporation. (“JGBI”)is a trademark J.G. DISCOVER THEHUGESOURCEOFPROFITSMOSTREALESTATE INVESTORSOVERLOOK JGB201AFP - Washington WK29 You canpocketthe savings, investinanotherprobate deal,ortreat percent to50ofitsmarket ou canbuy choicerealestate for30 yourself toanexotictriporabrand-newcar... thechoiceisyours. HOW TOBUYA$300,000HOMEFOR ONLY $180,000 et theproperty forhalfprice, that’s A SONLY DAYS Two-hour How toFindRealEstate Below Market Value price ofrealestatedropsinhalf. can suddenlybecomeaffordable whenthe of town youonlydreamedofmoving to opportunities closetohome.Even areas are inprobate. You canfind profit-making o for 30%to50% ne ortwo properties,andmaybemore, just onepropertyata30percent is huge.For example, ifyoupurchased The potentialtomake significant money Work” in aDay’s 300% GainCanBe“All Believe ItorNot,a helping themgetonwiththeirlives. motivated sellerswhoappreciateyou’re that $100value. Soyouhave highly when attorney feesareeatingaway at sometime off inthefuture.Especially lot betterthanthepromiseof$100 money quickly. Fiftydollarstodayisa Plus, mostbeneficiaries want their share. be soldtoensureeverybody getstheir one person,it’s likely thepropertymust lives. Ifahouseiswilledtomorethan state andthey don’t want tochangetheir estate involves peoplewholive outof property they inherited.Perhapsthe Not every beneficiary wants tokeep the Bargains Everywhere Why SuchIncredible inrealestate. tomakingbigmoney know landofrichesandthefastest routeI a properties. Butforthosewhodo,itcanbe few peopleknow wheretofind these There isno“For Sale”signoutfront,and estate tobuy low andsellhighquickly. some ofthecleanestandeasiestallreal mortgage ordebtattached,makingthem probate canbebeautifulhomeswithno called “realestategurus.” Propertiesin condemned propertieslike theslew ofso- rundown foreclosures,bankruptcies,or Rest assured,I’mnottalkingabout BUY LOWandSELLHIGH To Make BigMoney: NEW REAMSINFE DISO FREEADMISSION FREE ADMISSION FREE ADMISSION Sunday, July16,2006 7400 WisconsinAvenue Bethesda Hyatt Reservations notrequired. Regency No obligation. Bethesda p.m. 1 SECRETS OFPROBATE PROFITS J.G. Banks’ mance dependsupon theindividualskills, timeavailability, anddedicationofeach studentinthetraining program. ? ve regarding v1 investment any particular ortheuseofany investment strategy. .JGBI, itsowners, employees, andaffiliates donotgive investments. orfinancial advice andare not licensedas you’ll discover inmyFREEworkshop. moneymaking potentialthantheone believe thatnoroutehasmore anyone canwalk alongthispath,andI makingmillionsofdollars. Almost to Real estatehaslongbeenaproven path 300 percent. down paymentcouldeasilybemorethan full market value, thegainonyourinitial the property, whenyouquicklysellfor put down 10or15percenttopurchase to make giganticprofits... assumingyou But here’s how youleverage yourmoney this. not even take afullweek’s effort todo $150,000. And withmysystem,itmay make about$45,000onapropertyworth 100 percentofitsmarket value, you’d discount, andthenresoldthepropertyfor Buy Properties How toGettheCash as never before. you’ll bepositioned tobe“inthemoney” workshop and putyourself“intheknow,” guaranteethatifyouattendmy FREE I it. about realestateinvestors whoknow few paradise. Yet therearevery buyer’s a It’s in probate. More than$3trillionworth ofassetsare learning thesecretsof“estateinvesting.” workshop istheonlyway tostart FREE Money inEstates”atbookstores.My You won’t find abookon“How toMake same street. $40,000 lessthancomparable lotsonthe Another studentboughtavacantlotfor probate properties hisfirst year. gentleman from Dallaspurchased 18 A money inthebank. tohave That means,youdonothave fund youroffers tobuy properties. discover it’s possibletogetthecash little as50centsonthedollar, you’ll also to regularly purchaserealestateforas In additiontolearningwhyit’s possible Reservations notrequired. No obligation. Monday, July17,2006 p.m.or 7p.m. 1 1750 RockvillePike Doubletree Rockville Rockville Reservations notrequired. No obligation. COLLECTIBLES. TREASURESOFALLKINDS. BUSINESSES. CLASSICCARS.ANTIQUES.ART. 5 4 3 2 1 T yourself forsubstantialgains. quickly formarket value andposition on thedollar. You canrunit,orsellit acquire aprimebusiness forpennies An estatecanbeyourquickest way to system. were acquired usingtheJ.G. Banks profit onfourcars. All fourvehicles student alsonettedover $22,000in flow ofwealthdidn’t stopthere. Our The profits from oneestatepurchase. themselves apotentiallifetimeof and runthebusiness, creating for interest in.Heandhisbrother own auto shopthatthebeneficiaries hadno into acareer gained from theJ.G. Banksworkshop, love for cars, andtheknowledge he An enterprisingyoungmanturnedhis businesses. kinds ofpersonal industrial parksandof be commercialrealestateincluding McLean HiltonTysons Corner How toBuyAlmostAnything ACQUIRE PROBATE PROPERTIES beyond houses. To start,therecan here’s awholeworld ofassets “first in”estateinvestor, estate.Eventhebeneficiariesdon’t knowhowtosell.Thatmeans,asa an IT’S ASECRET rescue them. every day. jewelry, antiques,art,toys,collectibles,andmuchmore enterintoprobate ALL KINDSOFTREASURES estate thatmustallbesettledbefore theestatecanbedistributed. debtsattachedtothe (and otherunwantedassets)sothattheycanpayoff highly motivatedseller. Mostbeneficiariesare BUYER’S MARKET foreclosure there are nearly beachside motels—are inprobate. According tothe assets worthtrillionsofdollars.Everytypereal estate—from housesto HUGE INVENTORY High” scenario captur home ofyourdreams foryourfamily, orresell quicklyandbepositionedto properties youcansnapupfor30%to50%belowmarketvalue.Getthe BARGAIN-BASEMENT PRICES ues—pu o’ehelping anxioussellers. buyers —plusyou’re Tuesday, July18,2006 Hunt Valley Marriott 7920 JonesBranchDrive lifetimeofgainswithindays.It’s the a e Themanpurchased an . 245 ShawanRoad TOP FIVEREASONSTO for 30%to50%Off Millions ofitems Hunt Valley McLean p.m. 7 . property —even or a.m. 9 . 4timesmoreprobatepropertiesthanin 44 Fewpeopleknowhowtofindandpurchase property from : fices. Plusall Purchasing property outofanestateassures youofa : There are almost : you havelittleornocompetition Andtheycansitthere foryearsunlessyou . Historicarchitecture, classiccars,fine : Theprobate marketisfulloffabulous : “buried treasure”hiddeninprobate. of items,andrealestate,endupas collectible thatinterestsyou.Millions itemor business aroundjust aboutany You canuseprobatetobuild atidy windfall inevery estateyousear quickly sold. There isapotential possessions hefoundinestatesandthen 1,000 percent to3,000percent onthe One ofourstudentsmadeprofits of thriving e-basedeconomy. findings, andcashinonthenew, start ane-business, auctionoff your Estate huntingisalsoagreatway to ...... six millionestates make money Anybody whowantsto Retirees Couples Homemakers Young entrepreneurs Business people Real estateinvestors Who ShouldAttend anxious tosell ultimate “BuyLow/Sell FREE ADMISSION Wednesday, July19,2006 Timonium Holiday Los AngelesTimes 2004 GreenspringDrive Reservations notrequired. p.m.or 7p.m. 1 Inn Select in probate, with No obligation. Timonium from other the house ch. , C7DAB30Hk & "! %k4G?A4BBk(

BC82:HBC82:D?)4RUCKLOADSOFMAPLESYRUPWORTHHUNDREDSOFTHOUSANDSOFDOLLARS HAVEBEENSTOLENFROMA1UEBECWAREHOUSE THE#ANADIAN0RESSREPORTS4HETHIEVES HAULEDOFFSOME BARRELSOFSYRUPˆDISGRUNTLEDWORKERSARESUSPECTEDINTHECRIME F^a[S

Bg;kb^_ 8baPT[XCa^^_b2a^bb8]c^;TQP]^] <>=C4AA4H<4G82> ;TUcXbc2P]SXSPcT½b1PRZTab FbebmZkrhi^glg^p 7TPSc^2P_XcP[U^a?a^cTbc _khgmZ_m^kA^s[heeZa Lniihkm^klh_e^_mblmik^lb]^gmbZe \Zimnk^l+lhe]b^kl \Zg]b]Zm^:g]k^lFZgn^eEhi^s H[kZ]hkmhhdma^bkikhm^lmlhgma^ 94ADB0;4<kBlkZ^e[hf[^]Zg] khZ]P^]g^l]Zr%e^Zobg`lfZee la^ee^]lhnma^kgE^[ZghgZg] fhngmZbgmhpglZg]likZpebg` l^gm`khng]mkhhilho^kma^[hk& bg]nlmkbZe\bmb^lZg]a^Z]bg`mh ]^k_hkma^_bklmmbf^bglbqr^Zkl F^qb\hLan] ma^h__b\bZegZf^h_ma^:nl\apbms Hef^km\Zee^]ma^A^s[heeZakZb]Zg

\hg\^gmkZmbhg\ZfiZ_m^kf^f[^kl ÊZ\mh_pZkË[rE^[ZghgZg]mak^Zm& -/(!--%$:!!4!2)!0 h_ma^Phke]A^kbmZ`^55F>AB4=B)2ESIDENTSVIEWTHEDAMAGETOABRIDGEINSOUTHERN,EBANONAFTERITWASHITBY)SRAELIPLANES7EDNESDAY \hne]ghmZ`k^^hgma^blln^%N'G' Zmbhg'Ma^D<BD30= mhpglp^k^hk]^k^]mhl^^d\ho^k A^s[heeZae^Z]^kLa^bdAZllZg ma^AZfZl&\hgmkhee^]IZe^lmbgbZg ]khii^]ZjnZkm^k&mhg[hf[hgZ 7TPS^U3PaUdaATQT[6a^d_ bgng]^k`khng][hf[la^em^klZl GZlkZeeZalZb]a^phne]_k^^ma^ ?hk^b`gFbgblmkr' ahf^bg@ZsZ]=^acW:^aTP _knlmkZmbhgZmeZ\dh_ ma^lbqihp^klmaZmaZo^h__^k^]g^p ^g]mhnkZgbnf^gkb\af^gm' k^lihgl^mhgnd^ieZg mZedl' Mahn`aKnllbZZg]=Bk=C8=D4338B?;40BDA4F8C7E824?A4B8 34=C274=4H½B2A8C828B5ADBB80½B f^^mbg`lpbmaBkZgÍlgn\e^Zkg^`h& pa^ma^kbmphne]f^^mm^kflmh ma^lbmnZmbhg%Ëma^BM:K&MZllg^pl e^o^e;8C820;0=3A4;868>DB5A443>

1-800-411-1222 NIH Clinical Center www.cc.nih.gov TTY 1-866-411-1010 On the Frontline of Medical Discovery BTRcPaXP]EX^[T]RTB_XZTb National Institutes of Health \hffZg]^kh_ma^BkZjbZkfrÍl =hs^glh_Labbm^l]b^ .ma]boblbhg%mhe]lmZm^&kngm^e^ob& bgeZm^lmBkZjZmmZ\dl4 lbhgma^ZmmZ\d^kll^iZkZm^]Labbm^l IFie^Z]l_hkngbmr _khfLnggbl%ma^gmhhdma^Labbm^l mhma^g^Zk[robeeZ`^h_;Zeehnk%Zg 10673038A0@k@ngf^gl^bs^] Z\\hngmlniihkm^][rpbmg^ll^l' mph]hs^gLabbm^l_khfZ[nllmZ& Ma^fZllZ\k^pZliZkmh_Zlnk`^ mbhgZ_m^kl^iZkZmbg`ma^f_khfma^ bgl^\mZkbZgobhe^g\^maZmaZldbee^] \khp]bgZik^]hfbgZgmerLnggb fhk^maZg*/)i^hie^lbg\^Lng]Zr% Zk^ZP^]g^l]Zr%dbeebg`ma^fZg] pa^gLabbm^`ngf^gkZfiZ`^] ]nfibg`ma^bk[h]b^lbgZg^Zk[r makhn`aZ;Z`a]Z]g^b`a[hkahh] obeeZ`^Éma^eZm^lmbgZl^kb^lh_ dbeebg`Lnggbl' [kZs^gZmmZ\dl' P^]g^l]ZrÍlZmmZ\d\hbg\b]& Ikbf^Fbgblm^kGhnkbZe&FZebdb ^]pbmaZgngZgghng\^]oblbmmh Zii^Ze^]_hkngbmrZg]pZkg^]ma^ BkZj[r=^_^gl^L^\k^mZkr=hgZe] gZmbhgÍl_nmnk^pZlZmlmZd^'ÊP^ A'Knfl_^e]%pahlZb]ma^g^p ZeeaZo^ma^eZlm\aZg\^mhk^\hg& BkZjb`ho^kgf^gmblghmr^mk^Z]r

\be^Zg]Z`k^^Zfhg`^Z\ahma^k 7!4()1+(5:!)%'%449)-!'%3 mh]^\b]^hgl^\nkbmrblln^lmaZmpbee hgZohb]bg`\hg_eb\mZg][ehh]'B_ "LOODCOVERSTHEGROUNDATTHESITEOFA ]^m^kfbg^ma^iZ\^h_N'L'mkhhi p^_Zbe%@h]_hk[b]%B]hgÍmdghp BOMBATTACKIN"AGHDAD7EDNESDAY k^]n\mbhglmablr^Zk' paZmma^_Zm^h_BkZjpbee[^%Ëa^ Ma^mhiN'L'\hffZg]^kbgBkZj% GW SCHOOL OF BUSINESS mhe]iZkebZf^gm' Ma^[ehh]b^][h]b^lh_ma^ob\& @^g'@^hk`^

The National Institute of Mental Health www.gwu.edu/gradinfo National Institutes of Health, Department of Health & Human Services THE GEORGE WASHINGTON UNIVERSITY IS AN EQUAL OPPORTUNITY/ 31304 AFFIRMATIVE ACTION INSTITUTION CERTIFIED TO OPERATE IN VA BY SCHEV. Introducing The Latest Now that     Technology In Comprehensive there’s a choice, Dental & Orthodontic Care which would you •Implants All In One Facility •Emergency Care choose?  2 blocks away from •Dental Check-Ups Farragut North and Straight Teeth. No Braces. •Crowns & Bridges Farragut West Metro PREMIERE INVISALIGN PROVIDER •Root Canal Therapy Free Orthodontic (top 5% Nationwide 2005) •Oral Surgery Consultation Free Implant K Street Dental & •Periodontics Consultation Orthodontic Group •Cosmetic Dentistry Dr. A. Shouhayib & Associates •Orthodontics K Street Dental 308 Main Street •Digital Computerized X-Rays 1990 K Street NW, Suite 15-A Gaithersburg, MD 20878 •Intra-Oral Camera/Video Imaging Washington, DC 20006 Beside Whole Foods •Air Abrasion (No More Needles) 202.775.0167 301.977.9787 •EVENING HOURS BY APPOINTMENT www.kstreetdental.com Simply thinner. Simply visit one of our Hurry, limited time offer! convenient locations accessible by Metro: WASHINGTON, DC NEW! 1828 L St., NW Motorola V3 RAZR Corner of 19th & L St., NW ••Farragut West •Farragut North * (202) 466-7777 $ 99 McPherson Square Corner of 14th & L St,NW !" ('')!*)+',,- #$%&' #!+'. 79 ••McPherson Square               * (202) 289-7344 Save $50! Capitol Hill              (with mail-in rebate) 660 Pennsylvania Ave., SE ••Eastern Market MSRP $249.99 (202) 546-8818 National Press Building Instant Rebate - $120.00 529 14th St, NW Metro Center      Mail-in Rebate - $50.00 ••• (202) 662-7662 Final Price $79.99 Reagan National Airport *After $129.99 2-yr agreement price, Terminal B T-Mobile $50 mail-in rebate & new 2-year ••Reagan National Airport service agreement. (703) 417-1486     MARYLAND City Place            $ 8661 Colesville Road      •Silver Spring (301) 565-0050       #    Westfield Wheaton Mall •Wheaton              (  Lower Level - (301) 933-7700   Upper Level - (301) 946-6300        VIRGINIA         -    Order by phone: Crystal City Plaza ••Crystal City            1.866.343.2735 (703) 416-5040      .   Special Bonus Code: RAZR07 Crystal City Underground ••Crystal City           )!    (703) 413-4500 Merrifield             ! /  $ •Dunn Loring-Merrifield       2929 Gallows Road Don’t forget to ask about our special offers! (571) 226-8500   !   +    " 0    ® #      $   ,     T-Mobile Get More Plan - Limited Time Offer!        $ )!   (1! %% &'   $1+          (    • 1500 Nationwide WHENEVER® Minutes             ,     $ 99              PER MONTH • No Nationwide long-distance or roaming charges )   $        39 *        *Limited time offer. New activation required. Rate plan offer requires minimum 1-year agreement. Phone offer requires 2-year agreement and activation       $    per line of service for each phone. Taxes and fees not included.   +                ,       

6 7 6                 *Simply Wireless advertised price of Motorola V3 RAZR based off new 2-year REBATE OFFER: Motorola V3 Razr (Silver & Magenta) mail-in rebate offer expires      agreement of an individual plan $39.99+ or first two lines of a FamilyTime plan 07/31/06, in-store rebate offer expires 07/31/06. 1500 Get More Plan Promotion   $69.99+, and $50 T-Mobile mail-in rebate. offer ends 07/31/06. Limited to phone shown; Supplies may be limited and offer may         not be available at all dealer locations. T-Mobile reserves the right to substitute different Limited time offer subject to change. CREDIT APPROVAL/ADDITIONAL COSTS: Does not phone models of equal or greater value. Customer must remain on a qualifying T-Mobile                 apply to pre-paid. Credit approval and $35/line activation fee required; $200/line early rate plan at the time mail-in rebate is actually processed. Allow up to 8 weeks for mail-in cancellation fee applies. Regulatory Programs Fee (not a tax or government-mandated rebate check. See mail-in rebate form for full details. See T-Mobile’s Terms and Conditions !  255      charge) of 86¢ per line/mo. applies; additional taxes and fees may add 6-28% to your (including mandatory arbitration), available at www.t-mobile.com, for cancellation policy, monthly bill. Minutes over monthly allotment are 40¢ per additional minute. Partial international long-distance, roaming and messaging rates, and additional details that may          6 6   minutes are rounded up for billing. SERVICE COVERAGE: Service is not available affect this offer and additional rate plans, and other information and/or contact T-Mobile   2'        $ everywhere. For full details, see Coverage Maps available at www.t-mobile.com or at a T- Customer Care, at 1-800-937-8997, with questions concerning any T-Mobile offer or rate Mobile store. ABNORMAL CALL PATTERNS: Call duration and/or your continued plan. T-Mobile is a federally registered trademark, and the magenta color is a trademark, %%3  "      235  '3 eligibility for any rate plan may be limited or terminated for (a) consumer protection of Deutsche Telekom AG. Whenever Minutes, FamilyTime and Get More are federally purposes or (b) abusive conduct or abnormal call pattern(s). MAIL-IN and IN-STORE registered trademarks of T-Mobile USA, Inc. © 2006 T-Mobile USA, Inc.  245           %%  C7DAB30Hk & "! %k4G?A4BBk "

=d\QTa^U0\TaXRP]8]SXP]bFROM6IRGINIAWHOTRAVELED7EDNESDAYTO ,ONDONTOCOMMEMORATETHETHANNIVERSARYOFTHE%NGLISHLANDINGIN +%q*AMESTOWN 6A4HEGROUPSAIDITHOPESTHETRIPRENEWSTIESWITHTHE"RITISH ;^RP[ ;P]S\PaZBTRdaXchD__TS F0B78=6C>=k20BC8=620;;B aZo^kbl^g*-i^k\^gmZg]Zkf^] ehmfhk^maZgma^iheb\^'Ë Mphkh[[^kb^lhgFZee ZllZnemlaZo^cnfi^]*1i^k\^gm' Mablblma^mabk]lnff^kbg_hnk h\\nkhggb`amh_\kbf^ EZlmr^Zk%ahfb\b]^lbgma^\bmr_^ee r^ZklmaZmKZfl^raZl]^\eZk^]Z ^f^k`^g\r]^\eZkZmbhg mhZ+)&r^Zkehph_*2.' \kbf^^f^k`^g\rZg]ma^_hnkma Iheb\^\ab^_=kIheb\^[^^_^]ni ^f^k`^g\r]^\eZkZmbhgZeehpl\hf& bg*221'Bg+))-%KZfl^rphkd^] iZmkhelZkhng]gZmbhgZeeZg]fZkdl fZg]^klfhk^_e^qb[bebmrmhZ]cnlm mhaZemZliZm^h_\Zkma^_ml[rcno^& P^]g^l]Zr%Z]ZrZ_m^k=blmkb\mh_ h__b\^klÍl\a^]ne^lZg]k^Zllb`g gbe^l%Zg]bg+)),Zghma^kpZo^h_

iZkmh_ma^l\ahheÍl]Zr\Zfi'Ma^k^ Zeema^Zk^ZÍleZp^g_hk\^f^gmZ`^g& "),,/,%!29470 p^k^ZmeZlm*.hma^k\abe]k^gbgma^ \b^lmhk^lihg]mh='<'Íl\kbf^^f^k& ?>;4?>B8C8>=B)&ROMLEFT $OMINICK0ARKER 4YQESE-ARTIN :EQUAN Bg;kb^_ ihheZmma^mbf^Zg]mpheb_^`nZk]l `^g\r'Iheb\^\ab^_2:E8;;4<3 ma^[hrZmma^[hmmhfh_ma^ihhebg mhZme^Zlm*-ahfb\b]^llbg\^Cner 1^h3a^f]b3daX]VBd\\Ta _hnk_^^mh_pZm^k%inee^]abfhnm *%Zg]Zcnfibgkh[[^kb^lZg] 2P\_½bBfX\\X]V;Tbb^]b Zg]lmZkm^]2:E8;;4<3k:cn]`^P^]g^l]Zr pab\a\ehl^]bml]hhklbg+))-%pah ma^\abe]pZlinee^]_khfma^ihhe fbmm^^É\Zee^]_hkZeeZk^Ziheb\^ k^c^\m^]Zk^jn^lm[reh[[rblmCZ\d lZrma^rZk^hp^][Z\diZr' lahkmerZ_m^k**Z'f'Zmma^C^pbla F0B78=6C>= Z`^g\b^lmhphkdmh`^ma^kmhlmhi :[kZfh__mh]^eZrZ\bobelnbmZ`Zbglm :[kZfh__ÍleZpr^k%H[b ladhe:\Z]^fr% `ho^kgf^gmbgo^lmb`Zmbhg'0?

Bgo^lmb`Zmhklp^k^ghmli^\b_b\

2D?AD==4C7>E4A)%UROPEANADVERTISINGSPENDINGROSE ASDIDSALESOFBIG SCREEN46S BEERANDSNACKSASMILLIONSOFSOCCERFANSSPAREDNOEXPENSETOENJOYTHE <^]Th 7ORLD#UP!NESTIMATEDMILLIONVISITORSWEREDRAWNTO'ERMANYFORTHETOURNAMENT

F =0B30@ B?$ =TfH^aZBc^RZ4gRWP]VT =0B30@Bc^RZ2: ;0BC 270=64 ?4A24=C270=64 BC>2: ;0BC 270=64 ?4A24=C270=64 '  ( ' ' '  ( aP;PQb "'  $%  &" 1P]ZBc^RZb 8]cR]c[4g] $'$  "  $# +1-8^\PX] #!   # "% Lh_mpZk^`bZgmieZgl   308;H H40AC>30C4 ;^bTab ;^bTab BC>2: ;0BC 270=64 ?4A24=C270=64 mhZii^Zei^gZemr_hk HP]Z2S[ !  ( "!"  "! BTRdaT2\_ #(( " ' "'! 0dbc=I (( $  #   !% B\ac5] $ !  #' ( BT]cXVT] !"  #(  &% 1R^B]27 ##( "# (( Zgmb&mknlmobheZmbhgl 3^eTa36b '"$  &' '' ATcP[Xg &  "$"  &! 1Z^U0\ #'$& $' $! 0VTaTBhb !&'  !  '% B>A;] %%#  !%  $( 1Z=^ePV # !( "(  & 1ADBB4;B14;68D<kMa^>N_bg^] CP[Q^cb ! "   &% ' BXaT]iP (&"  !#  " 2XcXVa_ #''" && % Fb\khlh_mDBF44:  C>30H ?A4E8>DB30H H40A06> A^hP[1ZVb # %! #& %& _Zbe^]mhh[^rZ+))-Zgmbmknlm ?aX\TAPcT '!$ '!$ 1aXcXbW?^d]S $#$# $# ' $%!( C^a31ZV $ #' $  !" hk]^kmhlaZk^m^\agb\Zebg_hkfZ& 5TS5d]SbR[^bT $!$ $!$ 2P]PSXP]3^[[Pa  "#'  " " ! # D1B06b $!#   #!  ! "\^]cWSXbR #(# #( 4da^_TP]4da^ &'&$ &'"  ' &$ DB1P]Ra_ " ('  ( "% mbhgmaZmphne]ZeehpkboZelÍlh_m& !hTPa $ & $!# 9P_P]TbTHT] $$! #  ( FPRW^eXP $"&& &   & pZk^mh\hffngb\Zm^[^mm^kpbma hTPa $  $!!

ma^_bg^%\eZbfbg`ma^a^_mrZfhngm 96%3,/''(%!0 pZlng_Zbk'BmllaZk^l_^ee,/\^gml% %UROPEANREGULATORSCLAIM-ICROSOFTIS hk*'/i^k\^gm%mh++'0-bg^Zker NOTSHARINGENOUGHDATAWITHITSRIVALS FREE! mkZ]bg`hgma^GZl]Zj' Open to the Ma^>nkhi^ZgNgbhgZelhlZb] Z[ho^ma^eZp'Ë 97th Annual 2006 Public! bmphne]]hn[e^_bg^kZm^lmh,fbe& Fb\khlh_m@^g^kZeNÍll^\hg]ab`a^lm\hnkm%ma^ Media Sponsors: bg`Cner,*nge^llma^\hfiZgr NaZ]g^o^k[^^g fZd^lh_mpZk^maZmphkdllfhhmaer \e^ZkZ[hnmpaZmbmpZgm^]' Sales, Healthcare, Security Clearance, Finance, Computer, Engineering, pbmabmln[bjnbmhnlPbg]hplhi^k& Dkh^lZelhlZb]P^]g^l]Zrla^ Education, Retail, Restaurant, Administration, and more! Zmbg`lrlm^f' pZkg^]Fb\khlh_mbmaZ]mhmZd^\Zk^ Tuesday, July 18 • NOON - 8 pm ÊFb\khlh_maZllmbeeghminmZg mhZohb]Zgmbmknlmikh[e^flpbmabml Wednesday, July 19 • 10 am - 4 pm ^g]mhbmlbee^`Ze\hg]n\m%ËlZb]>N g^phi^kZmbg`lrlm^fOblmZ%pab\a 854F78C40? PARTIAL LIST OF PARTICIPANTS • Fire Department • Society of Human Resource Management • ADVO, Inc. • Eye Care Centers of America, Inc. • Loudoun County, VA Sheriff's Office • Sony • Air National Guard • Fairfax County Fire & Rescue Department • M. C. Dean, Inc. • St. Paul Travelers • Allstate Insurance Company • Fairfax County Police Department • Madison Metropolitan School District • Strayer University • Altarum • Fairfax County Public Schools • Manpower • Sunbelt Rentals • American Cancer Society • FBI • March of Dimes • The Children's Hospital of • American Honda Motor Co., Inc. • Federal Deposit Insurance Corporation • Marriott International • The Washington Home & Community • American University • FEMA • Maryland Department of Public Safety & Hospices AT_^ac)3Xb]Th?[P]b • Apptis, Inc. • Food Lion, LLC Corrections • • AT&T Government Solutions • Freddie Mac • Military Sealift Command • The Washington Times • BAE Systems - Electronics & Integrated • Frito-Lay • Milton Hershey School • Tiffany & Co. Solutions • GEICO • NASCAR • Transportation Security Administration C^B[PbW5X[\>dc_dc • Best Buy • General Motors Corporation • NASD • U.S. Department of State • Boehringer Ingelheim Pharmaceuticals, Inc. • Georgetown University • National Security Agency • U.S. Government Printing Office • BP America •H&RBlock • Nationwide Insurance & Financial Services • U.S. Marines ;>B0=64;4BkPZem=blg^r

0=38CBC8;;70B'!60<4B)4HE7ASHINGTON#APITALSANNOUNCEDTHEIRREGULAR SEASONSCHEDULE7EDNESDAY4HE#APSWILLOPENON/CTATTHE.EW9ORK2ANGERS ANDTHEHOMEOPENERISSCHEDULEDFOR/CTAGAINSTTHECHAMPION#AROLINA(URRICANES B_^acb IXSP]T0_^[^VXiTb1[P\Tb8cP[XP] ÊBphne]kZma^kaZo^mZd^gZ mbhg%ËSb]Zg^lZb]'ÊFrZ\mblghm_hk& ?k^g\a\ZimZbglZrl ing\abgma^cZpmaZgaZo^a^Zk] `boZ[e^';nmma^rfnlmZelhingbla bglnemmhfhma^k%lblm^k maZm%Ëa^mhe]ma^A;32D?k?k^g\alh\\^klmZk aZkla%ËZg]maZma^nmm^k^]ma^ a^bglnem^]Sb]Zg^%pbmahnm`bo& Sbg^]bg^Sb]Zg^h__^k^]Ziheh`b^l bglnemll^o^kZembf^l' bg`li^\b_b\l'A^]^gb^]bglnembg` [nmghk^`k^mlP^]g^l]Zr_hk[kn& Bgabl_bklmin[eb\\hff^gml Sb]Zg^Ílfhma^k' mZeera^Z]&[nmmbg`ZgBmZebZghiih& lbg\^Lng]ZrÍlfZm\a%Sb]Zg^ ÊB]b]gÍmlZrZgrmabg`mhabf g^gmbgma^Phke]

ablfhma^kZg]lblm^k' a^]b]gÍmk^`k^mma^Z[knim%obhe^gm Lihkm'ÊB]b]gÍmmZedZ[hnmablfhma& $!.)%,-!52%2!0 >qZ\merpaZmpZllZb][^mp^^g hnm[nklm' ^k%^bma^k'Behlmfrfhma^kpa^gB *UERGEN+LINSMANNCELEBRATESAFTER ?kZg\^Íl\ZimZbgZg]FZk\h P^]g^l]Zr%a^lmk^ll^]a^_^em pZl*.%Zg]^o^gghpBlmbee`^m^fh& 'ERMANYTOOKTHIRDATTHE7ORLD#UP FZm^kZssbk^fZbglZfrlm^kr%ahp& ghk^`k^mÊ[^\Znl^maZmphne] mbhgZemZedbg`Z[hnma^k'Ë

^o^k'Sb]Zg^g^o^kpZlli^\b_b\Z[hnm f^Zg!FZm^kZssb"pZlkb`ammhlZr $!.)%,"!2$/5!0 Sb]Zg^ÊaZlZepZrl[^^gfr paZm^gkZ`^]abf'Lh%_hkghp%ma^ ZeemaZm'Ë &ORTHEFIRSTTIME &RENCHSTAR:INEDINE a^kh%ËFZm^kZssblZb]'ÊBZ]fbk^ ^q\aZg`^lmZrl[^mp^^gma^f' ÊMa^k^pZlZl^kbhnlikhoh\Z& :IDANETALKSPUBLICLYABOUTHISHEADBUTT abfZehm'Ë0=64;03>;0=30? 6Ta\P] 0\TaXRP]b ?TaZX]b6TcbBda_aXbT0[[BcPa=^S 2^PRW8b ;^^ZX]VU^a @hZeb^bl*h_,Ngbm^] 5X]XbWTS lmZkm^klmhk^\^bo^ma^ DebglfZgg]^gb^lZgr ATeT]VT fb]&l^Zlhgahghk bgm^k^lmbgmZdbg`ho^k D=8C43kBm\hf^lZlghlnkikbl^ N'L'lh\\^kikh`kZf :_m^k+ehll^leZlmr^Zk% maZm='<'Ngbm^]ÍlCZbf^Fhk^gh N'L'lh_m[Zeeblg^per Zg]A;32D?kCn^k`^gDebglfZgg ma^**ieZr^klgZf^]r^lm^k]Zrmh pZed^]ZpZr_khfma^@^kfZg fhmboZm^]_hk5C10;;kEhlbg`hg^`Zf^bl]b_& LmZk`Zf^Z`Zbglm>g`ebla\aZf& krbg`Z[Z\diZ\dpbmamphlh\\^k _b\nem^ghn`a_hkma^N'L'lh_m[Zee ibhg

mh]]b^Ihi^Zg]

Was THIS WEEKEND ONLY! Was 0 WNwPsa Sedan Passat New VW ‘06 Up to 48 mpg

AND TDIs in Stock. l rcspu a,tg,fegtadpoesn e.Cs aki iuo uvne P.Ms iac hog WCei.Alporm xie7/20/06. expire programs All Credit. VW through finance Must APR. subvented of lieu in back Cash fee. processing and freight tags, tax, plus prices All $ $ 39,225 24,990 0 WTouareg VW ‘06 ehabla Se Español $ ,0 AHBACK! CASH 2,000 o umrSale. Summer Hot #E061149 #E061104 k 1/V6 Pkg Now Now ml ru nomto eso uy0 2006,5:30 –7p.m. July20, Space islimited!R.s.v.p. at Session Information Group Small admissions(e.g., No-nonsense GRE/GMAT notrequired). • IncludesPHR/SPHRprep(SHRM LearningSystem™). • Impressivefacultyofsenior-level practitioners. • Completeyourdegreeinasfew18 months. • andonlinecourses. Accelerated, evening • ApplynowforFall 2006courses!It’snottoolate. • Master ofArtsinHumanResource Management Are youanHRprofessional For more information,visitourWeb site:http://metro.cua.edu. Line). near theBrookland/CUA Metrorail stop(Red Location: PangbornHall,TheCatholic UniversityofAmerica,Washington, D.C., $ $ 31,998 21,990 ut5mntsfo -7 oWotnPw okil Pike Rockville & Pkwy Wootton to I-270 from minutes 5 Just 0 8 2920 784 800 Was WNwRbisaein! are Rabbits New VW AND congressionalmotors.com who wantsaseatatthetable? T $ ub akg 1 Package Turbo From [email protected] orcall 26,415 HE 0 e Jetta New ‘06 $ ,0 AHBACK! CASH 1,000 C ATHOLIC Now $ 14,990 #E061126 $ 22,990 U oi all. it Do METROPOLITAN COLLEGE NIVERSITY 202-319-5256 Discover excellence.Experience success. Was Was 0 WPsa ea V6 Sedan Passat VW ‘06 AND O AND pr Package/Nav Sport F $ 36,044 $ A 25,175 $ MERICA $ ,0 AHBACK! CASH 3,500 0 WPassat VW ‘06 ,0 AHBACK! CASH 2,000 . #E061072 Now Now #E061170 $ $ 31,990 20,995

Ronald Reagan Building and International Trade Center ceuesbett change. to subject Schedule /8DvdL lu iteMaggie Little & Fleur La David 7/18 Soul Latin Festival Theater Hop 7/17 Hip DC 7/14 oMr tNOVA! at More Do OAi orpaet grow. to place faculty, your is expert NOVA by taught non-credit and classes credit 6,000 With ANCEIST RNFR•IPOEYU SKILLS YOUR IMPROVE • TRANSFER TO CREDITS EARN ur al20 Classes 2006 Fall … Hurry olanmr,visit more, learn To N ÉUÉ•EPOEALFLN NEET• INTEREST LIFELONG A EXPLORE • RÉSUMÉ AND eeosfiaca i opportunities aid financial Generous • credit per $82 than less — tuition Affordable • counseling career and services support Free • place any time, any learn you let options Online • Alexandria, in locations campus Convenient • classes weekend and evening day, Flexible • rigo n Reston and Arlington in centers learning state-of-the-art plus Woodbridge, and Education) (Medical Springfield Manassas, Loudoun, Annandale, USEADGE RCRIIAE• CERTIFICATE OR DEGREE A PURSUE • ei uut21! August Begin hsFall, This rcall or oa’ rePerformance Free Today’s Palenke 703-323-3001 ai Jazz Latin www.nvcc.edu/fall

projectA theof U.S. General Services Administration.

www.itcdc.com

30Pnslai.Ae,NW Ave., Pennsylvania. 1300

UEJL AUGUST JULY JUNE

2no–:0pm noon–1:30 12 Monday–Friday C7DAB30Hk & "! %k4G?A4BBk &

<8BB8=6?4AB>=)3ERENA7ILLIAMSWILLPLAYHERFIRSTMATCHINSIXMONTHSNEXTWEEK 7ILLIAMS NOWRANKED.O MISSEDTHE&RENCH/PENAND7IMBLEDONBECAUSEOFACHRON ICLEFTKNEEINJURYANDHASPLAYEDATOTALOFFOURMATCHESOVERTHEPASTMONTHS GOING  B_^acb

8b_T]SP[^c Bd__[T\T]cP[ ^UcX\TfXcW 3aPUc8b5^a\Ta DEPBcPa½b7^_T =0C8>=0;B?8C274A<8:4BC0=C>= UP\X[h8Wd]c =5;kPa^ga^e^_m\hZ\a:e@khaÍl @0kFbd^LmZgmhglZrla^blgÍm[b` S^P[Xcc[T h__b\^bgFZk\aZ_m^kablObk`bgbZ hgk^fbgbl\bg`';nmpa^g^o^ka^ UXbWX]V _hhm[Zee\Zk^^k^g]^]ln]]^gerZg] ]h^l]^\b]^mhk^mbk^%a^ÍeeaZo^Zehm pbmahnmZgrh_ma^_Zg_Zk^_hk^\Zlm mhmabgdZ[hnm'Ma^lhnmaiZpaZl nihgablZkkboZe% fhk^maZg*/r^Zklh_FZchkE^Z`n^ FWPcS^h^dcWX]Zh^d½[[T]Sd_ :afZ];khhdl ^qi^kb^g\^makhpbg`_hklbq]b__^k& S^X]VfWT]h^daTcXaT. lZb]a^pZllhkkr ^gmm^Zfl'A^Íl[^^giZkmh_**ihlm& BaZo^gÍmmahn`ammaZmfn\aZ[hnm a^aZ]gÍmebo^]ni l^Zlhgl%^Zkgbg`mak^^Phke]L^kb^l bm':lh_kb`ammablfbgnm^%BÍfdbg] mhablihm^gmbZe' kbg`l'?hkableZm^lm_^Zm%ma^lahkm h_mbk^]h_ma^mkZo^eZg][^bg`ZpZr ;khhdlblahi& k^eb^o^klnkiZll^]AZeeh_?Zf^kl _khfTfr_ZfberV_hklhehg`' bg`Mankl]ZrÍl AhrmPbea^ef!*%)0)"Zg]=^ggbl Lniie^f^gmZe "ROOKS >\d^kle^r!*%)0*"hgma^Zee&mbf^ 0cfWPc_^X]cX]P_[PhTa½bRPaTTa =kZ_mfZkdlZ

`Zf^libm\a^]eblm'LmZgmhgaZ] */.!4(!..%74/.470 S^TbcWTcaPeT[VTc^[S. g^p[^`bggbg`'MaZmÍlpa^gG?E *%)0/\Zk^^k`Zf^lng]^kabl[^em .ATIONALSRELIEFPITCHER-IKE3TANTON RIGHT HASTHROWNIN CAREERGAMES Bm`^mlhe]^o^krr^Zk'@^mmbg`bgZm m^ZflaZo^ma^himbhgh_nlbg`hg^ Zmma^:ee&LmZk[k^Zd' !FTERYEARS HESAYSTHETRAVELANDCONSTANTPLAYWEARHIMDOWNMOREEVERYYEAR _hnkhk_bo^bgma^fhkgbg`mhmnkg h_ma^bk+))0]kZ_m\ahb\^lhgma^ Zkhng]Zg]ieZrZ`Zf^maZmg^qm ebg^[Z\d^k%Z_hkf^k:ee&:meZgmb\ FPb=^  & P]hSXUUTaT]ccWP] lhf^mabg`maZmrhnk^Zeermabgd ehhdbg`[Z\dpZk]'BÍfmhh[nlr gb`amÉbmaZlZmheehgrhn'

ROCKVILLE AUDI KOONS CHEVY TYSONS MOORE CADILLAC HUMMER EURO MOTORCARS GERMANTOWN KAY JENNINGS SPRINGFIELD TOYOTA Rockville,MD 301-881-0900 Vienna, VA 888-383-8200 Chantilly 703-674-5900 Germantown,MD 240-686-1300 Springfield 703-451-0300 1450 Rockville Pike • rockvilleporsche-audi.com 2000 Chain Bridge Rd • www.koons.com 25440 Pleasant Valley Rd • www.moorehummer.com 19750 Germantown Rd. • euromotorcarsgermantown.com 6570 Amherst Ave. • www.springfieldtoyota.com EURO MOTORCARS GERMANTOWN Germantown,MD 240-686-1300 KOONS ARLINGTON TOYOTA 19750 Germantown Rd. • euromotorcarsgermantown.com Arlington 888-837-8657 CRYSTAL FORD INFINITI OF CHANTILLY 4045 Lee Highway • koons.com Silver Spring 866-369-9999 Chantilly 703-322-3600 BMW OF ARLINGTON 3111 Automobile Blvd • www.trycrystal.com Chantilly Auto Park. • infinitiofchantilly.com KOONS TYSONS TOYOTA Arlington,VA 703-647-1810 Vienna, VA 888-505-1137 3154 Jeff Davis Hwy • www.bmwofarlington.com JERRY’S FORD 355 NISSAN/VOLVO 8610 Leesburg Pike • www.koons.com Annandale, VA 703-256-5000 Rockville, MD 301-309-2200 6510 Little River Turnpike• www.JerrysFord.com 15911 Indianola Drive • www.darcars.com KOONS FORD OF ROCKVILLE JERRY’S JEEP OF MANASSAS Rockville 877-518-1747 MANASSAS 703-631-1181 718 Rockville Pike• www.koonsford.com 8820 Centreville Rd• www.jerrysjeep.com ALEXANDRIA VW KOONS STERLING FORD 355 TOYOTA/SCION Alexandria 888-692-7089 CAPITOL CADILLAC 107 W. Glebe Rd.• www.alexandriavw.com Greenbelt, MD 301-441-9600 Alexandria, VA 888-342-7300 Rockville, MD 301-309-3917 6500 Capitol Drive • www.capitolcadillac.com 46869 Harry Byrd Hwy • www.koons.com 15131 Frederick Road • www.darcars.com BROWN’S VW OF MANASSAS OURISMAN WORLD OF FORD LEXUS OF SILVER SPRING Manassas, VA 703-257-6002 Alexandria, VA 703-660-9000 Silver Spring, MD 800-266-4874 8846 Mathis Ave. • www.manassasvw.com To place dealership listing 6129 Richmond Hwy. • www.ourismanford.com 2505 Prosperity Terr • www.lexusofsilverspring.com in the directory, 355 TOYOTA please call Rockville, MD 301-309-3917 202-334-4710 15131 Frederick Road • www.darcars.com or your Washington Post BILL PAGE HONDA JERRY’S Lincoln Mercury ALEXANDRIA TOYOTA JACK TAYLOR SIGNATURE CARS Sales Representative Falls Church 1-866-391-8562 MANASSAS 703-631-1181 Alexandria 703-684-0700 Alexandria,VA 703-683-0700 6715 Arlington Blvd • www.billpagehonda.com 8820 Centreville Rd• www.jerryslmjeep.com 3570 Jeff Davis Hwy • www.alexandriatoyota.com 3750 Jeff Davis Hwy • www.alexandriatoyota.com EARTH GREEN 'k4G?A4BBk & "! %kC7DAB30H Landscaping & Design Build Co. Complete Spring Cleanups Trimming/Mulching 0\^d]cX]\X[[X^]bTHAT#AVALIERSSUPERSTAR,E"RON Dr. Valerie Callender is Lawn Maintenance B_^acb *AMESWILLRECEIVEOVERTHENEXTTHREEYEARS/NTHEFIRST conducting a research 703-380-7415 +%qDAYAFREEAGENTCOULDSIGN *AMESANDOTHERSCASHEDIN study that may help. 7Ta]P]STi8bPATP[2PcRW He’d love to snap O^m^kZg[^abg]ma^ up your 35mm camera. ieZm^a^eilrhng`HÍl Sell your stuff in Express. Place your Classified ad today. lmZ__e^Zkgma^`Zf^ 202-334-6200. >A8>;4BkG^`hmbZmbg`blgÍmebfbm^] mhlZe^lf^gZg]]biehfZml'

A Publication of the GHI KZfhgA^kgZg]^sÉma^ www.readexpress.com Hkbhe^lÍikbs^h__l^ZlhgZ\jnblbmbhg Classified ads appear in Express and The Washington Post. ÉblghlmkZg`^kmhaZg]ebg`ma^ X167b 1x3 \hfie^qbmb^lh_Zibm\abg`lmZ__'Ma^ [Z\dlmhiaZg]e^]ma^mkbhh_Mbf GW VIRGINIA CAMPUS – LOUDOUN An]lhg%FZkdFne]^kZg];Zkkr GW ARLINGTON AND ALEXANDRIA CENTERS SbmhbgHZdeZg][^_hk^fhobg`hg mh\Zm\abg`CZd^I^ZorZg]Mk^ohk Ah__fZgbgLZg=b^`h' Graduate Programs in Information Sessions A^d^^ilkngg^klahg^lm%abl Tuesday, July 18 m^ZflnlnZeerfZd^ma^ieZr& .!4(!.$%.%44%!0 Engineering 6:00 pm h__l%Zg]]^libm^abllb`gb_b\Zgm 2AMON(ERNANDEZ LEFT HASPLENTYOFEXPERIENCEWITHYOUNGSTARSLIKE#HRIS2AY 20101 Academic Way k^lnf^%a^]h^lgÍmfbg]`^mmbg` Building 1,Room 101 laZd^gh__' ableZlmmphlmhil'Ma^_hkf^k:ee& abl\Zeebg`\Zk]%;Zembfhk^`hmZg Management Ashburn,VA ÊBmabgd\hffngb\Zmbhgblma^ LmZkbll^^gZlZd^r\h`bgbfikhobg` ng^qi^\m^]k^mnkghgbmlbgo^lmf^gm &Systems Wednesday, July 19 fhk^bfihkmZgmiZkm%ËA^kgZg]^s ma^ph^lh_ZgHkbhe^lÍibm\abg`lmZ__ _khfA^kgZg]^sZmma^ieZm^'Ma^ 6:00 pm lZb]'ÊRhnaZo^mh_bg]hnmahpma^r maZmpZl+,k]bgma^FZchklbg>K: \Zk^^k'+/,abmm^kaZl[^^gZlmZie^ pZgmmhphkdpbmarhn%Zg]rhn`h bg+)).Zg]bllnkk^g]^kbg`p^eeho^k bgma^fb]]e^h_ma^Hkbhe^lÍhk]^k Engineering 1775-B Duke Street Alexandria,VA _khfma^k^' _bo^knglZ`Zf^mabll^Zlhg' É[Zmmbg`'+0,makhn`ama^:ee&LmZk ÊB]hgÍmpZgmmh[^ma^`nrmaZm ÊBmabgdKZfhgblk^Zeerik^& [k^ZdÉZg]bll^\hg]hgma^m^Zf Focus on your interests with a Metro: Yellow or Blue Line to lZrlÌRhn]hmabl[^\Znl^Bm^eerhnmh'Í iZk^]pa^ga^\hf^lbgmh[Zee& bgahf^kl!*."Zg]K;Bl!/*"' Master’s Degree or Graduate King Street B]hgÍmaZo^ma^[Zee%lhB]hgÍmdghp `Zf^l%ËHkbhe^l\ehl^kA8>;4Bk:r^ZkZ`h%ma^;Zembfhk^ gbg^%ma^rfnlm[hng\^[Z\d_khf Hkbhe^lZeehp^]^o^krmabg`ma^r Z]blZiihbgmbg`_bklmaZe_'I^kaZil Z\\hfiebla^][^_hk^ma^:ee&LmZk ma^ehg^[^g^_bmh_eZlmr^ZkÍl [k^Zdmh[^knbg^][rZgZ`hgbsbg` ]^fbl^blmaZmbmlahp^]Zgrmabg` l^\hg]&aZe_\heeZil^'MaZmphgÍm[^ \ZgaZii^gho^kma^l^ZlhgÍl_bgZe www.gwu.edu/gradinfo Zgblln^mabll^Zlhg' +fhgmal' THE GEORGE WASHINGTON UNIVERSITY IS AN EQUAL OPPORTUNITY/ 31275 AFFIRMATIVE ACTION INSTITUTION CERTIFIED TO OPERATE IN VA BY SCHEV. Ma^Hkbhe^lk^Z\a^]ma^[k^Zd ÊBmabgdmaZmp^Ík^Zee]blZiihbgm& pbmaZ-*&-2k^\hk]%ma^^b`ama ^]bgma^pZrp^lmZkm^]mabll^Z& mbf^bgma^eZlmgbg^r^Zklma^r lhg%Ël^\hg][Zl^fZg;kbZgKh[^kml Adapt you. abmma^fb]ihbgm[^ehp'.))'Ma^ lZb]'Ê;nmp^lmZkm^]h__lhp^eeeZlm

“Personal Tech” can give you cool and useful tools. Mondays. ehg^^q\^imbhgpZlbg+)).%pa^g *!-)%315)2%'%449)-!'%3 r^Zk'Lhb_rhninmmh`^ma^kZk^Ze ;Zembfhk^pZl-0&-)Zg]bgl^\hg] "RIAN2OBERTS TOP HASTHETOUGHTASK `hh]lmk^m\abgma^l^\hg]aZe_%ma^g ieZ\^bgma^:E>Zlm' OFHELPINGTHE/SGETBACKABOVE rhnÍk^kb`am[Z\dbgbm'Ë0? X017e 2x1      

  - , -        *  0 - .-           $##  7889     -    0     '

%' (' ) )*+) ', ' %'* -       '!  $    6    7        8  !   # $         #& !         !$  &!         1             #   #1 ,'2"#$(#      " # 9'  ,             67       , -           !    ! &    -$  71       "  $ &! & ! 0 "  6:  &   % 5  #   $   &  $ / &    %       !  &              '                 ,        &      - * .     !"#$% !&!'(#!()'**+ &#)'   &

    %   ()                 -  +        "%  !     &   *+  ,-&  .)                 */"       4        !  %       5   ,   $  /0*1   / !        &!        5    !    &     0         *2-3   323. !     -         %%     &   (.          # %  !      #    #-  !  1   )       -  &     !      -23. !   4     &!   2 - - 3 #- 1 -6.    &       #      " #   $ *     ,  

By treating my NEED A LOAN? high blood pressure, Marianne Segura is a neighbor providing home and commercial mortgages with the highest levels of professionalism and service. • Local lender • Hundreds of different loan programs I may be preventing its harmful effects. Prevention. The overall goal in lowering high blood pressure is to prevent the development of other harmful effects. • Creative solutions to special financing Even a slight decrease in blood pressure could have lasting effects on quality of life including lowering the chances needs of heart failure, stroke, heart attack and kidney failure. • Low closing costs Our physicians are conducting a research study of the investigational use of approved medications, used in • Experience and knowledge combination, to see if they effectively lowerblood pressure. Adults with high blood pressure who have never experienced heart failure, heart attack or stroke may qualify For every closed loan, Marianne donates $100 to to participate. the Center for Missing and Exploited Children. All study related care is provided including physical examinations, laboratory services and study medications. To learn more, call: Marianne Segura (703) 440-9420 (202) 223-6777 (703) 527-8100 (202) 439-5506 [email protected] Clinical Research Institute Drs. Shepard & Lugerner, P.C. Millennium Clinical Trials, LLC 9291 Old Keene Mill Road 2021 K Street, NW, Suite 310 3801 Fairfax Drive, Suite 20 Near Metro Burke, VA 22015 Washington D.C. 20006 207 S.Alfred St. • Alexandria,VA • 22314 Arlington, VA 22203 Don’t Wait, Participate 20 EXPRESS 7.13.2006 THURSDAY n ae fu o$7adteSpebr1t euiyFeo pt 1.Adtoa esaedeuo eatr rmS.Mri,pybei ahol,direc only, cash in payable Martin, St. se from domestic departure per upon $3.30 due of fo are fees apply. responsible fees segment may is Additional air dates passenger $10. $18, blackout to flying to and up up surcharges Every convention of of noted. charges and/or Fee otherwise holiday facility Security unless Weekend, passenger Ted. 11th occupancy itinerary: or September double by United the on vary by and based which serviced $87 and service be to shown may of up prices segments class of the H taxes in in and included person not per are are which Prices DC. Washington, ucae etPieGaaterfnsaeaalbe o uldtiso h etPieplce,visit policies, Price Best the on details full For 2009218-20 CST available. information. qualifying more a for require brochure are Vacations may United values, Other a free notice. in refunds without conditions including change and values, to a terms subject +Extra forms Guarantee to are Rebate 8/14-8/28/06. refer and States. qu Please & availability United apply. adult on 7/28-8/7 Price the may paying based departures in restrictions each are only For offers Fri originating purchase. All Best & unitedvacations.com/reservations/bestprice.asp. of 1/01/06-12/31/06 Mon time travel the for for purchase. at service valid under of are and class Aruba). prices 12 H (Divi ages Bulk 8/27 children in for 8/26, booked valid be price: unitedvacations.com/kidsfly. must ^Kids at travel 8/28-9/1/06. Air 8/21-8/25, airfare. 8/18, child’s 8/16, 8/15, 8/7-8/11, EM N CONDITIONS: AND TERMS rcnatyu oa rvlprofessional. travel local your contact or call Visit nldsrudrparothtltransfers airport/hotel roundtrip Includes nights 7 Includes Club Beach Case Grand nights 7 Includes Resort and Hotel Flamboyant Le Martin St. nldsrudrparothtltransportation airport/hotel roundtrip Includes Maya Paraiso Iberostar Mar del Paraiso Iberostar Maya Riviera h Caribbean the & Mexico to travel summer on deals Great Getaways Summer Cool nlds3ngt,AlIcuie istruhae3stay, 3 free!+ age eat through & Kids play All-Inclusive! nights, 3 Includes stay, 12 free!+ age eat through & Kids play All-Inclusive! nights, 3 Includes 1-888-328-6877 unitedvacations.com T MARTIN ST...... from ◆ ...... from ARUBA oesaertdo rated are Hotels dlskids kids adults adults l rcsblwicuerudrparadhtlaccommodations hotel and air roundtrip include below prices All from ai o a eatrs71 8/26/06. - 7/15 departures Sat for Valid : ai o n eatrs72,72,83 /9 /0 /4 /6 /7 /1(iraDlSl n o n eatrs72,72,81,82,8/24, 8/20, 8/19, 7/27, 7/22, departures 7nt for and Sol) Del (Tierra 8/31 8/27, 8/26, 8/24, 8/20, 8/19, 8/3, 7/27, 7/22, departures 7nt for Valid : ...... from $ $ 849 654 bde)t lxr)sae l-nlsv niae l el n rnsaeicue nyu aainpie eatrsfrom Departures price. vacation your in included are drinks and meals all indicates All-Inclusive scale. (luxury) 5 to (budget) 1 a n .from . .from . $ $ 189 189 $ $ , 799 779 ^ ^ ASUPRDS ISLAND PARADISE NASSAU nlds7ngt,All-Inclusive! nights, .from 7 . Includes Inclusive . All Aruba Divi nights 7 Aruba Includes Club Country & Resort Sol Del Tierra Aruba free!+ play & transfers stay airport/hotel 11 roundtrip age Includes through Kids nights, free!+ 7 play Includes & Island stay Paradise 11 Atlantis, age through Kids nights, 3 Includes Island Paradise Atlantis, Island Paradise Nassau ih rcsvldfrFidprue /8 / /8910.7night 7 8/18-9/1/06. & 8/4 7/28, departures Fri for valid prices night 3 : ...... from ...... from ...... from IBEROSTAR $ $ $ 1,564 1,249 1,479 $ 754 rcsaevldfrdprue 7/31-8/2, departures for valid are Prices : dcmlt ue a efound be can rules complete nd lf o 0 eaeo one on rebate 50% a for alify BE rigo altn(rigo,V) rnho etodClee-Ln ec Trac,C)adhsbe certified been has and CA) (Torrance, Beach Long - College Westwood of branch a VA), (Arlington, Ballston Arlington etitosmyapply. may Restrictions 1-866-811-6459 ALTODAY CALL E AERTANN IN: TRAINING CAREER GET WWW.WESTWOOD.EDU Design Interior • Multimedia & Design Graphic • Justice Criminal Drafting • Architectural - Design Computer-Aided • Animation • mn,Itrainlfees International gment, h olwn charges, following the r SUMMER 1-888-562-0095 www.washingtonpost.com/subscribe crdtdb h crdtn omsino aerShosadClee fTcnlg (ACCSCT). Technology of Colleges and Schools Career of Commission Accrediting the by Accredited SIZZLER! l otearot Air airport. the to tly etodClee-AnnaeStlie(nadl,V)i aelt apso etodClee- College Westwood of campus satellite a is VA) (Annandale, Satellite Annandale - College Westwood idcr,huig ecads n ra jobs great and merchandise housing, cars, Find udeso te o ie noees search. easy one in sites top other of hundreds ooeaei ignab h tt oni fHge dcto o igna(SCHEV). Virginia for Education Higher of Council State the by Virginia in operate to utrsodb 8/13/06. by respond Must itnsfo xrs,Wsigo otand Post Washington Express, from listings MORE readexpress.com CLASSIFIED altl free toll Call rvisit or 91N t yrDie ut 300 Suite Drive, Myer Ft. N. 1901 69Ltl ie Turnpike River Little 7619 , nadl,V 22003 VA Annandale, rigo Ballston Arlington rigo,V 22209 VA Arlington, x.25 Ext. Annandale t Floor 5th GS6 2x6 S260 NG 10 2x3 X120g C7DAB30Hk & "! %k4G?A4BBk! CT[TeXbX^]

Is it time to take your

HR career to the Master’s,next Bachelor’s, level? Certificates.

Accelerated, Evening and Online Programs • Master’s degree in Human Resource Management. • Bachelor’s degree in Business Management. • Certificate in Human Resource Management. • Exam preparation courses for PHR (Professional in Human Resources), SPHR (Senior Professional in Human Resources), and CEBS (Certified Employee Benefit Specialist). 6)6)!.:).+!"#&!-),9 ¼C>30H½B50<8;84B½)*AMES"LACKAND.ICKI-ICHEAUXINASCENEFROM!"# Small Group Information Session July20, 2006, 5:30–7p.m. &AMILYSh,INCOLN(EIGHTS vABOUTACOPWHORETURNSTOHISOLDNEIGHBORHOOD Space is limited. R.s.v.p. at [email protected] or call 202-319-5256. Location: Pangborn Hall, The Catholic University of America, Washington, D.C., next to the Brookland/CUA Metrorail stop (Red Line). For more information, visit our Web site: http://metro.cua.edu. THE CATHOLIC UNIVERSITY OF AMERICA METROPOLITAN COLLEGE I]Z678h Do it all. Discover excellence. Experience success.

2.9% Financing D[;Vb^an Available on Selected Models >aXVX]P[_a^VaP\\X]V maZm%bg\en]bg`ma^a^Zoberikhfhm^] ÊDre^QR%ËZ[hnmma^ZgZmhfb\Zeer VTcbPQ^^bcfXcWP bg\hkk^\mm^^gZ`^[hrpahbl`bo^g Cool Cars. Hot Prices. fXSTaP]VT^UbTaXTb Zahf^[rZlh\bZephkd^kZg]a^k _ZfberZg]lhhg]blieZrl^qmkZhk& B78=8=6D?kPaZm]hMOlahpl ]bgZkrZ[bebmb^l' Z[hnmZfrlm^kbhnlm^^gZ`^k ÊMak^^FhhglHo^kFbe_hk]%Ë fbgnlZ[^eer[nmmhg%Ziheb\^h__b& ]^[nmbg`hg:n`'/%lmZkl>ebsZ[^ma $12,788* $22,448* \^kk^mnkgbg`mhablnk[Zgg^b`a& F\@ho^kg%GhkZ=nggZg]Kh[ 2006 Mazda 3i 2007 Mazda CX-7 [hkahh]Zg]ZlfZeemhpg]^Zebg` ;hembgbgma^mZe^h_ahpma^mhpgÍl Power Brakes/CD and More! #E064278 FAMILY AC/Pwr. Windows & Locks #F074001 pbmama^ihllb[e^^g]h_ma^phke] k^lb]^gmlk^lihg]pa^g_Z\^]pbmaZ VACATION aZo^bg\hffhg8 \hlfb\\kblbl3:g^qiehlbhgaZlliebm SPECIAL Ma^mak^^l^kb^lZk^hghkchbgbg` ma^fhhgbgmhmak^^ib^\^l%i^kaZil Purchase :;<?ZfberÍll\a^]ne^%iZkmh_Zg ihkm^g]bg`ma^phke]Íl]^fbl^' $ x 24 months* a Mazda MPV $ ^__hkmmh[hhlmhkb`bgZeikh`kZf&

85=>C=>FF74=.&UNNYHOWSOMETIMESTHINGSARENOT/+ ANDTHENTHEYARE7EARE SPEAKING OFCOURSE OF#OMEDY#ENTRALSDECISIONTOPUTTHE3OUTH0ARKEPISODEh4RAPPED CT[TeXbX^] INTHE#LOSET vWHICHMOCKS4OM#RUISEAND3CIENTOLOGY BACKONITSRERUNSCHEDULE

m^klpbma]kn`]^Ze^kl%`Zg`lZg] Zllhkm^]kn__bZgl' >=CEC>=867C B_pZm\abg`iheb\^h__b\^kl]h HigV^\]iH]ddiZg ^g]e^lllbm&nilblrhnkb]^Zh_ C74F>ABC>5C74F>ABC 01aXcXbW¼bd_TaR^_½ ^gm^kmZbgf^gm%ma^g[^fr`n^lm' <>BC4E8;PM $ISCOVERY PROFILES Ma^ikh]n\^klmkrmh^gaZg\^ma^ ANDINTERVIEWS#OLUMBIA5NIVERSITY cTPRWTb^cWTa_TPRT ]kZfZpbmal\^g^lh_D676DHkÊ"bliZkmh_ ÍlmnkgmhpZk]m^lmhlm^khg^& A^Ílikhm^\mbo^h_lfZee\k^Zmnk^l 0=HC78=6C74H20=3> ^gaZg\^]k^Zebmr_Zk^' Zg]^l\hkmlZa^eie^llfhnl^hnm 5;0H20=3>14CC4A

Ê54E8;..OTREALLYˆITS phkdlZlZmkZbg^kZg]\a^^ke^Z]& Zm^l'Ablohb\^jnZo^kbg`%a^m^eel ENSINTHESERIESC7A>F3>F=F8C71>11H FORENSICPSYCHIATRIST-ICHAEL3TONE ^k_hkiheb\^_hk\^l'ÊDA6D4BB)8C½B34<>=82 QUERSTHEFASHIONWORLDANDSUCCUMBS _khf\bmrmh\bmr\hg]n\mbg`Zp^^d& ^ghn`aiheb\^\hfkZ]^l'ÊMa^ .EWSABOUT#ASSIESCHILDON74G TOINNERDEMONSINTHECABLEBIOG

ehg`[hhm\Zfi%\aZee^g`bg`\hil #"3.%7302/$5#4)/.3 g^qm_ng^kZeBpZgmmhZmm^g]%ËlZrl PM ""#!MERICA  RAPHY680PM /XYGEN ABREAK pahaZo^`khpglh_m%lehpZg]e^ll& <027><027><0=)0AUL#ASTLE =>D67 2D;C27>824 THROUGHROLEFOR*OLIE:4E8=<23>=>D67 maZg&ik^iZk^]_hk]^Z]er^g\hng& POINTEDLYWORKSWITHHISTRAINEES D=8C43540CDA4BH=3820C4 !TROUBLEDMODEL!NGELINA*OLIE CON D=8C43540CDA4BH=3820C4

                         #3D@  ##756A:F#3D@ 113@@=::FD==2 "F#/;3@/?: )63$44713 F"47:?G )63$44713  ;3?71/)/:3G  #3D@  )=<756A(6=D   (37<43:2  )63(7;>@=<@  )63(7;>@=<@  (37<43:2  )6/A @(6=D )6/A @(6=D (=-=B)67<9-=B/</<13  #3D@ 3?/:2=/A!/?53 7<5=4A637:: 

 ,:2#3D@ ,633:=4=?AB<3  #756A:7<3  #3D@  3=>/?2F  "/@A3?=46/;>7=<@    ?3F@

 #3D@  (#3D@ #3D@)=<756A 

   7<5=4A637::  )6/A @(6=D )6/A @(6=D C3?F'/F;=<2 /A3@6?7@ !=C3<1  C3  BA@  )63)F?//<9@(6=D  7?:4?73<2@  7?:4?73<2@  

   )63#3D@=B?,7A6 7;!36?3?   B@7<3@@'>A B@7<3@@=<< "=A=?,339  )67@$:2=B@3 )63(7E,7C3@=43

   ,=?:2#3D@ B@7<3@@'>A )63#3D@=B?,7A6 7;!36?3?   ,7:2)67<5@ F#349:>3,=2492,.6G )63%/17471,/?)63F7:;32A63,/?7<=:=?  =A=5%?=5?/;  6/?:73'=@3      )=3??C4?!@?:7/G /::/@(,)  =;; /@A:3 =;; /@A:3 =:2/@37:3@  %"$# )63?=1=27:3B:.?:;@> =5(6=D F@6,9@-,%:@=9,809?:13,8;4:9> G,==4>-@=2", =5(6=D%:@=9,809?:13,8;4:9>   %/?9)@)=> !7C3  )63:/19/?>3A )63%/?93?@  )63%/?93?@  7?:4?73<2@  7?:4?73<2@  =;71C73D  /;73=EE /;73=EE '+& %?=831A'B=?A 6/>>3::3@(6=D (=BA6%/?9  "7<2=4"3<17/ 6/>>3::3@(6=D /7:F(6=D =:03?A'3>=?A &*') =?3<@717:3@ =?3<@717:3@ =>@  =>@  =A%B?@B7A =A%B?@B7A ,=?:2@(1/?73@A%=:713(6==A=BA@ )63>7,9/ =::FD==23/A =::FD==23/A "(&+ ', =DA@"/23 =DA@"/23 =B?@/?2C723<13 '3/:"7/;7=>@  (B>3?;/E F9?0=9,711,4=>G "=@AC7: 4770=>B3:/0.04A0  =B?@/?2C723<13   %/?/;3271@ F:=0??0=1:=(:=>0G )?/B;/!7437<A63'  =B0:3233?=?#3D ;3?71/<?5< ./19=2F )6/A@(='/C3<  (7;>:3!743 (7;>:3!743 #3D@   )63/7:F   H/G32/<2=<4B@32I   =,8,,>:9:9/:9(470D(42249> 67:2(A/?=< 67:2(A/?=<47 #3D@ )63/7:F

  7<5=4A637::  7<5=4A637::  )6/A @(6=D )6/A @(6=D H;3?71/<%73I  :80/D,>:9422>$3,99:974E,-0?3 :D/F@(B<



  '3<=C/A7=< 4,/::@=B:2 (;/::(>/13 =B@3B3<=B@3 ?33@75< 7C7<33@75< !/<2@1/>3?@ =B@3B/13    ,6=@3!7<3 ,6=@3!7<3

 $"#, A63/C3< F",=,9:4,G A63/C3<  H,67:3-=B,3?3(:33>7<5I   $,9/=,@77:.6477"@778,9 )63 :B0    "()&', (6==A=BA F@9?1:=-49,/09G "=23?<"/?C3:@=  "/?C3:@"=?3(09:8494.(0>? H =B?@A=!7C3I  $@>;09>0:90$6D0 4.3,07 :=4,=?D ,7::?/13 ,7::?/13  /<A3-=B '==;'/723?@   '==;'/723?@  '==;'/723?@  "/97<5/<2 "/97<5/<2 "/97<5/<2 'B<@=B@3   %7;>"F'723   ,7:2<$BA  ,7:2<$BA  -=B?"=C73(6=D   #32@(16==: /<=<53=0 '=;3=  B::=B@3  ?3@6%?7<13 ?3@6%?7<13 '=@3/<<3  '=@3/<<3  '=@3/<<3   (A/?5/A3( F:80.:8492G H&B33<=4A63/;<32I   :==:=$?@,=?%:B9>09/,74D,3 H(:/F3?I  :==:=,>;0=',9409D9/,,=?0=0A49=0A4:@C &B3@A4=?A:/:3@@7<(3/AA:3I   %:8,96> 02#D,9  ,67:3-=B,3?3$BA  ,6/A,3?3-=B)67<97<5 (>=?A@7@/@A3?@ F(=0.6>,9/#4:?>G $C3?6/B:7<  :=/[email protected] ,?319@A='7163@ F3=4>?490,8,=:G (>=?A@7@/@A3?@ F(=0.6>,9/#4:?>G  !/D$?23? F"=:$0G '$ ,7A6=BA/)?/13 F410#@70>G ,7A6=BA/)?/13 F:39 4.3,07>G H(3C3;09>0=,/"4?? :=2,9=008,9 #756A;/?3@?3/;@1/>3@  !/D$?23??7;7317/:+71A7;@*<7A  %@F16  !/D$?23?(>317/:+71A7;@*<7A  !/D$?23?   !=C3A63 @+=:B;3 F  G  !=C3A63 @+=:B;3 F  G  !=C3A63 @+=:B;3 F G  !=C3A63 @+=:B;3 F G  ,=?:2(3?73@=4%=>B:AB?3    !=C3A63 @+=:B;3 F G  

   (/:/23%/?38/@ #=A7)3:3;<2= !/)=?;3

   &B3!=1B?/ #=A7173?=*<7C #=16323@A?3::/@ %?3;7=@ BC3/1A= #=A7173?=*<7C

  (>=?A@3&94?0/$?,?0>=:8!67,3:8,4?D /@30/::)=<756A 4A0 (>=?A@3

 "793/<2"793 ?=B<2A63=?< "!/@30/::%0,8>?:099:@9.0/$@-50.??:7,.6:@?4A0 =E7<5 ,91=0/:=A>"08-0=?:9 &B7A3?/<9:F,7A6(A3>63< (;7A6

  <=1B@=<(# (>=?A@#7A3  "!/@30/::%0C,>#,920=>,?,7?48:=0!=4:70>=:8!=4:70",=6,?,8/09),=/>49,7?48:=04A0 (>=?A@#7A3 4A0 $?7=:3@::113@@ 73?    

  (>317/:'3>=?A 4A0 )63=E'3>=?A,7A6(63>/?2(;7A6 )63$'37::F/1A=? 4A0 /<<7AF=:;3@ 4A0 $<A63'31=?2+/<(B@A3?3< )63$'37::F/1A=?  )63(7AB/A7=<,7A6)B193?/?:@=< /?20/::  =B317/:    H(7:C3?(A?3/9I  :80/D090(47/0=+" H)63:FI  $.409.04.?4:9011:7/-7@8009,,A4>+# H)63:FI  $.409.04.?4:9=4.$?:7?E,;390*@942,+#  H)63*<47<7@632/<13I    @>4.,7 ,=2,=0?!=409+ # HBAA3?473:2I  =,8,74E,-0?3%,D7:=+ # '$ H(B223<:F!/@A(B;;3?I   =,8,74E,-0?3%,D7:=+ #    H(=/>27@6I   :80/D$,77D407/ +"   H7<23?3::/"/>077=:B0#09I0*077B020= +"   ==9)=B?5/@; /A6=B@3)63(3?73@   

    H:3E/<23?I   4>?:=4.,7=,8,:749,==077 +#  H=<@A/D0,9@#00A0>#,.307(04>E +#  H?F,=:4I   49/D::?3 +"   %6/4%' +#  H)63!=<53@A-/?2I   /,8$,9/70=4%' +"  

  !3A6/:=@3   H:7<2/A3I  [email protected](4774> +"     H34 /;@=DA=3/%:/F3?I  477077,8D +#  H!=C3$0831AI   0>8:9/,==492?:9+# (:/;    "=<3F)/:9@ H7A16I   #:8,9.0:80/D(477$84?3 +"   D2'3>=?A3? H!=A!793!=C3I   >3?:9@?.30= +"      H!/F3?/93I      H3::0=FI   ,9?,>D#:9"0=78,9 +"   H)63=??B>A=?I  .?4:93:B)@9,?#4.):@92 +#  H3?=I   .?4:90?4+"  /<13@,=:C3@ C7DAB30Hk & "! %k4G?A4BBk!" Classifieds

JOBS JOBS JOBS JOBS JOBS

Acitivities Coordinator— Immediate opening for AUTO BODY PORTER—For Fairfax Area. Bookkeeper/Receptionist — Exp. helpful DRIVERS — A & B w/ TX endorsement. Suitland Md Financial an enthusiastic self starter w/ excellent organiza- 703-273-3976 but not reqd. Good English skills reqd. Familiar with based. Shift work. Benefits. 301-773-9009 ext. 13. STOCKBROKERS/FINANCIAL ADVISORS tional skills. Must be detail oriented & flexible. AUTO BODY TECH—For Fairfax Area. 703-273-3976 computer a must with min. knowledge of Word, Reputable multi-national brokerage firm in Reston, Proficiency in Microsoft Office Suite, Pinnacle Liq- Auto Glass Technician Excel a plus. Downtown DC locations near metro. DRIVERS/COURIERS VA is expanding. Needs talented Stockbrokers & uid, Adobe PhotoShop, Publisher prior use & knowl- That Glass Place, Inc. Good pay and benefits. Resume with salary BEST PAY IN TOWN PLUS Financial Advisors with existing books. High payout, edge of stereo equipment, mixers, mics, cameras, Needs exp’d /reliable glass tech for work in the No. requirements to [email protected] great perks & excellent working environment. recorders. Ability to edit footage a must. Previous DJ VA area, comp. pay, retirement plan 703-491-7557 GENEROUS FUEL HELP! Contact Jacques Thimothee at: 703-310-7689 experience preferred & degree in related field Cabinet Makers Rapidly growing premium delivery service needs FAX resume: 703-842-5351. preferrable. Clean criminal background is required. Millwork co. in Warrenton, VA seeks exper’d. & 8 couriers with cars, small trucks for local FUNDRAISING Please FAX resume & references to: 202-722-7125. AUTO SALES reliable Journeymen, Cabinetmakers/Millwork- deliveries. PAID WEEKLY! FT drivers can earn Capitol Hill fundraising firm representing America’s ers & Finishers. Exper req’d. Competitive pay & $700-$1300/week. NO DOWN TIME! JOIN THE top business and physician associations has 5 FT ACTIVISM benes. Pls CALL 540-347-4551, ext. 111 or EMAIL COMPANY THAT WILL MAKE YOU MORE MONEY! openings for Client Tel. Reps. Seeking well-spoken resume to: CALL TODAY, 703-683-3333. individuals interested in politics and current affairs [email protected] who have experience communicating with or selling DRIVERS PT / MAINTENANCE AIDES to the public. Great hourly pay and generous bonus DEFEAT THE CAREGIVER—Female Live-In needed for Bethesda City of Alexandria DARCARS is currently seeking energetic, career location. Must drive. CNA/GNA a plus. Domestic plan. Company-paid health benefits and leave. CALL Operate a passenger van to transport persons to & minded professionals to join our growing sales skills a must. Call Life Matters, 301-652-7212 202-546-0296 and FAX resume 202-546-3871 or REPUBLICANS team at locations in the DC area. Experience from designated locations, assist with recreation email [email protected] EOE not required - we will train! In addition to our City Federal Jobs activities. Monitor persons riding in the van be- $1400-$2200/Month aggressive pay plan, we offer: DC area. Hiring. Paid training. All Occupations. Call tween driving periods; maintain the van in a safe GOVERNMENT 202-521-1492 and sanitary condition. 1Yr. experience in operating ASSISTANT REGISTRAR I / II-City of Alexandria, VA Had enough of Bush and the • Health Insurance & 401K CLEANER - DRIVER a van or similar vehicle & completion of grade school Government, Provide information & instructions on Republicans? Work with Grassroots • Company Car For maid service, knowledge of DC streets, Must courses. Must posses a valid driver’s license. Pre- registration & election procedures to citizens. Enter Campaigns, Inc. on behalf of the • Paid Vacation have good refs. and driving record, M-F 7:30a-4p. ferred: 1Yr. supervising & leading activities for voting application data on the automated voter • $80K+ 1st yr earning potential 301-350-7000 youth, adults & seniors, first Aid/CPR, bilingual, registration system. Proof reports, prepare mailings, & National Democratic Party to elect • Rapid advancement CNA— Live in, weekends, must cook. At least 1 yr possess CDL. $12.71 - $14.30/HR. For more informa- maintain files. Work 16 hours on Election Day, 5am to Dems in ‘06 FT/Summer/Career exper. $85-$110/day. 301-306-1444. tion & to apply, visit www.alexandriava.gov EOE/AA 9pm. Must be a registered voter in the Commonwealth opps. Dupont Circle. CALL Erin at Apply in person, at DARCARS of Silver Spring CONTRACT SPECIALIST DRIVING/LIMO - CDL w/P of Virginia. Office & computer/data entry exp and 12214 Cherry Hill Road, Silver Spring, MD 20904 Temporary assignment. Exper. in govnt contracting PT eves & wknds. VA/DC/MD. $18-$20/hr. Spring- Bilingual (English/Spanish) preferred. $26,443 - $ 202-797-9655. (at of Rt. 29 and Cherry Hill Road). pref’d. Principles only. FAX resume ASAP: field 703-550-7200 31,449 (DOQ) REF# VTR-6-9902 Closes 07/28/06 by Contact Shannon Ryan at (301) 622-0020 or 301-559-2881. Dry Cleaner Sorter — Environmentally safe Dry 5pm. For more information and to apply, visit [email protected] for more info or to COUNSELORS/RECREATION—House Parent, sin- Cleaner. FT/PT, friendly, dependable. Alexandria www.alexandriava.gov or call 703-838-4485. EOE/AA Admin Asst/Bookkeeper schedule an interview. gle or couple for youth, free room & board + sal. & area. 703-998-6464 EXECUTIVE ASSISTANT Graphic Designer First Mount Vernon, an Alex Financial Srvcs. Co. AUTO benes. Will train. Fax resumes 301-562-9377 or call has an opening for an exper’d Admin Seeking Detailers with 1-2 yrs. exp. 301-562-9370 ext. 256. EOE. World Resources Institute (WRI), an environmental Local ad agency looking for graphic Asst/Bookkeeper w/ a min 5 yrs exper. Working Must have valid drivers license. Customer Service — Environmentally safe Dry think tank based in Wash, DC is seeking a temp. designer/production artist for full time front lines knowledge of common office software and good Please call 301-516-8322, 9a-5p. Cleaner/Clerk. FT/PT, friendly, dependable. Alexan- Executive Assistant to the CFO from July -Oct. The position that is very fast paced and deadline driven. written & verbal comm. skills helpful. This is not AUTO Service Manager & Mech. For busy Rock- dria area. 703-998-6464 position requires a polished, detailed-oriented, Quark, Indesign, Photoshop, Illustrator and all basic an entry level position. Please fax resume w/ ville station. Must have exper. Great pay & benefits! CUSTOMER SERVICE/ highly organized individual with excellent oral and studio skills a must. Web skills a bonus. Great work salary req to Kathleen, 703-823-4455 or email to Call 301-529-0990 written communication skills and strong computer environment, benefits, and free parking. Send [email protected]. SECURITY MONITOR skills (Word and PowerPoint). Candidate should resume and salary requirements to AUTOBODY TECH/HELPER have bachelor’s degree, 4-6 years previous exec. [email protected]. ADMIN ASST — Native Engl. spkg. French lang. a +. Needed for busy Due to recent acquisitions & expansion, Datawatch asst. exp. bkgrnd in acctg. Flexibility w/hrs,days, ft Hotel Very good typist & writer. Busy small immig. law Vienna, VA shop. Call Philip. 703-759-4327. Systems, Inc., a Bethesda-based national access vs.pt. Interested candidates please send cover Front Desk with Shuttle Driver Duties control co., has immediate openings for FT Moni- firm. Nr. Arl. Metro. Fax: 703-730-3775. Automotive letter, resume, and salary requirements to: World Hotel in Crystal City is currently seeking energetic, Tech / Mechanic tors. Detail-oriented individuals with customer ser- Resources Institute, Attn: Human Resources, 10 G responsible, service oriented team member. Must Administrative vice, telephone & data entry exper. req’d to excel in Street, NE #800, Washington, DC 20002, FAX: have valid Driver’s lic, computer savvy, and be able Busy shop needs motivated, quality oriented tech. central station. METRO accessible. Top wages & ADMIN/STAFF ASST. Top Pay depending on experience. NO WEEKENDS. 202-729-7610, Email: [email protected]. No phone calls to work flex schedule in your role as a front desk Administrative/Staff Assistant Full-time Admin- benes. Please EMAIL resume to: please. EOE. agent with shuttle driver duties. Salary commensu- Call for details 703.624.6971. rrambler@ datawatchsystems.com istrative/Staff Assistant for Downtown DC PR BANKING rate with exp. Apply in person or call Americana firm. Strong organization, multi-tasking and OR Fax: 301-718-7782. DCJS#11-2294 Executive Asst: National military nursing re- Hotel, 1400 Jefferson Davis Hwy, Arlington, VA computer skills, including proficiency in Micro- Tellers -- Now Hiring DANCERS— Wanted for Gentleman’s Club (PG search program seeks organized, mature, cus- 703-979-3772 soft Office Suite. Duties include answering Please visit our website at northwestfcu.org County). $300-$500/night. No exp. needed. tomer service-oriented team player. Candidates HOTEL phones, providing administrative support and BARBERS—Seat Pleasant MD, 240-286-3660 or 301-568-8500 should demonstrate excellent interpersonal, ad- Hospitality Temps Corporation has immediate work general assis- tance to staff. We offer a competi- MD license needed. ministrative, organizational, and oral/written for exp. tive salary, generous benefits and enjoyable 202-529-0451. DENTAL ASSISTANT communication skills, and ability to work inde- • Attendants (min. 6 mos. exp.) work environment. E-mail cover letter and re- PT Dental Asst. needed. pendently. Responsibilities include activities as- • Cooks (All Levels) sume to Beautician Exp’d. only. Please call 703-691-9740; or fax resume sociated with the administration, logistics, and • Cashiers [email protected] HAIRSTYLIST to: 703-691-9809. compliance requirements of research grant ap- • Service Coordinator Trainee DENTAL ASST plications. Access, Word, and Excel skills essen- Apply in person Tue thru Sat, 9am to 2pm with police Seeking licensed Hairstylist in Clinton, MD & tial. Exp with the military, databases, and Fed- Asst Director For busy, FUN pediatric office. 4 or 5 days. Full clearance, 2 ID’s, B/W, and references to 600 PA Ave. McLean, VA for a Retirement Home. Built in eral grants management a plus. Competitive SE, Rm. 105 WDC Needed for CDC in Annandale. Admin & class- clientele. Please call if interested 703-794-9419 benefits. FAX resume: 202-364-1386. DENTAL ASST/RECEPT salary and benefits. Convenient location at Silver room respon. BA in ECE or related field + 3yrs Spring metro. Send cover letter, resume, and teaching exp. Supervisory/admin exp. desirable. BEAUTY—Licensed Hairstylists, Barbers, Braiders & 2 yrs. min dental exp. Must be X-ray certif. Positions HOTEL—The Homewood Suites by Hilton in Nail Techs for salon in NE, DC. Call Steve at avail. in DC & MD. FAX resume to: 301-313-0207. salary history by email to TSNRP@palladian Alexandria is seeking outgoing and energetic Sal. low to mid 30s plus excel. benes. Email partners.com or fax to 301-650-8676. resume to [email protected] or fax to 202-497-0311. Dental Front Desk/ individuals for the FRONT DESK TEAM. This is a 703-256-2277. BEAUTY - MANICURIST Receptionist full time position with a wide range of benefits. For general dentist in DC near Metro. Customer FINANCIAL AID OFFICER Experience is preferred but not required. Candi- Exp’d Manicurist for upscale salon in Georgetown, dates should apply in person at 4850 Leesburg Attorney-Associate betw.M&NSts.CALL Nadia: 703-629-5452. service exp. pref’d. Must be hardworking & depend- able w/ good communication skills. Please leave Essential Functions and Pike, Alexandria. EOE BEAUTY—Nail Tech wanted. Manassas, VA. message 301-208-0782. Sought for small DC real estate litig. firm. 703-309-7470. Responsibilities: DC Bar req’d. Salary DOE. Respond to: PO Box Dental Hygienist HVAC 77681, WDC 20013 OR [email protected] Beauty/ Nail Tech—Upscale nail salon. • Provide financial aid counseling to 240-460-7670 Hygienist needed 4 days/week, temporary position. A top quality co. needs: ATTORNEY students and parents. Comm/Res Svc Techs/Inst Lic’d Spanish-speaking Settlement Attorney for VA BEAUTY - Perla Hair Salon Downtown high quality professional practice. Fax resumes to attn: Ms. Parks 202-833-2632 • Review and explain financial aid • Signing bonus up to $2K w/real estate exp. pref’d. EMAIL resume: New salon is looking for Stylist to work immediately. eligibility with parents and students. • Comms & tool bonus [email protected] CALL Persia, 301-748-8943. DRIVER-DUMP TRUCK • Health ins, vac/sick lv AUTOMOTIVE Beauty Salon Hiring - HAIR/NAILS Experienced. CDL & good driving record. • 125 plan, 401K w/match Exper Mechanic, ASE certified pref’d. D & D Tire Co, 202-439-8081. Education: • Advanced tech training Hyattsville, MD. Call Jay or John at 301-277-8565. Busy salon, professional environment, mall location. DRIVER — Earn $600-800/week FT, $9-14/hr PT. Call 301-324-5694 High school diploma or equivalent. Call 703 541-1006 AUTO TECH - SUMMER’S HERE! WE’RE BUSY! Driving for TakeOut Taxi, the area’s largest restau- Bachelor’s Degree preferred. Lindsay Ford of Wheaton has openings for General rant delivery service. Call 301-571-0111. HVAC Line Techs. AND Diesel Techs. We offer: Bookkeeping DRIVER — Exp’d. w/CDL. Good working conditions. Exper’d Installers and Trainees. Start Immed. Full 301-577-8639 Send resumes to: • 401K, Medical, Dental PART-TIME BOOK KEEPER time, Year round work. All benefits, commission, • Top Pay to the Right Candidates DRIVER — Floral deliv. event setup/breakdown. FT James Green, Director of Financial Aid holiday, & truck. CALL 301-881-4300 For Jewish Community Relations Council of & OT. Heavy lifting. 301-565-0020. [email protected] LABORERS / UTILITY LOCATORS If interested, please call Paul Boots, 301-949-4060. Greater Washington, Rockville. Full charge, 6-8 Auto hrs/week. Minimum 3 years exp. in non-profit DRIVER NAT’L UTILITY LOCATING FIRM ESTIMATOR/MANAGER environment. Proficiency in Quickbooks. BA in has FT/PT jobs open NOW for Entry Level or Experi- accounting preferred. Resumes to: Full time Driver. Must have CDL B Lic. w/P enced people. Some Travel Req’d. Great Salary & Loudoun Collision Center is hiring estimator/man- [email protected]. endorsement + airbrakes for transit co. Benefits. Valid DL, Drug Screen & Physical Req’d. ager. Good salary & benefits. Min. 3yrs exp. CALL No calls or faxes please. Pls. call Mr. Crittenden at 301-925-7957. EOE. Email letter & resume to 540-295-7324. [email protected] or FAX to (866) 615-2211 !#k4G?A4BBk & "! %kC7DAB30H Classifieds

NANNY Good pay & opportunity in McLean! M-F 8am- Restaurant Manager RECEPTIONIST PART-TIME SALES JOBS 6pm. Live in/out. Teaching exp pref’d. Ref req’d. An Odyssey Restaurant Manager is responsible for for Long & Foster’s #1 office. Call Anita at 703-346-0389. coordinating and executing a 4-course Fine Dining Great location in Bethesda, one half block from LEGAL ASSISTANT Nurses Service for up to 600 guests within very strict time Metro. Tysons Corner family law firm seeks F/T Legal Asst. CNA’s —needed immediately. Live in or Live out. frames while simultaneously providing the guests with Must have basic computer skills, pleasant phone Sal. comm. w/exper. FAX resume: 703-827-5545. Call Distinctive Home Care at 301-772-3245 the ultimate experience in Hospitality and manner and be able to multi-task. Account Manager Legal Assistant/Paralegal OFFICE ASST Entertainment. They are responsible for maintaining Hours: 2-7 p.m. Tues.-Fri. and 9 a.m.-1 p.m. Sat. Automotive Advertising proper cost controls. They must be able to accomplish Please fax resume to 301-951-2072 Reston trial practice law firm seeking dedicated this by training, managing and motivating staff Sell print advertising to automotive industry clients! Small DC (Conn. & K) actuarial firm seeking F/T Long & Foster Real Estate, Inc. is an Equal • Cultivate and grow existing business Legal Assistant/Paralegal w/ min 3 yrs exper & excel effectively. Opportunity Employer computer skills. References req’d. Email Office Asst. w/skills to do e-mail typing, document • Cold call and close new business organization, filing & other routine office activity. Job Duties • Outside Sales [email protected]. Shift Management Train, Manage and RECREATION/COUNSELORS—House Parent, sin- Must learn quickly, have excellent organizational gle or couple for youth, free room & board + sal. & • Sales presentations LEGAL ASSISTANT skills, be detail-oriented. Must possess strong com- Excute Detailed Motivate Staff • Account management Event Programs Execute 4-Course benes. Will train. Fax resumes 301-562-9377 or call puter skills w/proficiency in MS Word & Excel. 301-562-9370 ext. 256. EOE. • Consultative selling Silver Spring. ATTN Experienced litigation secretar- Salary: $28,500 or higher if skills warrant. Schedule, Fine Dining • Base plus incentive ies: Seeking a career boost? Apply now to our Self-starter. Hosp., med. benefits. CALL for inter- Payroll Purchasing Manage Cash Handling RESTAURANT Great benefits package with health insurance that highly-rated crim/civ lit firm. We offer reasonable view: Anna Smith, 202-785-5901. Procedures Baker & Cake Decorators begins immediately and a 401(k) matching! For more hours, aggressive pay ($30K-$60K), bens & training Job Requirements Tysons Corner area. Call 703-361-8983, leave msg information: www.washingtonjobs.com. package to attract and retain the best. Please apply Paramedics & RN’s (Mother Infant Care) and call will be returned. Local Military Bases Experience in High Computer Skills only if you have min. 1-yr litig exper, are smart, & Volume Experience in High Restaurant Send resume to: work efficiently. Fax 301-495-8815. www.mark- F/T Great Pay! Call 866-595-6505; Send Resume BREAKWELLS COFFEE, 900 M Street, NW [email protected] OR Fax: 305-438-1486. Strong Communication Volume [email protected] skatz.com Skills Looking for enthusiastic staff, all shifts. Good pay. Attn: AutoEXP/JT LOAN OFFICER Great coffee! Call Cindy at 202-289-4601. Part-time Ability to maintain ”grace Seeking experienced LOs w/ knowledge of Calyx. under pressure” RESTAURANT We are committed to diversity & promote a Excellent environment & commission. We train Open House for Event Staff drug-free environment. candidates new in industry. 877-556-9444 Please Submit Resume and Salary History SERVERS Day & Eve Shift Loan Officers The Window Place is looking for [email protected] Wknd/Late Night SALES Trained LO’s wanted. 50% split. Sterling VA. part-time promoters to work at home shows Please visit us at www.odyssey.com for company 571-212-1855 For the IHOP in Clinton, MD. Good pay. Apply in & other events around VA/DC/MD. history person: MACHINIST—Experienced Machinist wanted, F/T. Requirements: 8905 Woodyard Rd. Excellent pay & benefits. Springfield, VA. Clinton, MD 703-256-9550 Ability to work some evenings & weekends MAINTENANCE/HANDYMAN Excellent communication skills RETAIL MANAGER Dumfries, VA. Apt. turnover & renov. Sal. negotiable. High-energy personality ADVERTISING REP Fax resume: 703-821-0133. Reliable transportation Upscale custom jewelry design store in downtown Frederick, MD is looking for a FT (Tues-Sat) Gallery PART-TIME Join us Sunday, July 16 from 10am-2pm at our Maintenance RETAIL SALES Manager. Must be articulate, computer literate & 15 or 16 hrs/wk - phone sales. Join our advertising sales Fairfax showroom, 2814-A Merrilee Dr, Fairfax, willing to go the extra mile. Artistic & marketing SERVICE TECHNICIANS APPLIANCES — $12/hr+. team! Assess client needs and sell advertising space VA. Bring your resume & come prepared for an background a must. Email resume to: Home Properties is the 6th largest owner & Bonus. Professional Position. Will train. Not based on budget and target market. Inbound call on-site interview. Positions pay between Metro acc. Transp. req. Springfld. 703-569-5014. [email protected] manager of apt. communities. We currently $13-$15/hour. 703-675-2036 center. Communicate product options and value. have openings in Slvr Spg MD & Alexandria VA. RETAIL Retail Upsell and cross-sell. Base plus commission. Great Service Technicians with 3-4 yrs of hands-on PHOTOGRAPHER-SCHOOL entry-level sales experience! Daytime hours. Requires maintenance experience in plumbing, electrical, Juan Valdez Cafe is seeking team members for our Sales great phone speaking and influencing skills, and typing carpentry, HVAC, & more needed. CFC certifica- new locations! min 40 wpm. tion a plus. We offer great benefits, competitive Lifetouch National School Studio, the nation’s leader Design Consultants in school photography, is now hiring Seasonal pay, free apartment for some positions & oppor- If you are outgoing, love coffee, and have a passion Due to an increase in business, Thomasville Furniture is For more information: tunities for advancement. Please fax resume to School Photographers. Work: FT, Sept. - Nov. and looking for career minded, success oriented profes- Feb. - May. Have summers and winter break off. We for success, we are interested in meeting you. www.washingtonjobs.com 703-370-7368 or email to TommyRa@homepro- Competitive pay, friendly people, generous benefits, sionals. If you have the ability, the skill set, and the perties.com will train & provide equipment. Must have reliable desire to achieve great results, then we want to talk to Send resume to: transportation & the ability to make kids smile. CALL growth opportunities, and the richest coffee in the world! you. We offer the environment, the tools and training, [email protected] MARKETING Company 703-968-7545 , ext. 33. and an excellent compensation and benefits package Attn: HR/1516EXP/JT. 10 F/T positions avail. PHYSICAL THERAPIST Stop in to fill out an application: including a 401 program. Call our store manager, A. M-F,8-5, Must love people, music, travel and $$. For outpatient clinic in Fairfax. Hirsch at (703) 706-0966 to arrange for an interview. We are committed to diversity & promote Do you want to have fun & make $800-$1000/wk? a drug-free environment. FT with benefits. Please fax resume to: 1889 F Street, NW Thomasville Furniture CALL today, start tomorrow. 703-212-7525. 703-204-4630. OAS Building, 1st. Floor MECHANIC 3915 Jefferson Davis Highway Washington, DC 20006 Alexandria, VA 22305 Limo repair. Must know AC & Electrical. springfield PHYSICAL THERAPY 202 464 1360 SALES VA area. Includes benefits & health insurance. EOE 703-550-7200 FT, PT & PRN physical therapists & PTA needed for 675 E ST NW Travel Agents needed. MEDIA BUYER our Gainesville & NoVA clinics. Excellent pay. Flex. Washington, DC 20004-2238 hrs. Great benefits. Positions available immediately! 202 464 5540 Work from home. No exp nec. Call 301-352-7330. Change Your Life Old Town ad agency seeks highly motivated Media New Grads Welcome. Please FAX resume: Buyer with a minimum of 3 years experience in 571-248-8191. Not Just Your Job! multi-market print/outdoor planning and buying; internet and broadcast buying a plus. Knowledge of PLUMBERS Join us now, get trained & make $4K-$6K per month. STRATA print software as well as Tapscan also a We Offer: plus. Must have strong computer and organizational Commercial contractor seeks reliable individuals for • Paid training skills and be able to hit the ground running. We offer FT employment in NoVA. 10 yrs. exper. Good • $400 per week salary a great benefits package and a fun working environ- Benefits, Top Pay. CALL 703-335-2677 • Up to 40% Commission for experienced Salespeople ment. Email or fax your resume to Property Manager— Dumfries, VA. 5 yrs. multi- • Full benefits package [email protected]; Fax: (703) 836-9267 family exp. min. Sal. negotiable. Fax resumes: If you’re looking for the ability to put your ideas to MEDICAL OFFICE MANAGER 703-734-8594. work, we’re the company for you! For orthopedic practice in Laurel. MUST have CBSI RADIOLOGY exper. FAX resume: 301-776-1548; CALL Shady Grove Radiology is now hiring for the Candidates must: 240-899-7399. following FT positions: • Have a Valid Drivers License Mental Health • MRI Technologist • Be at least 21 years or older REHABILITATION DIRECTOR • Mammographer • Be able to work long hours • Diagnostic Technologist (new grads may apply) • Must have a neat appearance MA Deg. in Human Service field, 3 yrs exp. in Psych • Ultrasonographer (RDMF only) • Have very good communication skills Rehab. w/one year superv. exp. Strong writing skills, We have state-of-the-art technology, pleasant work Call us today for an interview knowledge of residential and day rehab progams. environment, sign-on bonus, & continuing educ Pohanka Automotive Group-Temple Hills, Maryland. ASL skills preferred. Fax resume J. Grinnell reimbursement. Must have ARRT & current MD lic. 301-899-7800 301-918-9758. EOE. Exp candidates pref’d. Exc salary/benes. Please fax MENTAL HEALTH resume to 301-590-8961 or [email protected] Therapist Radiology SALES X-Ray Technologist LCSW-C or LCPC. To see deaf clients on the Eastern Shore. Must be fluent in ASL. FAX resume w/cover Well established orthopedic practice in the DC letter & salary reqs. to: J. Grinnell, 301-918-9758. metropolitan area seeking X-Ray Technologist, Reg- EOE. istered or Certified. Varied duties. Management Inside Sales/ potential. FAX resume: 301-567-2618, Attn: Lee. Business Development MENTAL HEALTH REAL EST. TITLE PROCESSOR Residential Counselors Sell online employment advertising to employers across Exp’d. Maryland Title Processor. EMAIL resume to: Exper w/ adults w/ Chronic Mental Illness pref. all industries! Target potential advertisers, develop [email protected] leads, prospect, cold call and close new business over Must have valid drivers lic. and good driving REAL ESTATE recd. Fax resume K. Almond 301-918-9758. EOE. the phone. Competitive sales incentive! Seeking sales Greenbelt settlement office needs exper Processor hunters for multiple opportunities on The Post Jobs MORTGAGE LOAN OFFICER in purchases & refinances. E-fax resume to Advertising Team. Applicants with recruitment, Seeking experienced Los. Excellent work environ- 301-576-5406. advertising, and/or phone sales experience ment & commission. We offer training to candidates RESTAURANT MANAGERS encouraged to apply! Great benefits package with new in industry. First Metro Mortgage 877-556-9444 For growing rest. DC/MD/VA. $38-$85K. health insurance effective immediately and a 401(k) 800-351-7557 FAX 800-208-0633 with matching program! MORTGAGE LOAN OFFICERS EMAIL: [email protected] RESTAURANT For more information: www.washingtonjobs.com Benchmark Mortgage Inc., one of Maryland’s hottest mortgage companies, is growing. We • Line Cooks Send resume to: need Loan Officers. Find out for yourself. Listen • Shift Manager [email protected] to 1450/1010 AM Saturdays 8-9am & 10-11am. • Bartenders Attn: HR/MMEXP/JT The way the mortgage business should be. Be on • Servers a winning team! Great commission & draw We are committed to diversity & promote a schedule available. Call 1-877-617-2800 or Great $$. FT/PT. Apply in person at: 1520 K St NW, drug-free environment. 301-617-2800. Wash, DC 20005. SALES MORTGAGE Loan Officers needed for mortgage business. Will restaurant train. High earning potential. Serious inquiries need National lender looking for exper’d. Loan Processor apply. Call: 301-595-0500. to start immediately. Great compensation package Sales & benefits. FAX resumes to: 1-888-527-8408. Looking for enthusiastic, energetic people with MORTGAGE positive attitudes to cover our pre-set, pre-qualified National lender has net branch opportunities avail- appts. Multi-million $ company with exclusive prod- able for Seasoned Loan Officer looking to start their Career Fair ucts. Must have in-home exp. and dependable vehicle, Monthly bonuses, and benefits. 1st year own business. Great compensation & benefits pack- Looking for restaurant professionals; bring approx. income $60-80k. Please call Andy Wildman age. CALL for inquiries, 703-760-2002 or send re- resume; on the spot interviews; experience an at 1-888-666-6414 Ext. 107 or fax Resume to sumes to: [email protected] asset, but all candidates will be considered. 301-333-7311 Attn: Jessica. MORTGAGES Elephant & Castle Loan originators for a mortgage broker. Loan officer 1201 Pennsylvania Avenue, NW exp. pref’d. Calyx point a must. F/T. Sal + comm. Fx 202-347-7707 301-362-1227 NANNIES — MD/VA/DC. Many positions avail! Call: Career Fair Hours: 703-922-5004. Wed. July 12, 2:00pm-7:00pm www.incareplacements.com Thurs. July 13, 2:00pm-7:00pm C7DAB30Hk & "! %k4G?A4BBk!$ Classifieds

Social Services Writers Group JOBS Immediate openings in a Medicaid Day Program for A new career! Career training in Adults with intellectual disabilities. Must have out- Client Services Coordinator at standing interpersonal skills, excellent written & communication skills. Candidates should be enthu- Criminal Justice! SALES Get career training siastic self-starters, have excellent organizational Tremendous growth opportunity for candidate will- skills, and be detail-oriented. Must be proficient in ing to work hard, learn new skills and become an Microsoft Office Suites. The openings are as follows: important part of a dynamic editorial and sales • SOCIAL SERVICE ASST. — requires a min. of 3 yrs. operation. The Washington Post Writers Group in Criminal Justice! Westwood College exper. in the field, case management pref. Must (www.postwritersgroup.com), the syndication arm Outside Account Manager, Education and have a degree in social work. (BSW). of The Washington Post, seeks a team player with Animation or Design. Financial Services Jobs Advertising • ACTIVE TREATMENT SPECIALIST/ PROGRAM exceptional phone skills and experience with Excel, can help you prepare ASST. — requires a min of 1 yr. exper. working with Adobe Photoshop and QuarkXpress to handle cus- Let MR/DD population. BA in a related field pref’d. tomer service and provide admin support for a for a future in one Manage all existing and potential clients in education 4-person sales team. and financial services to sell print and online recruitment • CERTIFIED FITNESS INSTRUCTOR — advertising. Develop new products/initiatives; tactical Certification is a must. Exper. working with MR/DD For more info: www.washingtonjobs.com. Westwood College of today’s most and strategic; analyze clients’ marketing needs and population pref’d. Must have CPR certification at Qualified candidates should send a cover letter, multi-media presentations. Requires ability to time of hire. resume and salary requirements to: The show you how! exciting career fields develop relationships outside of typical media buying • SPECIAL PROGRAM ASSISTANT — Requires a Washington Post, Attn: HR/WG-CSC/JL, 1150 15th chain to facilitate sale, and prospect for and close new min of 3yrs of admin. exper. at an executive level. Street, NW, Washington, DC 20071, Fax (202) Get the training business. Base salary plus uncapped incentive! Microsoft Suite is required. Must have web page 912-3677, TalentSearch@ washpost.com 1-866-811-6459 www.washingtonjobs.com. Send resume to: exper., letter composition, proof reading skills & [email protected] Attn: HR/JobsEXP/JT you need for active treatment documentation. Must be flexible. CAREER TRAINING AND Not all programs We are committed to diversity & promote EMPLOYMENT SERVICES a drug-free environment. • PROGRAM AIDE— Implementation of the a new start. activities of daily living (ADL) schedule for assigned offered at all SECRETARY/RECEPTIONIST clients. Monitoring & assisting assigned clients with changing & feeding. campuses. Silver Spring. Requires Bilingual Spanish. Minimum 1-866-811-6459 1-year office experience required. Excellent pay & Current TB test & background check req’d. EOE. benefits. Exciting work & reasonable hours Competitive salary & excellent benefits. Please fax w/highly-rated newsmaking lawyers. See resume & references to: (202) 832-2474. markskatz.com. FAX: 301-495-8815. Telemarketers www.westwood.edu www.westwood.edu Looking for exp’d TELEMARKETERS. Earn $8-12/hr. SECURITY - ARMED SPOs Eve. PT avail. MORTGAGE LOAN PRICER. Up to 35% Various DC premiere locations. Must possess valid commiss. Please call 301-776-0030. DC Armed Commission. Min. 5 yrs. exper. No Exceptions. Must pass background check and have TELEMARKETING good work ethics, team player. CALL M-F, 10AM- Earn up to $25/hr. NOVO1 is looking for highly 2PM, 202-293-8011 or FAX resume: 202-293-1095. skilled, exper’d inside sales reps to market for DC Lic 0444 Fortune 100 co. FT/PT. Great working environment, Security Guards— PT on-call Sec Grds needed for Laurel, MD. Call 301-361-1111, ask for Mark. special events. Must be 21. Weekly pay. Fax res to: TRAVEL AGENT 301-265-9866, on-line apply. www.ppssvc.com, Exp. SABRE agents for No. Va. & DC. Good pay with or apply in person 1050 17th St NW suite 600 Wash, bonus, benefits for self-starter. DC. 20036 Between 9AM-4PM. Fax resume: 1-877-839-5247. SECURITY GUARDS VOLUNTEERS NEEDED Men and women with type 2 diabetes mellitus, with For various DC & VA premiere locations. All shifts. protein in the urine for research trial of an investiga- FT/PT. Must have min. 1 yr. exper. w/proof. Good tional new drug that may reduce urinary protein. work ethic. Computer knowledge a plus. $8-$13/ Travel honorarium provided. hour. CALL M-F, 10AM-2PM, 202-293-8011 or FAX Call 202-296-0670 ext 238. resume: 202-293-1095. DC Lic 0444; VA Lic 11-2468 WAREHOUSE/TRUCK HELPERS/LABORERS Security Officer Apply today, work tomorrow! 46 immed openings for Warehouse/Truck Helpers/Laborers on day and Miles Protective Agency seeking Security Officer. No night shifts. Positions located in DC Metro area. exp. necess. starting $9.50/hr. 301-675-9470. Apply in person Mon-Wed., 10am sharp, at Crosby SERVICE TECHNICIANS — Balt/Wash Area. Will Corporation, 835 Bonifant St., Silver Spring, MD. train to refinish bathtubs. Excellent work ethics & reliable vehicle req’d. Fax resume to 301-490-6063 & call 866-604-9501 to schedule interview. Stock Person/Liquor—FT 202-889-1500/889-1623 TEACHERS PRE-SCHOOL TEACHERS Consider a small school with a personal profes- sional approach. We have PT/FT pos. for Teachers for 2-5 y.o. ECE or certif. & 3 consec. yrs. of successful teaching pref’d. Fax res. to: Olga Lloyde, 703-323-6369; or call: The Mark of Excellence Preschool at: 703-323-0165. www.markpreschool.com

SPECIAL EDUCATION St. Coletta of Greater Washington is a state of the art special education facility serving school-age children and adults with mental retardation, autism and secondary disabilities. As we prepare to open our new facility in Washington DC for the 2006-2007 school year we are actively recruiting for:

• Special Education Teachers— Must be certified in Special Education and endorsed (MR) or willing to pursue certification. Experience with project-based learning and multiple intelligences theory a plus.

• Physical Therapists— Must be licensed or capable of being licensed in State of Virginia and Washington, D.C. Experience with Special Needs population a plus.

• Occupational Therapists — Must be licensed or capable of being licensed in State of Virginia and Washington, D.C. Experience with Special Needs population a plus. Currently within walking distance of King Street METRO, our new school will be directly opposite the Stadium/Armory METRO exit on Independence Avenue, SE. We offer top competitive salaries and excellent benefits. Learn more about us and our new school at www.stcoletta.org Mail resume to: St. Coletta of Greater Washington, 207 S. Peyton Street, Alexandria, VA 22314; fax: 703-683-9888; [email protected] No calls please. EOE

A Bar Career In 1-2 Weeks • Days, Evenings & Weekend Classes • Free Lifetime Personalized Job Placement • Approved by the State of MD • National Alcohol Awareness Certificate (T.I.P.S.) Call for nearest location 1-866-411-2MIX www.authenticbartending.com Become PC Repair TECH Eve/Wknds! Other Courses Avail 301-942-8724 / CALLitEXPERT.com !%k4G?A4BBk & "! %kC7DAB30H Classifieds

BEAUTY SALON—3 chairs, manicure, pedicure & French Bulldog Puppies—puppiestogoodhomes.- Alexandria/Old Town EHO CENTREVILLE— 3BR/2½BA TH. Avl now. Great CAREER TRAINING AND massage room. For more info call: 571-216-0796 or com F’Burg VA Pied M/F Vet Chk’d, S/W $1500 Monticello-Lee Apts amenities incl. pool, balcony, $1700. Jobin Realty EMPLOYMENT SERVICES 703-440-0097 540.972.6808 Experience the Charm of Old Town 703-628-3217 ENTREPENUERS GOLDEN DOODLES—F1B, the ultimate dog. Ready Effics from $939 CLARKSBURG Itunes meets MySpace 7/28. Adorable!! Call for website, 540-667-2525 1BRs $1203 RENT TO OWN/BAD CREDIT OK www.newdigitalinvestors.com HIMALAYAN—Retirees. Bayed. Neutered. Loving. Call 888-524-2167 SFH. Renovated inside. 3BR, 1½BA, View commercial and call 202-716-9132 All shots. Will deliver. $150. Call 703-455-2665 . ANNANDALE — M/F to shr 3BR TH, next to 495 & 13108 Suncrest Ave. 301-528-2265. HOMEOWNERS IN TROUBLE!!—There is a solution! JACK RUSSELL TERR PUPS—AKC, 2 Ms, 2 Fs. Great NOVA. Lge bsmt rm w/pvt BA, shr Kitc, prkg, pool, COLLEGE PARK—1BR, grdn style apt, within an Visit www.FromDebt2Saving.com or call Wesley markings. S/W, vet chkd. $450 ea. Call W/D, DW, $750 + 1/4 utils. 202-431-2494. easy wlkng dist of Univ of MD & Metro. All utils incl. Howard 301-789-1629. 240-308-0452. APPLE GROVE—4 BR, 2 BA, 1 car gar, w/d, d/w, 1BR-$850. Call JE Smith Corp. for more details VENDING BUSINESS—leaving area. Need to sell JULY AQUARIUM MEGA-SALE! 75 gal tank starting $1,800/m 301-395-6616. 202-582-8824. Wknds, call Vic 202-489-7040. profitable home based part time vending business $89.99. 180 gal tank starting $409.99. Setup too! ARL N—Lovely Lg 1BR, balc new carp, very clean, COLLEGE PARK/METRO—Unfurn’d Room. High in Alexandria VA. 5-10 Hours per week. Revenue Full listing at: www.scales-tfw.com SCALES Tropical new paint $1250 utl incl Good loc 703-379-9880 Speed Internet. HBO. refrig. micrw. ac. w/d. NS. 1000/m. 703-567-0420. Fish Warehouse, 744 Cloverly St, Sil Spg., Md. 20905 Arlington—New, Deluxe 1BR, & pkg. 2 blks to $600 utils incl. 301-254-7385 WE HAVE DONE THE IMPOSSIBLE 301-384-7839 metro, premier bldg. Courthouse area. Furn. or Denied an apartment due to credit? We can All situations considered. We save homes from LAB PUPS—All colors, shots, wormed, $175 & up. unfurn. $1800-2200. Dean Hastie 703-941-7364 RE/ help! 301-306-0175. foreclosure, bankruptcies & payoff high debt. Call Sire has all clearances 804-633-3358. MAX Allegiance www.eliasconsultinggroup.com 240-314-0319. LABS—AKC, Beaut. 1 shots/ dewormed, Yellow, Blk, Arlington/Rosslyn Several Locations DERWOOD—3BR, 2+2BA TH, fin. bsmt, new cpt- M/F,$500, 301-535-6052 or 301-645-2635 On-Site Parking, Walk Metro paint-flrs, w/yard. Walk to Shady Grove. Avail. 7/25. PAPILLON POM PUPS—M & F, 9 wks old, Black w/ $1500/mo. 301-448-5582 STUFF White chest. Will be small adults. Call 703-421-8385 Upgraded Apts, 1&2BRs 703-671-4045 or 703-861-7605 POODLE PUPS—Standard, 7 wks, s & w, vet- DIS HTS— Beautiful 2BR 1FBA condo, $1150 + elec, www.carydale.com close to shppg, avail now, Section 8 OK. 8PC-Cherry sleighbed set, new in boxes, $565- checked, raised w/ kids. $550 F, $500 M. 540-946-8500 AUBURN VILLAGE—Lg 1BR condo, mny closets, 703-508-2139 val $1100 301-343-8630 CAC, Nr Cryst. City & Old Town. $1,000. DONT LET CREDIT STOP YOU FROM RENTING Alexandria—Huge Sale: 22306, 7/15 Sat 8-2pm PUG PUPPIES— AKC Fawn, S&W. Adorable, very friendly, health guar. $500. 804-694-0575 703-548-7311 —Call 301-515-7760 Clayborne Ave (Rt 1 So. Beacon Hill) 7/16 rain dt; BELTSTV—3BR endunit TH, 2.5BA, fully fin w/o FAIRFAX/BURKE $2650 Crime Scene Variety of items new, antique, furn, clths, collect, sm ROTTWEILER PUPPIES—Shots, wormed, AKC, par- ents on premises, German. $800. 240-508-0585 bsmt, jaczzi, frpl & rec. lghtng. $1900+utls. 2 lvl. brk ramb, 5BR + den, 3.5 BA, hdw fl, 1-car gar., appl, jwlry, hshld. 301-931-1787 Investigator Training ROTTWEILER PUPS—2 F’s $650 each. Call Jen new kit. cabinets, new cpt. Owner/Agent. Sec. 8 ok. BD $129 Qn Double pillowtop matt set new in BETHESDA—3BR 2BA brick Col. Walk to d’twn. w/d. Re/max Premier 703 929-5680 Enhance your current CSI skills or train plastic Can del 301-399-7870 301-669-9607, 301-674-2106 SHIH/TZU PUPS—ACA, M/F, solid brindle, bl/wh, fpl. lge yard & deck. $2150/mo. Call 202-468-2716 FAIRFAX—Huge 1 & 2BR apts avail. on bus line for a CSI career. Course will be held July BD $240 Double pllwtop king matt set New in BETHESDA—3BR, 3BA TH, DR, fam rm, patio. Near serving Metro. Plenty of parking, fitness center & plasticCan del 301-343-8630 s/w, $600 540-582-5552. 31-Aug. 4, 2006 in Chesapeake, VA. ST BERNARD—AKC puppies, wormed, dew clawed, NIH, Metro, I-270 & 495. $1960/mo. 301-652-5411 pool. Call 703-968-7900 Instructor is a Forensic Science Acad- BEDS shots, vet checked, reg. parents on farm. BETHESDA—Newly remod. 1 BRs fr $1345. 2BRs fr FALLS CH CITY—Charming 3BR 2BA + Den, detach $475. 1- 717-359-9687 $1660. Incls. utils & prkg. Avail. Aug, Sept, Oct. Near grg, front porch, lrg yd, CAC, w/d, wonderful emy Graduate and is DCJS Certified. Used in Great Condition Metro, NIH, shops. No pets. 301-656-1306 For course tuition or more info call QUEEN SETS $129 schools, avl 8/1. $2300. 703-534-5351 EQUAL HOUSING BETHESDA PARK —3-BR 1½-BA, spac. condo, balc., FALLS CHURCH/LAF PARK—1BR den, new w2w, 336-368-9500 or register online MD 301.324.8684 301.468.6443 exc. schls., pool, Utils incl. Nr Metro. $1695. DW, balcony, utils incld on Route 7 nr Seven Corners. www.securityinstruction.com 301-717-9445 $1,250/mo. Avail now. Jobin Realty, 703-856-4533 BALTIMORE 410.719.6922 OPPORTUNITY BOWIE—3BR/2½BA, Fin’d Bsmnt, 1Car gar. $2100/ VA 703.818.2678 703.354.2600 FFX/N Spgfld—3lvl 4BR/3BA SFH, full bsmt with Loan Officer-Training Class mo+Utls. 301-346-4083 walk out incl sun deck, plenty of parking. $2200/mo, Earn more than $100K 1st yr. Class start 7/24 Lmtd CORT FURNITURE All advertisements for the sale or BOWIE—3BR/2BA. Fam Rm. 2-car gar. Never Avail. Now. Jobin Rlty 703-628-3217 seating $175. 301-384-1200. namcmortgage.com BIG & TALL DRESS SHIRTS—$25.99 MADE TO rental of dwelling units published in rented, like new! 2yr lse. N/P. Bring Credit Report. FOG BTM—Lg BR, Metro, GW, new kit, $1750 inc utl. MEASURE - 100% Pure Egyptian Cotton Dress Shirts $1800 + sec. 301-262-7544 7/5. 703-323-6704 Prepare for a new life! made to your measurements - BIG AND TALL - ANY Express are subject to the federal BOWIE—Beautiful TH totally new, 4BR, 3.5BA, 3lvls. Good for sharing. 240-491-6337 or 240-472-0737 GAITH—Brand new lux TH. 2BR/2FBA/2HBA. Rec Make a difference, SIZE - SAME PRICE and 100% Egyptian Cotton Men’s Fair Housing Act, which makes it rm. 2-car gar. Walk to Lake Forest Mall! Nr Metro, even with the little ones Underwear Please visit our ebay store: Samarausa/ illegal to advertise “any preference, BOWIE: Rent To Own $1850 355 & I-270. Only $1900/mo; lowest in the commu- fine egyptian products SFH Col - 5BR/2½BA/$5K to move in nity (w/pool)! 301-922-1328 - GREAT VALUE! as an Ultrasound Technician. BURKE — Sat, July 15, starts at 9am-2pm. (6602 limitation, or discrimination be- Knowledge Ln 301-996-6077 GAITHERSBURG—2BR 1BA, w/w, w/d, FPL, Bal- Train in less time than you think! Degen Dr - off Ironmaster Rd.). Furn., TVs, clothing, dance-wear & costumes & more. cause of race, color, religion, sex, BRANDYWINE—$1700/mo. 4BR, 3FBA, LR, Din/Kit, cony, Nr Rio, Kentlands, 270. $1100/mo. 202-329-4627 Career services available Canon Eos 30D—New, camera, sealed in the box, handicap, familial status or national gar, remod bsmt w/sep entr, 8208 Heatherwick Dr. accesories included. Email to ingeexchange@ya- call 1-866-Rolanda GEORGETOWN —Effcy. walk to Wisc & Geotwn U, Financial Aid for those who qualify. origin, or intention to make any full kit walk in clst, lndry, $1350+ shr uts. No Pets, 1yr Training includes an externship! hoo.com for details. BROOKLAND—Walk dist to Metro & CU Univ., 1BR CARPET SALE— Starting at $1.59/s.f. Hardwood such preference, limitation, or dis- $850+ utils. Avail 8/1. 202-210-7938/202-483-0082 lse. 713-614-0223 or 301-657-1412 For a Brochure, floors, $6.99/s.f. Price includes installation. CAP HGTS—Beaut. spac. 3BR, 2½ ba TH, w-w cpt GERMANTOWN—TH, 3-lvls, 2 MBR’s on upper level 301-341-2499 crimination.” State law forbids dis- w/fully fin. bsmt. Conv. to Metro, 495, AAFB & DC. (each w/own BA), finished basement (in-law apt.) call now! 888-771-2433 Couch+l/s+chr, microfiber Brnd new never used crimination based on factors in $1700. Avail. immed. 703-731-0107 $1800. 301-252-8480 Sanford-Brown Institute still in crates take $575. 3/343-8630. addition to those protected under Dell 9300 Laptop NEW—1.73GHZ, 80GB HD, Intel 8401 Corporate Dr. Ste 500 Pentium M Centrino, 17” Screen, Wireless, XP Pro. federal law. Landover, MD 20785 Warranty. Two available $1,299 EA OBO. [email protected] 703-403-0190 Express will not knowingly ac- FURNITURE—All wood kitchen set, full sz canopy cept any advertising for real TRAIN FOR A CAREER IN bed (no mattress), light Pine coffee tbl, 2 kitchchen HOMELAND SECURITY tbls., exer. equip., other items. 301-460-1898 estate which is in violation of AT EVEREST COLLEGE LOST - Brown shppng bag w/items inside, ‘Old the law. All persons are hereby Towne ‘ on outside. Lost outside Spgfld informed that all dwellings ad- Graduate in less time than you think! Metro St. 301-602-1986 MATTRESS SALE— lge selection, all szs in plastic, vertised are available on an Tysons Corner Campus $80-$280/Basic, Serta & Simmons. Make ofr Credit equal opportunity basis. 1430 Spring Hill Road, Suite 200 cards accepted. Warr. DC/MD/VA Same Day Delivery avl. A.J. 301-674-2843 www.mattress4less.biz McLean, VA 22102 NW DC—Huge Church Yard Sale July 8th, 9AM - 3PM350516thSt Arlington Campus REDSKINS SEASON TICKETS—4 club level seats, 801 N Quincy, Suite 500 club admit, 1 orange park pass, 8 games + 2 Arlington, VA 22203 preseason. $8400. 804-908-5220. SIL SPG—RECORDS, 25,000 LP’s, jazz, rock, soul, u CALL: 866-300-9344 country, classical, opera, & soundtracks. 9909 Dallas Ave. Sun. 7/16, 9am-2pm. No earlybirds Adkey NPEX625E SOUTH RIDING—Sat 7/15 (Rain 7/16) 9am-3pm. BR set, Electronics, Toys, Picture Books, Girls& Womens RENTALS Clothes+more. 25437 Beresford Dr, 1 blk S of Center TRAIN TO BECOME A St, 1 blk W of Loudoun Co. Pkwy MEDICAL ASSISTANT Toro Lawn Tractor—Wheel Horse 520 Hydro 60” 195 35th ST—1 BR 1BA Hardwood floors Deck, 152 hours. $1,500, 301-906-2526. $700-301-758-1062 IN LESS TIME THAN ALEX $850-$1150 Longview Terrace. 1 & 2BR newly renov apts in YOU THINK TICKETS nice & quiet commty, nr metro, ww, ceiling fans, Three locations to choose from! a/c, dw, patio, balc, prkg. Call 571-245-6502 ALEX/Cameron Station $710,000 NATIONALS*WIZARDS*ORIOLES REDUCED TO SELL! Recently renovated 4 lvl, 4 BR, Everest College Arlington Campus BUFFETT*MCGRAW*PEARL JAM 801 N Quincy, Suite 500 3½ BA TH w/LL custom study, 2 car gar. Free Metro Arlington, VA 22203 301-985-6250 shuttle. Call Patrice 703-731-4829 www.greatseats.com RE/MAX Preferred Properties ALEX/KINGSTOWNE—Newer 3BR/2BA condo w/ Everest College Tysons Campus fplc, balcony & free 2-car pkg. $1650/mo. 1430 Spring Hill Road, Suite 200 PETS 319-651-3083 ALEX/LANDMARK—2BR, 2BA condo, W/D. $1400. McLean, VA 22102 703-604-9634 ADOPT A Cat/Kitten—Sun 12-3pm, Springfield ALEX—Lg 1 BR 1½ BA, duplex up/ds w/balc, new Everest Institute Silver Spring Campus Petsmart, 703-922-4990. www.animalallies.com cab, kitch appl, 14th flr, $1200/m. Fountains Condo- 8757 Georgia Avenue BEAGLE—Female, 16 mo, nice family dog, very minium. 703-916-8570. Silver Spring, MD 20910 friendly. 204-375-0329. ALEX/OLD TOWN—TH, 1½ blks fr King St. Metro. BEAGLE PUPS— Tri-Color. M/F. Shots & wormed. CAC, 1BR+1 small computer rm, encl back yd, small $200. 540-582-5552 pet ok. $1400. 571-263-9940. CALL: 866-255-6621 ALEX/OLD TOWN—2BR, 2 BA condo, W/D end unit, Adkey NPEX627G BEARDED COLLIE PUPPIES— AKC reg. 2 Blk & Wht Fs. Ready for homes. Call 410-867-3813 1 blk from Metro. Secure bldg, gar pkg. $1750 incl. CANE CORSO PUPS—10 wks. ICCF reg. Lg boned. everything. Owner is lic Realtor. 703-967-5420 Blues & Blacks. 703-924-3573 POSITIONS WANTED Parents on prem. $600. Must see! 804-347-2600 ALEX— RENT TO OWN. Brand new 3BR, 2½BA TH. Chihuahua—3-male adorable, happy regis. S&W Low down $2,100 per mo. All credit ok. $550 540-878-9523 202-957-4432. NURSING ASST—Private duty care (24 hrs) & gen- ALEX S—SFH 3BR 1BA CAC w/d n/s no pets. $1475. eral cleaning. 301-350-1905 Chinese Shar-Pei—AKC registered home raised puppies for sale to approved homes. 703-898-3393 703-360-5885 BUSINESS AND DOBERMAN PUPPIES,Black-tan, Absolute pure- Alexandria City/Rt 1 bred, family raised, guaranteed health, Males $400, Highrise, Garden Apts & Twnhms FINANCIAL OPPORTUNITIES Females $450.00 703-349-6726 Numerous Amenities! DOBERMAN PUPS— AKC, Ch. Ped., old bloodlines, ARE YOU HAVING TROUBLE M/F, black, rust. red, rust. Shots & wormed, out- *SPECIAL GETTING APPROVED? standing. $600 up. Call 540-582-5552 Move-in by 8/1/06 Residential, commercial, construction and re- DOGS/POODLES—8 WEEKS OLD. 1st shots given. $275 Move-in Credit hab loans. Bankruptcy, low credit scores, and Black. 2 Females. 1 Male. $200/ea. 301-283-0707 4th Mo Rent 1/2 Credit foreclosure issues. No downpayment. No doc, ENGLISH MASTIFF PUPS—Ch.sired. Brindles & no income verification loans. Fawns. 6 Fems. Ready Now. $1800-$2000. Carydale East 703-751-7576 Call today and get approved. 540-784-0328 Carydale Village 703-780-6244 301-362-4001 ENGLISH SPRINGER SPANIEL—AKC reg lvr & wht *Holly Court 703-765-7039 pups ready now. $450. Ref. avail. 301-475-7827 *Rolling Hills 703-780-0161 BAKERY—For sale. Great location in new shppng *Washington Avenue 703-765-7039 ctr. New equip. Must see! Great oppty! Ferret—Fabulous fun 2yrs.old.,Rabies cert., in- 301-996-4986 cludes cage/supplies. $125. 703-250-3142 www.carydale.com C7DAB30Hk & "! %k4G?A4BBk!& Classifieds

SE—Try this on for size! 1BR & 2BR renovated apts. ARL/ROSSLYN $199,950 ARLINGTON $699,000 IDEAL 1031 —ocean front lots, waterfront homes, Easy Greenline access! Carpet, quiet, secure, con- Newly remod. spect. Studio 476 s.f. w/views of the 3BR, 2.5BA, SS Kitc, Main Level Fam rm., wood flrs, luxury condos in beautiful Wilmington, N.C. Call RENTALS venient. Vouchers ok.Call 703-780-0040. Leave msg. pool. Owner wants quick sale. 703 587-4071 corner lot, deck, driveway. Agents welcome. 256-468-6424 or visit us at: SIL SPG/Conn Estate—3BR, 2BA, LR, DR, FR, bsmt., ARL/ROSSLYN-2 BLOCKS TO METRO 5900 1st St. S. Call 703-447-4916 www.meliaproperties.net. SouthCoast Realty GERMANTWN N —Lux TH 4BR 3½BA, 2 car grg, CAC, DW/WD, OSP.$1450. Call 301-984-7749 Convenient Studios $139K-$195K, 1BR units $210K- Arlington, North $649,900 INVEST IN NO. FLA—Under $55K Package deal, 5 deck & patio Nr Milestone & 270. $2099 Call SIL SPG—SFH, 5 rms, 2BAs, 2 rms upstairs w/ 1BA, 3 $265K. Parking incl. w/ these units. Open house at COMMUTER OPEN HOUSE non contigious lots in growing nghd, 20 mins from 301-986-8654 rms in middle w/ 1BA, fin bsmt. Close to bus stop & 1111 Arlington Blvd. #841. Enter on Lynn St. next to Thurs. 7/13 4p-7p. 4 bed 2 bath SFH. 1 mile to EFC Gulf of Mexico, fishing/boating, beautiful State Herndon $2000 bltwy. $2,000. Quiet neighborhood. Arl. Blvd. Ask gatehouse for pkg. & dir. Call Harriet metro & I66. Lee Hwy W, R on John Marshall Dr to Parks. Call 850-510-1556 Rachel at Shell Point Realty Home for Rent Call 301-523-7877 for info. 703 447-3336. Landmark Realty Group 2614. www.OrangeLineHouses.com IT’S A BUYER’S MARKET — Buy a home. Move in 3 lvl single - 4 BR, 2.5 bath, living, family, dining, SIL SPG—Spac. 5BR, 2½ ba w/bright sunrm that ARLINGTON Keller Williams Realty 703-861-9468 w/less than $1000 out of pocket. Call Berna Able at deck, garage, bsment, etc. Akim 703-395-1187 opens up to lg. deck. Walkout bsmt. Rent to own. All WALK TO METRO BUYS!! ASHBURN BY OWNER RE/MAX Allegiance 703-649-0939 HYATTSV—1-2 BR house, 1-BA, lg. garage w/deck. credit considered. $2600 mo. FANTASTIC BARGAINS HERE!! 4 BR 3½ BA, 2 car gar, fnshd bsmnt, beaut $617,900 LANHAM - $370,000 4BR, 2FB, fin full bsmt., det Avl. 8/1. $1439 + $650 dep. 301-210-7994 Metrostar Realty, E. Veney, 202-330-8711 Sellers Pay Closing Cost!! value. $396,500 or best reasonable offer. Inspection home w/ deck. Shows well. Fresh paint, carpet. HYATTSVILLE/1800 Metzerott Rd.—2BR Condo Sil Spg Town & Country—3BR 3.5BA TH, fin bsmt, Large Effcy w/view $179,OOO sat/sun (15th/16th) 12-5 pm. House will be sold Victoria Carmon-Brown, Exit Premier Realty, for rent, nr shpg cntr & bus. Call 301-580-5045 new paint, new carpet, walk to Metro $1760/mo Newly Renov Effcy $185,000 sunday night to highest bidder. 1-888-222-4997. 202-438-8785, 301-560-6700 ofc. CALL JOHN 301-434-3040 DUFFIE INC. Spac. 1BR River Pl $185,000 BOYDS $969,000 LORTON/WODDBRIDGE- *DRASTIC REDUCTIONS* HYATTSVILLE HOUSE Southwest—$1450 Deluxe rare floorplan effcy $227,950 14102 BEAR CREEK DR. Buy Now!-Limited Offer Residential TH & SFH, quali- APARTMENTS Spacious Studio with Garden Stratton House 2BR 1BA $269,900 GET $25,000 CASH FOR YOUR CLOSING COST. Huge fied buyers call, 703-587-1998 Jobin Realty ALL UTILITIES INCLUDED Newly renov studio w/ English garden. Metro ac- Decorator 1BR Ballston $279,000 Toll Brothers Home w/7 BR/5.5 BA, 2 yrs. old. OPEN MANASSAS CITY $439,900 cess. Prkg/Utilities incl. W&D. New appl. Call for Don’t have what you’re looking for here? HOUSE 7/16 12-4 pm. Call TAZEEN (240)299-2840 Lovely, spacious,1&2Bdrm. apts. avail. Start at Remodeled SFH, 4BR, 2BA, 2 lvl Cape Cod. Walk to appt: 202.484.3141 We’ll find it for you!! BROOKLYN, MD $329,600 VRE, TLC shows throughout. Call Chris Perry, II at $875.00. A/C, 24 hr. maintenance & more! W/W SPRINGFIELD/SARATOGA—3lvl TH, 3BR/2.5BA, Mn flr. 2 BR, 1 BA. fin. bsmt. 2nd flr in-law ste. 4 rms. Carpeting. Close to schools, bus stop, Metro and the Marion Cloud Lake & Country 540-223-1444 Hdwd flrs, upgrades, deck, $1895/mo. Sep. ent. Ingrnd pool. Ron Zimmerman Realtors, MANASSAS PARK $349,000 University of MD, shuttle avail... ASK ABOUT OUR 703-932-0007 202-714-0139. SPECIALS. Call 301-927-0415 for more info. 703-314-7033 4BR, 3FBA, 3 yrs old, 3 lvls, wk-out bsmt, brickfront, SPRINGFIELD—SFH colonial 4 BR/ 2.5 BA, nr 395/ BUYERS WANTED — 3-4BR. $350K - $450K. Credit Must See! 297 Kirby St. Call Hussain Jaghori, Landmark Great Location! 495/95, all new, excellent condition $2200 + utilities RE/MAX ALLEGIANCE problems OK. Call Henry 301-775-8420 1,2 & 3Br apts from $895 all utilities incld. Walk to 703-606-6626, Atlantis International, Inc. 703-926-5479 Balt City Waterfront $975,000 CAPE CORRAL—Beautiful vacation home w/indoor MANASSAS—Sale/Lease in 4 BR 3 BA SFH, Sev. fin Metro, shops and entertainment. Move in by 7/15 SS—1 BR apt, 1st lvl in SFH, pvt entr., BA, Kit, prk Panoramic Waterviews! pool. 5 mins from waterways. Priced to move! Won’t and get A MONTH’S RENT FREE. options. Clse. to VRE, 28 & 66, nr bus stop, setting, bus stop at frnt dr, nr ss metro, cab tv, Visit baltimoreshowcase.com for virtual tour last!! Call toll-free: 1-866-923-3368. 703-926-8110 Call 703-370-6080 Remax Sails, Inc. 1-410-814-2404 female, n/s, n/p. Avail imm., $900/m incl util. Sec CAPITOL HGTS $235,500 MARTINSBURG, WV—5BR, 3.5BA, 8.4 acres, water- LAUREL—New carpet & paint. 3BR/2.5BA gar TH in dep req. Call Liz at 240-505-9313. Ron Howard Sales Associate 443-414-3338 End unit TH, 3BR, sunken liv rm w/fpl, fncd bck yd, Golf Course Comm. Avl immed. $1700. Capitol Hill $303,600 front, lots of extras. Close to MARC. $460,000. SS/GA. AVE—Beltway/Forest Glen Metro. 1BR at call India, 240-472-2119. Exit Premier Realty, Call 304-260-0705 301-604-5549 $915 & 2BR $1095. All utils. incl. 301-681-2776. OPEN HOUSE 301-560-6700. Laurel—New condo 1BR 1BA in hist district over- Butterfield House is a new condominium designed MD, DC, VA—Need Real Estate Investors w/good STAFFORD—5BR 3½BA SFH for rent. $1990. Nisha, CHURCHTON/WATER VIEW—4BR/2.5BA. fpl. ga- credit (680 FICO or higher) & $5K min. to invest. looks Main St. Hdwd flrs, w/d, granite, stainless steel 571-212-1855 and constructed in the Edwardian style and with a rage. corner lot near Marina. $489,900. Call Ruth appl, close to shops, Metro, MARC. $1240/mo 202-747-5066 SUITLAND—3BR 2FBA rambler, lg bsmnt w/ den, lg craftmanship rarely seen today. It will have 28 very McLean, Assoc. Brkr, Re/Max 100. 410-991-2334 or CALL JOHN 301-434-3040 unique one & two bedroom homes. Prices start in 301-812-2515. Mitchellville $499,999 yard, w/d, etc. $1700. 202-285-5152. Charming 4BR 2.5BA LEESBURG—6 yr old SFH, cul-de-sac, fam nbrhd, low 300s. Come and visit sales center at 1010 CLIFTON AREA -$979,900— By owner-4/2.5Ba Col. 4BR 3½BA, 2500 sf, lg fncd yd, deck, 2-car garg, 5 SUITLAND/Morningside—4BR 2BA nr AAFB. SF detached. HWD foyer, bright LR, serene DR. Eat-in $1600 w/opt. 301-552-4460 Pennsylvania Ave SE Hours are from 11-6 daily .93 A nr Ffx Co Pkwy/66/495, 23x27 kitc/eat, cherry, min to Old Town. $2400. 703-737-7330 except Tues & Thurs. Brokers Welcome kitch, new SS appl, island. Backs to woods. Welcom- SW/4762 S CAP TERR—Lg 2BR,renov,priv ent, nr gran, lux ba, steam, jacuz, h’td flr, bonus/ofc/media ing FR w/gas FP. New carpet 2nd lvl. Big BRs. Huge LORTON—New TH w/ fin bsmnt, ready 8/1. $2,150. butterfieldhouse.com 202-544-0021 rm,exer rm,wrkshp. ’05 updt. 4700 sf. 703-830-1305 703-372-1600. metro. $700+util deck for kids and adults to gather! Call JolanBauc- DELWIN REALTY 202-561-4675 Capitol Hill $409,217! CLINTON $549K, Beaut. 4BR, 3½BA, 8515 Topaz MANASSAS—Sale/Lease in 4 BR 3 BA SFH, Sev. fin [email protected]. (C)301-442-0405.(O) 301-421-1114. Takoma/East Silver Spr. NEAR METRO! Modern amenities and uncompromising finishes Crt., & Bowie. NW $365K - 2BR condo. 66 New options. Clse. to VRE, 28 & 66, nr bus stop, describe this 3rd fl, 1br unit perfectly. Bring your York Ave, #102. All like new. Call Yvonne Skinner, 703-926-8110 1 BR sec bldg, pking incl, $850. Call JOHN 301-434-3040 Duffie Inc. pets! Bamboo flooring, Fab kitchen. Centrally lo- 301-257-6443, Re/Max Specialists - Finan Avail. MITCHELLVILLE/LAKE ARBOR— Gorgeous 1BR, cated on the hill Steps to Cap South Metro. 116 N N Arl-Becket Glen $799,000 TEMPLE HILLS—Lynn Hill Condos. 1BR/1BA & 3BR/ CLINTON— 4 yr old Colonial, 4BR, 2FBA, 2HBA, Mstr Luxury 3 BR, 3.5 BA with den (or 4th BR!). Absolutely 1BA, frpl, balc, spiral staircase to loft, w/d, dw, w/w, CAROLINA AVE SE #301, F06 Veronica, ste, Super Bath w/jacuzzi, w-i closets, formal liv & ac, Avl immed. $1000. 240-603-3337 2BA. Nr Naylor Rd Metro. $800 & $1250/mo inc utils. Gorgeous, GT patio, upgraded kitchen. 1.2 mi to 571-238-7525 301-608-9797 din rms, gourmet Kitc w/SS appls. Fam rm w/gas Fpl. MITCHELLVILLE—Lux home, 5BR, 3½BA, lg deck, www.MixonMixon.com Ballston. 2005 N Brandywine Street. WOODBRIDGE—3 good size BR’s 3½-BA, hwd flrs Hdwd flrs. Fin’d Bsmt w/exerc & theatre rms, deck, Megan McMorrow 703-403-5543 Long & Foster fin bsmt & bar. Lge yd. 2 car gar. $2,875. DOWNTOWN/CC—Sm. Commuter Pad. Live nr 2-car gar. 8604 Deborah St. Call Bethea at 301-343-1470 on main lvl, new paint, custom bookcases in BR’s, N Arl-Waverly Hills $560,000 full bsmt. w/outside entr., pvt fncd back yrd, vaulted work/play! New fixtures. $775. 202-289-4909 240-462-6456. Century 21/Home Center, MT PLEASANT—1656 PARK RD NW. 2BR $1600 mo, FAIRFAX Just Reduced $21,000—Spac 2BR, 2BA 3 BR/1 BA cape. Walk to Ballston and ES and HS. Nice ceil., beaut. deck, lots of storage, remod. kit. 301-552-3000. updates. Close to 66. 1504 N Utah Street. a/c, garb. disp, w/d in apt. PLUS utils. Contact Alex at 703-622-5704 condo, cls to Fair Lakes, frpl, balc, lge BR, pool, so CONGRESS HTS—$290K, 2 units, semi-detached, bf Morris Mgmt. Inc. 202-667-3000 Megan McMorrow 703-403-5543 Long & Foster WOODBRIDGE—3lvl 3BR 3½BA TH loc close to much more! This unit is price to sell. $299,000. Open 2BR/1BA, w/d, renovated! Open space & deck! NE—1219 Meigs St. New renov 2BR, new kit, W/W Sat 12-4. 12904 B Grays Pointe Rd. Monica, Century Bsmnt is 1 BR unit w/ w/d sep metered. NC/VA—Lake Gaston, waterfront lots in quiet sub Potomac Mills Mall & Potomac Hospital. Avail div. $325K to $425K. Offshore lots w/ deeded boat carpet, secure building, nr Metro. $1100+. Sec 8 immed, also for sale. Call Tom Willams The Real 21, 240-426-8723 703-403-0748, Jobin Realty. welc. DELWIN REALTY 202-561-4675 FALLS CHURCH - VIENNA slip, $135K. Call Beth, 252-578-7257 or email Estate Exchange 703-850-5073 DEANWOOD - $215,900 - Cozy 2BR brk home feat. [email protected] NE—2BR house, hdwd flrs thru-out, lge fin’d bsmt WALK TO METRO BUYS!! hdwd flrs., pvt yd., new appls. Loc. nr Capital WOODBRIDGE — House for rent or rooms for rent. N.E. —Comm’l/resid, 3BR, 2FBA w/bsmt, MSBR w/hdwd panelling, cac, avail immed. Section 8 4BR, 2FBA SFH, jacuzzi. Call 703-930-9431 FANTASTIC BARGAINS HERE!! Gateway Development. 5412 Blaine St., NE. JLC welcome. Call 202-526-1159 or 202-494-3540 Sellers Pay Closing Cost!! Realty. Call Doug Carter, 202-607-3684. w/sit rm, 2 rear exits. NE— 3 BR, new appls, W/D, $1700/mo. Nr Metro Like new 1BR, fpl balcony $319,000 Deanwood $375,000 N.W. —4BR, 3FBA, 1HBA semi detached TH w/bsmt totally renov. 1-car detached garage. 202-352-3195 SUMMER RENTALS Wilton House 1BR Like new $349,900 NO MONEY DOWN N.E.— End unit TH, 5894 Eastern Ave. $1800+ utils. Don’t have what you’re looking for here? Susie Moore Associates All Closing Paid on this Brand New 3 Level Home in 301-449-7979 3BR, 2.5BA, fin bsmt w/w/d, compl refin. 10 mins to We’ll find it for you!! Deanwood. Come choose your carpet & paint color. Ft Totten Metro, 8 mins to Walter Reed Med Ctr, 15 REHOB—Clean cottages, reasonable prices. ¾ mi. • 3 Bedrooms, 2.5 Baths NE/D.C.—Church for rent, part-time, $700/mo. mins to Wash Med Ctr. call 240-398-8460 ocean. 302-227-5528 www.bayroadcottages.com Marion Cloud • Hardwood Floors $350 seurity dep. 301-768-7810 or 202-583-6838 N.E./Ft. Lincoln—Lovely 3+BR, 2.5BA, 3 lvl TH, w/d, • 1 Car Garage O.C.—Oceanfront 2BR, 2BA condo, pool. Summer w/w, ac, dw, fin bsmt, Nr Metro $1650. 703-314-7033 Call James @ (240) 832-2010 wks. 703-628-4085; 703-759-7158 240-603-3337 Avl immed. THIS ONE WON’T LAST! ROOMMATES RE/MAX ALLEGIANCE DISTRICT HEIGHTS—Beautiful colonial, 4BR, 2.5BA, SE $285,000 - 1412 Bangor Street (20020) 2BR, NE—Newly remod 1BR new appli, W/D avail, carpet, FOGGY BOTTOM—1-BR, pkg, pool, & more. $475K/ marble flrs, granite cntrs. Open House Sun 7/16 2BA att. renov home. All new appls, duct work, A/C, near metro/bus service. $675/mo Call 202-583-6108 ARL—Shr hse. Wlk Ballston Metro. Immed. Lg Rm offer. 1230 23rd St. NW #917. 301-455-5123 $379,000. Shante Briscoe 202-498-3081 Exit Pre- ceramic tile, new wind, wd flrs++. Long & Foster, or 202-526-1758 $695/Lg Rm pvt BA $725 + utils. 703-599-7572 GERMANTOWN OPEN SUNDAY mier Realty 301-560-6700 301-434-8900. Call Mrs. Craven, 301-704-5214 NORTH BETHESDA $1650 CAP HGTS/SEAT PLEASANT—Nice rm. $140/wk & READY 4 YOUR FURNITURE Edgewater $659,000 SELF STORAGE GARAGES—9 self-storage grg’s. 5 1 MIN WALK TO METRO! up. M to shr hse. Near transportation. 2-bd, 2-bth, 3rd flr end. New paint + appl. + tile flrs + LIVE BY THE BAY singles, 4 dbls in the heart of Old Town, Alex. HUGE 2B,2BA, elegant security bldg, eat-in kit, patio, 301-499-6323 skylight upgr. + fpl + cov. deck. Wlk to N.W.H.S. Dir: Located on TURKEY POINT ISLAND - close to the Bay City assessed @ $707,100. Call 703-549-1010 to HW fl, 8’ceilings. INC util, parking, gym, pool! CAP HTS—Furn rm for rent in conv loc. Close to Blue Gr. Seneca to Dairymaid, turn R at Farmingdale sign. and Annapolis! Keep your boat at an island marina. make an offer 703-909-2580 [email protected] line. N/S. no pets. Cable ready. Call 240-398-8677 Follow signs to 13257 Wonderland Way #302. • 2-Story Victorian SELLING OR BUYING A HOME NW/12th&USt.—Immed. Occup. sophisticated 1 CHEVY CH—Fully furn. 7-BR hse. Apts avail. w/pvt. Colwell Banker 301-662-8600 • 4 Bedrooms, 3.5 Baths BR/1 BA, clse to restaurant, undrgrnd pkg and fit. ctr. LR, BR, BA. No kitchen. OSP. $1000/mo. LEISURE WORLD—3BR, 2 BA end unit, 2½ car gar. in • Large Kitchen w/nook $0 DOWN PAYMENT $1750/mo. 301-537-6520 301-237-5118 Adult Community. Conv. loc. $475,000. • Spacious FR w/ fireplace DC,MD,&VA NW—1BR, Utils. incl. Laundry on premisis. $775. COLLEGE PK—quiet neighbrhd, cl to trans /shops. 301 725-6751 • 9 ft ceilings/hardwood flrs Fort Stevens Props. 301-316-4590. Merrifield/dunn loring $429,900 SEE IT ONLINE at CharlesKraus.com Call Wilene 240-274-7510 $500/mo incl all util. Call 301-717-9057 Re/Max 2000 301-592-0200 NW/219 Upshur St.—large 1BR hdwd flrs, sep DISTRICT HTS—Rooms, furn/unfurn, remodel, catv, BRAND NEW! Charles Kraus, Associate Broker dining rm, laundry rm Never lived in 2BR 2 BA condo @ Dunn Loring/Merri- RE/MAX Experts (O): 888-514-2800 SIL SPG $619,900 cls to Metro. $150-$175. John 202-330-9226. Gorgeous split lvl home, 3-BR 2 full BA situated near Metro, free gas $750 DOWNTOWN/NW—Nsmkg F shr renov TH, lg furn field Metro. Stnlss & granite in Kit. Berber carpet, ELKRIDGE $425,000 DELWIN RLTY 301-577-7917 and Bay Window. Conveys 2 garage parking spots. BRAND NEW TOWNHOUSE! privately on an ac. of land. Tons of upgrades. Realty rms, W/W, W/D, cable wired, Metro, sec dep., net Executives, Bob Burch, 301-275-4122 NW—3BR loc. b/t 1st & 2nd Sts. 2 car gar, dck loc rent $560 incl utils. 202-232-1127 Brian 703-447-3085 3lvl 3BR 2½BA 2 car grg. Jenny Fowler 703-861-9385 George Mason Green Jobin Real Estate SILVER SPRING—Below market colonial. Dan Krell, over gar. Entr to Seaton Pl. $2500, all utls incl. Pets FT WASHlf —SFH fully furn Rm w/ refrig, micro- ok. 202-904-0057 N Arl-Odyssey-Courthouse $377,900 FAIRFAX $619,900 — Immac, lg, 3 lvl, end unit TH. 3 Realtor. Fairfax Realty, Inc. 301-529-8475 wave, CATV, free phone. $175/wk + sec dep. (Dir) 301-881-9800 (O) Equal Housing Opp NW/FOGGY BOTTOM/GWU EHO 301-758-6424 Condo fees pd thru ’06. instant equity! Under yrs old. Approx 2700sf. Open fl plan, dbl deck, fncd yrd, 2 car gar, great location! SilverSpringHomeSearch.com GEORGIA AVE/Walter Reed—3 furn BR in N/S SFH, appraised value. 1 BR 1 BA luxury unit minutes to FIRST MONTH FREE* DC! 2001 N 15th Street #402. ERA Blue Diamond Realty, Mary 703-402-6746. Hot New Listings By Daily Email avl now, F. $150/wk & up, util incl. Shr kit, BA, LR & SOUTHERN W.VA. — Brick & Redwood home. 4BR, dng area, Steps to buslines, few blks to Takoma Megan McMorrow 703-403-5543 Long & Foster Farm—260+ Acres w/house & barn Woods and Large Efficiency&1BRapartments available imme- N.BETH/ROCKV $295,000—3BR/1BA Beautif/to- meadows. North Central WV Doddridge County. 3BA, 2HBA, on 1 ac lndscp, formal din rm, overlook- diately. All utilities paid. Efficiency’s start at $1200. Metro. Daryl, 202-255-3664 ing heated ingrd pool w/sauna. Lge deck, 2-car gar., HERNDON—Nsmkg F to shr beaut quiet 5BR SFH, taly renovated, W.Johnson HS.240-221-0770. Web- Call (304)873-2258 R&R Realty Call Wendy for details 202-333-7711 site av. FEDERAL HILL—Beaut. 3BR, 3 FB, 2-tier rooftop fin bsmt, fncd in back yrd. Great view! On hill bwtw pool, grdn, woods. 703-264-7445 [email protected] Greenbrier River & New River. Excel for summer MANASSAS—Prof to shr 3 lvl TH nr Rt 28. MBR PENTAGON CITY $260,000 deck. $445,000. 410-916-3011; RZR 410 752-1050. *Select units for new tenants 1BR 1BA balc, grg, wlk-in closet, pool, tennis, 2½ FT WASH—4BR, 3FBA, 1HBA colonial, hdwd foyer, home. Great climate, 4-5 hrs from Wash., DC. PENTAGON CITY—Spac 1BR condo, updated, all avail. Very quiet. Refs. & dep. req’d. 336 710-2250. $250,000. Call 304-466-1100. MCLEAN— 1 rm avail in 2BR apt. of SFH. N/S, N/P. blks to metro. Call: 703-219-6817 Jobin Realty halls, stairs, kitchen, sep LR & DR, EI kit, some utils inc, walk to Metro, owner licensed real estate RESTON $450,000 closing help avail.BRANDYWINE—3BR, 3FBA, split STEPHENSON,VA $575,000 agent. $1250. 703-609-5868. Grt ngbrhd, W/D, Fp, $650/mo. incl all utls. & cable. Come Home & Relax. Stunning farm hse on over 8 Avl 8/1. 703-356-6767, 202-638-2233 FSBO - LUXURY CONDO foyer, all brick, over an ac lot, shows well, some Riverdale—1BR/2BR Specials, 1/2 off of security 9th Flr 2 Master BR 2 BA @ Carlton House Every closing help.WALDORF—4BR, 2FBA, split foyer, ac. A Rare Find! Gorgeous Views. Call Dave at Mo deposit! w/w crpt, balcony, laundry, d/w, hdwd flrs, NE/M PROF N/S—LG 4BR 2½BA hse to shr nr Ft $10K closing help. $5000 decor allowance Ask for Wilson Properties, 703-507-2245 & 703-878-0000. Totten Metro. RM avl. All utils incl. Maid svc. amenity! MUST SELL Overseas Owner 340-998-1468 close to Metro. From $850 - $965 + electric. S Arl-Courtbridge-Shirlington $475,000 KathyCAPITAL HTS—4BR, 2BA, detached, split STOCKS STILL LOW 6747 RIVERDALE RD $750/mo. 202-494-3692 foyer, jacuzzi tub, closing help.TEMPLE HILLS—4BR, Invest in the booming Atlanta mkt. Buy investment NW/GEORGETOWN/PALISADES— Share large Plus $5000 closing costs. 1623 sf 2 BR, 2 BA DELWIN REALTY 301-577-7917 townhome condo. Convenient to Pentagon and 395. 1FBA 2HBA, split lvl, corner lot, 2-car garage properties and sell with 60 days for a quick profit. ROCKVILLE/GAITHS—1&2LgBRs.Furn or unfurn. house. Private BA. TEMPLE HILLS—4BR, 2½BA split foyer w/huge fncd $5k min inv. 25% return w/n 60 days. Not an 1/2 utilities. $1200 301-518-7621 2913-B 4. Woodstock Street Short/Long term, Corp/internships. Fully equipped Megan McMorrow 703-403-5543 Long & Foster in back yd. & deck, some closing help. CLINTON IPO-IRA’s Welcome kit/balc. Nr Metro, park w/pool & gym, grocery. RESTON—Prof F N/S shr 3 lvl TH. BR avail. w/d. nr —3BR, 3FBA Rambler bsmt; wd flrs 2 frpl fncd yd, Serious inquiries only. Wiehle Exit. July 20th. $500+½ utls. Internet access SIL SPG/PARKSIDE PLAZA Good rates. Utils incld/cable 301-948-0087. 1 & 2-BR units w/pool/sauna/exer. rm/party rm. carport Some Closing Help. CLINTON—4BR, 2BA www.pinnacledevpartners.com incl. Call 703-860-1118 866-871-3226 SE/1322 T ST—LGE 1BR. Refurb kit. WW carp. Nr Close to Metro. Breathtaking views and so much det Split Foyer. Renovated. In-ground Pool Metro! $650 + utils. DELWIN REALTY, 202-678-2548 SE—Prof M or F to shr condo, n/s n/p, fully furn, ODENTON —3BR, 2FBA TH w/bsmt; remodeled; Taneytown $409,900 newly renovated, Jacuzzi, full kit, w/d, cable TV. more! RE/MAX 200 Call Wendy 240-832-0457. SE/3325 MLK AVE—New W/W carpet, wlk in clos- SW—SPACIOUS 2BR, 1BA CONDO. 1 YR OLD. WLK TO 1-car garageCAPITOL HTS—2-3BR/2FBA det w/ Minutes From Frederick ets, sec building, laundry, Nr Metro. $475+util. $175-350/wk utils inc. 202-536-5586 bsmt, huge DR, EI kit, fncd yd. This home home has everything. Situated on a 1/3 SIL SPG— 1BR. Nr Metro Bus & shops. $575/mo incl METRO, WATERFRONT. PARKING INCLD. $445K. DELWIN REALTY 202-561-4675 FSBO. CALL 571-243-6301. Susie Moore Associates 301-449-7979 acre cul-de-sac lot. A MUST SEE! SE/3748 1st St. — Large 1BR Secure bldg. Near utils, phone, cable & laundry (access). GAITHERSBURG—Lux ofc spc, 900 SqFt $1100/mo. • 4 BR,2F/2H Baths Metro, pvt prkg. $565+util DELWIN REALTY 703-994-3501 Call 301-515-7122 Leave msg. Lease Incentive • 3 finished levels 202-561-4675 HOUSES FOR SALE GERMANTOWN—3-BR TH, great value, $300,000. • Large kitchen w/ fireplace SE—4/5 BR hse. Freshly paint, W/D, CAC, $2400. Loads of upgrades. Metrostar Realty, E. Veney, • Fenced rear yard w/playset deck and shed 202-352-3195 CONDOS FOR SALE 202-330-8711 Open Sunday 7/9 12-2. Call for directions. SE: 4010 9th St.—1 BR $700+e. Totally remodeled,- A FREE DAILY LIST OF HOMES in DC, MD, & VA HAMILTON, VA - $795,000 — Beautiful cottage 410-905-6815 hardwood floors, A/C, balcony, Southern Avenue ADELPHI— Lge 1BR, EI kit separate dining room, 2 —for Sale w/Prices, Addresses & Descriptions. Visit style, newly redone, 3700+ sf, hdwds thru-out, UPPER MARLBORO $530,000 Metro. Laundry room on-site. walk in closets, new paint & crptd, nr train & bus. www.Move4FreeRealty.com. Sarah Santa Ana ceramic BA, 1 Ac, sml town setting. 10’ ceilg, gourm Model Home. 4BR, 3½ BA, brick executive-style Manager: 202-270-1319 View 301 332-1177 703-881-9333 FAIRFAX REALTY kitc, 2-c gar. FSBO, Agt welc. Duane, 703-989-3906 Colonial, fully fin bsmt, huge kit. w/morning rm & skylite, formal LR & DR, deck, fam. rm. w/brk fpl & Waggaman Corp 202-537-8970 ALEX- $200,000 - Stylish 1BR condo, lovely views. ALEX - 0% DOWN! BAD CREDIT NO Harford County/Forest Hill $799,900 Housing Choice Voucher Welcome Such a great location. Luxury building. E-Z commute. PROBLEM! OWNR FINANCING! much more. Please call Charmayne Clark, LUXURY HOME 301 595-5529 ext 29. Clark & Associates Real Estate Equal Housing Opportunity Grt in-town living. Open Sun by appt. 703-370-8670. 411 Lavern Ave, Alex Va, 22305 Just built this 5 bed, 3 bath, luxury home, 2.75 acres, SE—Cozy 2-BR, just renovated. $875/mo. Must have www.TaylorBrown.com $450,000. 2BR 1BA. 202-483-2024 sunroom, library, wetbar, butlers pantry, and much Waldorf/Accokeek—6 bedrooms multi-family on 5 rental history. Call 240-464-1983 ARL/BALLSTON $479,000 ALEXANDRIA — 3BR TH, 2½BA, Deck, fin’d bsmt, 3 more! Only 10 minutes to the MARC, I-95, and an acres 590,000. 6 bedrooms single family on 3 acres SE—Lge 2BR unit, on busline. Sec 8 voucher holders Luxury 2BR, 2BA. Good view. Hardly lived in. 5 yr min walk to Metro. $619,000. Call 703-785-1178 or easy commute to DC area. Great community & 290,000, call 301-343-1674 accepted. 301-652-2002 young, pool, exercise rm, garage, & more. Dirs: From 571-213-6261 schools SE—Sec. 8 vchr welc. Newly renov. 1 BR, CAC, W/D, Glebe Rd, Fairfax Dr, R on Pollard & L on 9th St. to ARL, S—Semi detached 2BR 1½BA. full fin bsmt. off Eric Gonzalez, Long and Foster, Inc. 240-481-1586 3830. Call Reza at North. VA Homes. 703-734-0400 str pkg. Renov. kitchen. 703-403-0748, Jobin Realty. C- 410-808-9053, O- 410-879-0900 !'k4G?A4BBk & "! %kC7DAB30H Classifieds

HOUSES FOR SALE WHEELS

BMW ’03 z42.5—Auto, 27k mi, gray, AM/FM, CD, Insp, AC, PW/PDL, PS, ABS, Alloys, Cruise, Tilt, WE BUY HOUSES $29900, 703-606-5440 BMW RT ’99—Back beauty like new. Adult ridden. ANY PRICE OR COND ABS, Autocom, 3 cases. 22k miles. $8500, WE BUY HOUSES FAST 703-309-8606 ALL CASH. NO Comm., NO Fees to you, NO Conting. CAD ’04 ESCALADE—50K mi. loaded, white dia- Why Stop USAVEMONEY. mond, navigation, moon roof, DVD, $34,995, day Brian Re/Max 2000, 301-996-9695 301-774-9821 evening 301-942-6955 www.ListorBuyHomes.com CAD ’97 SEVILLE STS—All power, chrome Cadillac [email protected] rims, new tires, asking $4000. 202-345-1383 WINCHESTER - 2 New Homes at Lake Holiday, CHEVY ’87 SS Monte Carlo Areo- Coupe—Auto, Cape Cod+ Contemp. Mtn views. Granite, crown 49k mi, Black, AM/FM, Insp, Snrf, AC, PW/PDL, PS, moldings, frplcs, bsmts., Jet tubs, sunrms., wd flrs., Alloys, Cruise, Tilt, $4500.00, 301-399-3968 garages. $392,900 & $399,000. Call Pat, FORD—’99 Taurus SE, fully loaded, clean in & out, 540-888-3205. McHale Realty, 540-723-9944. only 87K mi., exc. cond., will MD inspect. $3800/ WINCHESTER, VA—5 ac bldg lot w/4-5 BR perk, OBO. 240-988-2141 Now? level lot, 5 mins from Winchester Hospital. $175K/ FORD ’99 RANGER XLT—4-dr, super cab, runs OBO. 540-974-1191 great, must see, matching f.g. cap, fully loaded , WOODBRIDGE—2 beautiful 3 lvl THs w/ 2 car gar, fp, auto., pwr, 152K mi, $3900/BO. 301-972-8750 over 2K sf, 3BR, 3½BA, fin bsmnt w/ rec rm, only HONDA ’03 Civic Hybrid—5 spd, 38k mi, Beige, $540,000. $30,000 towards closing costs. AM/FM, CD, Insp, AC, PW/PDL, PS, ABS, Alloys, 540-752-5677/703-296-5093 Call Jock Brown Cruise, Tilt, $15499, 703-395-1566 WOODBRIDGE—3lvl TH, 3BR, 1½BA. Hw flrs, gran- ISUZU ’95 RODEO—Beautiful, green, clean in/out, There’s more to ite, new appliances. $329,900. Also for rent. Call $2500/obo. 202-607-6040 Olga, Owner/Agent 703-499-3222 JAGUAR ’03 X-type—5 spd, IMMACULATE cond., WOODBRIDGE—For sale/rent, new 3 lvl 4 BR 2½ 21k mi, Black, Power Everything, ABS, Alloys, BA, $550,000 or $2000/m. 703-989-4779. PRICED TO SELL, $17600, 301-948-0579 today’s Express at WOODBRIDGE— Gorgeous house. Seller will pay JEEP ’02 Grand Cherokee—SUV, 65k mi, Graphite $15K in closing. Call Ruby, 571-432-6717. Metallic Clear Coat, CD, Snrf, AC, PW/PDL, ABS, WOULD YOU LIKE TO BECOME A HOMEOWNER Alloys, Cruise, $13990, 240-422-6336 NOW ?—No money down program avail. Call Alicia MERCEDES-BENZ ’99 M-Class—Auto, 51k mi, 202-439-7747 Re/Max 2000 Black, AM/FM, CD, Insp, Snrf, AC, PW/PDL, PS, ABS, readexpress.com. Cruise, $17000, 703-905-9108 x 7039678573 MERCURY ’96 GRAND MARQUIS GS —All power, LOTS & ACREAGE bronze, alarm system, 100k mi, new tires, asking $2500. 202-345-1383 NISSAN ’04 Titan SE 4X4 Crew Cab—Auto, Only 1st Time Offered 5,500 mi., Silver, off-road, big tow, LOADED, DVD, AM/FM, CD, AC, ABS, PS, PW/PDL, Alloys, Cruise, Tilt, 1200’ Stream $25000/obo, 301-834-4490 SATURN ’99 SL1—Auto, 143k mi, blue, AM/FM, 20+ AC - $134,900 Cassette, Insp, AC, ABS, Tilt, $3290, 240-217-3346 One of a kind! Has a state forest setting w/large hardwood trees. Near historic Cumberland, MD & VOLVO ’04 Convertible—CONVERTABLE, Auto, 31k Interstate 68. Low rate, long term financing avail. mi, silver, AM/FM, Cassette, CD, Insp, AC, PW/PDL, Call 1-800-888-1262 PS, ABS, Alloys, Cruise, Tilt, $24600, 314-401-3716 20+ Acres with Private River Access. Perfect for a VW ’04 Golf—Auto, 19k mi, Red, AM/FM, Cassette, vacation getaway and retirement. Very usable with CD, Insp, Snrf, AC, PW/PDL, PS, ABS, Alloys, Cruise, long range mtn views. bf06 www.landneardc.com $14300, 773-960-8988 VW ’03 GTI 1.8T—5 spd, 32k mi, Black, AM/FM, CD, OWN THE MTN TOP! Mnrf, AC, PW/PDL, ABS, Alloys, Cruise, Tilt, $13,000. 50 MILE MTN VIEWS! 703-590-2566 RIVER ACCESS 25+ AC - $159,900 Has guaranteed seclusion w/ end of rd privacy. Perfect to build your dream home. Great financing avail w/ low interest rates. Call 1-877-777-4837 Keep up with the latest REAL ESTATE SERVICES local news.

AIRCRAFT STORAGE HANGARS—mo to mo lease, $300-$340. Avail. now. No wait list. Also, 2 storage units (auto/boat, etc.) $215/mo. Shannon Airport, BOATS AND AVIATION Fredericksburg, VA 540-373-4431 ARE YOU TIRED OF RENTING? Do you want to BAJA ’98—272, 27’, 502EFI 415HP,65 MPH, custom own? Bankruptcies, liens, judgements, foreclosures, paint, custom Bose/Clarion stereo, boatel kept, we can help. Call Berna Able at RE/MAX Alle- immaculate, $55000, 703-683-6333 giance 703-649-0939 BAYLINER—’04 21 ft. Bowrider, 220 HP, fast & ***BAD/NEGATIVE CREDIT powerful, w/trlr, test ride today on the bay. $16,000. Call 301-252-6029, 410-535-2582 Plan your night. Remove from Credit Report BAYLINER 1950 ’99—Bimini, cover, fishfndr, 2 props, skiis, pfds,runs great,needs H2O $7k Call 202-775-6932 703-407-0184 REAL ESTATE LOANS & $0 DOWN FINANCING HARLEY DAVIDSON ’05—Fat Boy, Black/Gray, fuel Investor Programs. Fast closing! We beat all injected, 30 miles, lots of extras. $17500, good faith estimates. Call Al at 240-533-7427. 540-710-6864 VIBRANT REALTY, INC TIARA 29 FT.—’96 Montauk Ltd ed. H/T, all fact. opt., Is actively seeking Real Estate Associates for its auto. pilot, radar, GPS, VHF, twin FWC 454 XLI eng’s, Hyattville, MD loc. Call 301-270-5599 or low hrs, full winter cover, lift stored, never fished, 800-645-5099 prof. maint., perfect cond. 410-745-3484 COMMERCIAL REAL ESTATE Discover restaurants, bars, Learn. Search. Shop. 1717 K St, NW.—Office Intelligently: On demand theaters and other hot spots offices, phone, mail, Internet, incubator, business seminars, other svcs. Plans $45-$200/mo. Call OSI, near any Metro station. Explore. Interact. Plan. 202-508-3896 to learn more. NW $558,000 3 lvl Shell in heart of City. Plans avail for renov. 2 Apts At readexpress.com. upstairs. Main lvl Comm’l. new roof & fence. 703-403-0748, Jobin Realty.

Find a job, home, car and more from hundreds of top A publication of GHI sites in one easy search.

readexpress.com

X120 3x12              

                     . 7 8  .   ' 9 ' !  :  5     #        (+       !           ) ! !         !     (   ;   !     ) +       !           4! 7 8    <222 , !    "  =2222     ! "##$ ! %&! -    !       .   &'&#$  %"   '!      .          !              !                        (    !         .             !  !                                    ! /0        (

       )                                  ! !                            !    "          !  !!              )     -         1     0222  3222 !   !  !     (   !    !  !                       + 1    +                      #      !          !  )      7                4 !     $                   1  $  %    !       "    "     5            & '                -  -      !      (  )                    ""     ! 62            "    !             !       !                !           ! &    !        !        (&')   ! (       !              (     ) )                           !   *            "    +        "                           *(    #                        !)()** *+, -.

By this time next year you will have...  completed your Master’s Degree or  be two months from completing your Bachelor’s Degree That is, if you enroll now in an accelerated degree Register today. program at Nyack College DC Campus. Call 202-220-1300 or log onto www.nyack.edu/dc Let this be your year Accredited by Middle States of accomplishment! Commission on Higher Education Financial Aid Available " k4G?A4BBk & "! %kC7DAB30H

GhmZee_hh]\h&hil^f[kZ\^ ma^mk^g]mhpZk]\hglnf^k&]kbo& ^gikh]n\mh__^kbg`lZg]ZpZr_khf ma^\kng\arb]^Zelh_ma^bkeZk`^er o^`^mZkbZg_hng]^kl'Ma^H\^Zg ;^Z\aI^hie^ÍlHk`Zgb\?hh]l BZViaVP]XR ma^[reZpl%lZb]_bgZg\bZefZgZ`& ^kCZfb^=^\d^k' >aVP]XRU^^SR^^_b S^Tb]½c Ma^k^pZl\hgmkho^klrZmma^ \TP]fTXaS¹Xc FB>½A40A aZo^ZieZ\^pa^k^ma^r\Zgink& 2>5>D=34AC742><<>=<0A:4C CnlmZlfZbglmk^Zflni^k& \aZl^f^ZmmaZmaZl[^^g`khpg fZkd^mlaZo^nii^]ma^bkhk`Zgb\ bgpZrlmaZmk^li^\mma^^gobkhg& h__^kbg`lbgk^\^gmr^Zkl%fZgrh_ ÊFhk^Zg]fhk^\hglnf^klZk^ f^gm%ËHÍK^ZklZb]' ma^gZmnkZe_hh]\hhi^kZmbo^lmaZm k^Zebsbg`maZmhk`Zgb\]h^lgÍmf^Zg Ma^

^lk^_e^\m[hmama^]^lbk^lh_ma^bk Z[bebmrh_hk`Zgb\lZm\hgo^gmbhg& #(2)3'!2$.%2!0 bg`fZgZ`^k%lZb]ma^\h&hiZbfl f^f[^k&hpg^klZg]Zg^^]mh\hf& Zelmhk^laZla^ei^]ma^\h&hi[r -ARK%YESTONE PRODUCEBUYERFOR4HE#OMMON-ARKET CAREFULLYPLACESAPPLES mh[^\hf^Z\hffngbmrf^^mbg` i^m^pbma^o^krhg^_khfPahe^ ^qihlbg`fhk^i^hie^mhln\aikh]& ieZ\^'Bmle^Z]^klZelhaZo^ahi^l ?hh]lmhPZe&FZkm_hkhk`Zgb\_hh] n\ml'Mahl^pahma^g\hf^mhma^ HgCner+2%ma^\h&hipbeeahlm liZ\^bl_hnkmbf^l[b``^kmaZg h_hi^gbg`Zl^\hg]lmhk^lhf^& lZe^l';nmma^rlZr\h&hillmbeeh__^k

#   ! ! !  !!  " # "# 6 "" ...'".'" $  $  !$ !$ $   6  %''%)#- %''%)#-  6  %))"%))" ++*'%-*'%-     "1 *,&"1 *,& 6     6  )),, ))!%-!*!%-!* $%!$%! ##** ".,*%.".,*%.  $!$  $!$  ! #  $ !$   $ !$   $ !$         --$%)#.*)$%)#.*)   6 "$ !  ! $    ! ! ! ")0",")0",  ))-- --%.2%.2         6    6 *- )#"'"-*- )#"'"-             .' ). '' --** .' ). 6         - 6 !     ! !-3:*56 6 "673516 */-.*)*/-.*) -.0&)*04-.& $&6-.2,7327-538,- 41$*) *753 "3)&;9&5.&'0; 30)5327     81'*50&2)  &.2 %% ((%% 6 35,&273:2 (038);-81.)&(3840*3+      !"  0855.*6 $&515327    6-3:*56&-*&9;7-82)*5 !-3:2&5*2332436.7.3263+:*&7-*56;67*16&2)45*(.4.7& 6 &07.135* .,-  < !23: 67351.,-$.2):*67 !7&7.32&5; 7.32"*14*5&785*'&2)6&5*-.,-6+357-*)&;35*(&67 $.2(-*67*5  3: < (* 5327 -.,-03:7*14*5&785*6&5*,.9*2+356*0*(7*)(.7.*6 6 14-    $&6-.2,732 351&0-.,- <  351&003:  < 9*5&,*-81.).7;  !!  ! "3)&; 5. "3)&; 5. -&50*6732  $      $       "  -&50377*69.00* !! 70&27&   7  7 167*5)&1   4(   6   -3856*2).2, 41  "5&(* !825.6*73)&;  &1 36732  7  6 7-*26   4(   4( 327-73)&7*   > !826*7732.,-7   41 -.(&,3  4( 6 *50.2   7  4( 351&01327-73)&7*   > 3325.6*73)&;  41 &00&6 6 4( 8*236.5*6  (  4( ;2(-'85, .(-132) *29*5  6  6 &0,&5;  4(   4(  %*&573)&7*   > 3326*773)&;  &1  &67;*&573)&7*   > 3230808  6  6 8'0.2  4(  4( 362,*0*6  4(   6 *2*9&   7   4( !-3:2.673)&;?6:*&7-*5 351&0;*&573)&7*   > &67 *: .567 800 "*14*5&785*6&5*73)&;?6 .&1. 4( 4( 36(3:   4(  7 #.5,.2.&*&(- *:%35/.7;  7  4( 31*  6 4( -.,-6&2)732.,-7?603:6  !  ! #   50&2)3  7   4( !;)2*;  6  6-     80; 80; 8, 8, !*&770*  4(   ( "3/;3   (  4( 35*(&676&2),5&4-.(64539.)*)';((8$*&7-*52( =                 C7DAB30Hk & "! %k4G?A4BBk"

1TPd ch

0?P[TaB WPST^U?X]Z 0INK ISPRETTY!RMANI GETSTHAT ANDUSESITINTHENEW?8=:B0C8= 0A<0=8 B 8;:COLLECTION WHIC H INCLUDESL IPSTICK GIORGIO ARMANIBEAUTYCOMOR AT3AKS &IFTH !VE NU E#HEVY#HA S E GLOS S ANDLINER 7EPREFERREDTHELIP GLOSSES WHICHAREASMOISTURIZINGAS LIPBALMANDHAVEAWONDERFULSHIM MERTHATMAKESLIPSLOOKHEALTHY NOT STICKY!NDTHELIPLIN ERSWENTO NSMOOTH WITHN OCRA YON Y FEEL4HECOLORSCAN hkbgm^kfbqhgebg^'\hf"%pabe^=n^?ZkbgZÍl BETRICKYTHEYTENDTO 2P aah^afTPacWTbT ^f [hll^]e ^Zma ^k%[ kZb ]^]mkbfFbgb& LOOKALITTLEFROSTY P^^d^g ]^k[Z`!.)) %]n ^_ZkbgZ'\h f" SOWEDRECOMMEN D _P[TUX]SbfT[[ QTh^]S g h]lmhmabllnff ^ kÍlmk^g ][ n maZl TRY INGBEF OREB U Y ;PQ^a3Ph½bSTPS[X]T Zmbf ^ e ^ll%eZ]rebd^Z i i^Ze' ING:A8 BC4 =?0 6 4 Fb \aZ^eDh kl%f ^Zgpabe ^% h __ ^k^] :8A1H4G?A4BB Mahn`ama^he]Ê ]hgÍmp^Zkpabm^[^_hk^ Zenq^mZd^hgma^mk^g]pbmaablbohkr F^fhkbZe=ZrËkne^aZlik^mmrfn\a_Zee& hlmkb\ a=^l^km=kZplmkbg`LZ m\ a^e%pbma ^g[rma^pZrlb]^%mahl^pahlmbeeZ[b]^[r \h`gZ\e ^Zma ^kmkbfZg ]Zg mb jn ^[ kZll ln\a_Zlabhg^]b\mlaZo^fnembie^k^Zlhglmh aZk] pZk^ !, %.))% Z m F b\aZ^ e Dhkl lmhk^l k^chb\^'?hkghmhger aZl F^fhkbZe=Zr\hf^ hkfb\aZ^edhkl'\hf"'=hggZDZkZgp^gmma^ Zg ]`h g ^%[ n mmabl lnff ^ kbl Z [Zgg ^ kl^Zlh g mph&mhg^khnm^pbmaa^k ^\knlmk^m\aln^]^& _h kZeemabg`lpab m^pa ^ gbm\h f ^lmh\e h mabg` Zg ]&pabm^gZiZe ^Zma ^k%phh] ^ga ^^e^]lZg& Zg]%fhk ^bfi hkmZgmer%Z\\^ll hkb^l ' ]Zel!-+)Zm=h ggZDZkZg[h nmb jn ^l" %Zl  =^lb`g^klZloZkb^]Zl=F8 A43 08 ;H DRINKSE82:H70;;4CC4G ? A 4BB "!k4G?A4BBk & "! %kC7DAB30H

Ua^\aTPSTg_aTbbR^\ ?^[[2T]cTa C>30H½B@D4BC8>= :e[i:$9$ÊiÇYh_c[ 2dbc ^\TaBTae XRT@d P] S Pah [c[h][dYoÈcWa[oek

6A>24A84BkLmZ__bg`ikh[e^fll ^^f pZlahibg`BÍ]cnlme^Zo^ma^lmhk^ \[[bkdiW\[5 mh[^Zk^\nkkbg`blln^_Z\bg`ma^pbmahnmiZrbg`'Bikh[Z[erlahne] 9ES \k^pZmma^B>280;B054F0Hbgma^ aZo^ÁË .O 64>A64C>F=1DA;48C7Zk^Z%Z\\hk]& Ma^[eh``^k]h^lgÍm%mahn`a%Zg] bg`mh270?C4A! %1;>6B?>C2><' _bgZeer^g]lni`hbg`mhB7>??4AB H4BC4A30H½BA4BD;CB >fiehr^^ ik h[e^flZk ^lmZg]Zk ] 5>>3F0A47>DB4':lb_maZmpbee _Zk^_hkZgr`kh\^krlmhk^Éhk[nlb& fZd^mabg`l[^mm^kÁ'<82704;6A0BB I^ekbZ9ed]h[iiZe g^ll h_fh lm lmkbi^l%_hkma Zmf Zmm^k 4G?A4BB -)#(!%,'2!33%802%33 ceh[jeYkhXedb_d[ É[nmma Zm]h^lgÍmf^Zgfn\ a _hk 27>824B)&IGURINGOUT-ETROELEVATORSCANBEHARD,UCKILY SOMEFOLKSAREHELPFUL Z\hglnf^k\ Zn`ambg\ nlmhf^k & 32½b¼2aX\T4\TaVT]Rh½ ]WcXb_d]5 l ^ kob\^a^ee ' Lng]ZrÍl[knmZelmZ[[bg`bg bg@^hk`^mhpgZg]ghpp^Zk^ bgma^\bmr8:k^h__b\bZelZg]ma^ A64C>F=bllmbee`^g^kZmbg` bgZlmZm^h_^f^k`^g\r'MaZmÍl f^]bZiZrbg`^ghn`aZmm^gmbhg bgoheobg`Mhgrm a^\ Zlab^k ÍlfZe& \hgo^klZmbhg%fhk^lhghpmaZm cnlmZghma^klfZ\dbgma^_Z\^_hk mh\kbf^bgZeeh_ma^\bmrÍljnZ]& => H4B _ng\mbhgbg`]^ [bm&\Zk] k^Z]^kbl ='<'Íliheb\^\ab^_%270A;4BA0<<4=CB/A4034G?A4BB2><' mh`h mhDA >?8=8>= >= C>30H½B ?>;; A^l^g]lf^mhk^`blm^k*) 'Lmbee%gh \kbf^Zg]fnk]^kl`hhgbg='<' Blma^Ê\kbf^^f^k`^g\rË /N-ETROSNEWORRENOVATEDELEVA @D4BC8>=0=364C0BC0C8>=1HBC0 C8>=1A40:3>F=>57>FH>DA54; hg^ma^k^'?b gZe er%a^aZg]lf^fr Zee]Zr^o^kr]ZrZg]Zpabm^fZg fZdbg`rhn_^^efhk^Ziik^a^g& TORS ITCANBEDIFFICULTTOTELLWHICH ;>F <4CA>A08; 2><C43 0C [Z`lZg]l ^g]lf^Zp Zr'Bmabgda^ _khfZghma^k\hngmkr`^mldbee^] lbo^Z[hnm[^bg`hnmZg]Z[hnm BUTTONYOUUSETOGOUPORDOWN A4034G?A4BB2><?>;;24=C4A?7?

7PeTh^dY^X]TS9PhI½b2aXbcP[Q^h Ç=[eh][8ki^^Wiiec[ed[ed ;XeT>][X]T R^cchTc.8½\cWX]ZX]V^UV^X]VQPRZ c^A^[[X]VA^RZ\hbT[U j^[fWohebbWjj^[M^_j[>eki[ BmÍlZeeZ[hnmma^Dkn`<3D;02WASONLINE :BCA44C1;D4B1;>6B?>C2><8BB7>2:43C70C?A4B834=C1DB770BBD270=0834>=4>5 7EDNESDAYATWASHINGTONPOSTCOM CWXbS^f]hTPaX]\dbXRfX[[RTa <0=H8=C4A4BC4334C08;B;40A=435A><C74?D1;82;H38B2;>B43F78C47>DB4?0HA>;; TOCHATABOUTNEW2" 3YD"ARRETT cPX][h_XRZd_^]0dV!!CWPc½bcWT /UTKASTSNEWALBUMAND*OHNNY#ASH SPhcWPc>dcZPbc½bº8S[TfX[S»fX[[ B^fWPcS^h^d[XZTU^aA1cWXb Sa^_ 3T[XRPcT?aTcch5TTc 3aX]ZD_ bd\\Ta8RPdVWcEP]7d]c^_T]X]V BÍfk^Zeerehhdbg`_hkpZk]mhmaZm h)FYOUJUSTGOTAPEDICURE ANDARESHOW h)TSNEARLYTWOWEEKSLATERANDWHEN) U^acWTJ1aP]S=TfL Ze[nf'Mahn`ama^raZo^Zik^m& INGPEDICUREWITHSTRAPPY CUTESANDALS WENTTODRAWACOOLBATHMYTUBSTARTED 7TPeXTbcWXbfTTZ mrbfihllb[e^mZld%_heehpbg`ni YOUNEVERWEARBECAUSEUSUALLYYOURFEET FILLINGWITHDECIDEDLY"2/7.WATER.OT T]SP]SF7>0 ln\aZ[kbeebZgmk^e^Zl^'BÍfahi^& LOOKLIKETHEYBELONGTOAZOOANIMAL THEN YELLOW TINGED NOTSLIGHTLYOFF COLORED Ehobg` OZg _ne%mahn`a%Z_m^ka^Zkbg`ÊFhkkbl WERETALKINGSTART SCARY CONTRAST TO ITWILLRAINANDRUINBOTHYOURPEDICURE Angm%Zg]B]n` ;khpg'ËMa^k^ÍlZelhZghma^kk^Zeer THE WHITE OF THE TUB BROWNv ANDSANDALSv ma^l^mZmma^23,) mZlmrmkZ\d_ehZmbg`Zkhng]bgma^ F><4=70E8=68C0;;1;>6B?>C2><;8BCB H40AF8C7>DC;867C=4C;>68BBC8;; \en[';nmblgÍmbm[Z]\hg\^km^mb& ^ma^kl%ÊB]e^pbe];en^l'Ë B><4D=8E4AB0;CADC7B01>DC;854 70E8=6CA>D1;4F8C7F0C4AB4AE8248= 0;4G0=3A804E4AB8=24C74C>AA4=C80; jn^mm^mh]hZg^g\hk^ZlZghi^g& 8]BTPaRW^UP6a^RTa A08=B>5;0C49D=4 bg`Z\m8Pab\aa^]b]'Bg_Z\m%a^ FWPcPaTcWTbP[TbUXVdaTb[^^Z lhkmh_]b]*'.^g\hk^l%k^mnkgbg`_hk X]V[XZTU^acWT]Tf9^W]]h2PbW h"ALDUCCISISABITRICHFORMYBLOOD SO Z\h]ZZ_m^kpZedbg`h__ma^lmZ`^ P[Qd\. )DPREFERTOHAVEAGROCERTHATCOULDFULFILL 01T PdcXUd[7TPS1dcc ]nkbg`ma^^g\hk^bml^e_' GhmZ[eh\d[nlm^kZehg`ma^ebg^l MYEVERYDAYNEEDS!SLONGAS)CANGET h)NTHEWORLDOFHEAD BUTTING HOWEVER HEWASSECUREDA h_ma^g^pKZl\Ze?eZmmlZe[nf% PRODUCEANDMEATSATREASONABLEPRICES PLACEINTHEGALLERYOFIMMORTALS/H ITWASAGOODHEADBUTT )COULDCARELESSHOWMUCHPRESTIGEA #ONNOISSEURSOFTHENOBLEARTOFTHEHEADBUTTHAVEVERYFEW ATbcX]_TPRTBhS1PaaTcc8f^] [nmbmlhe]^ghn`amhabmGh'*mabl GROCERBRINGSTOANEIGHBORHOODv OPPORTUNITIESTOSEEAGENUINELYWORLD CLASSPRACTITIONERIN STaXUcWXbfX[[b_dacWTaTbc^UJ?X]Z p^^d'Jnbm^ZgZ\\hfieblaf^gm' ACTION:IDANESWASACLASSICv 5[^hSLc^S^PR^]RTac. BmÍlC'<Í'l_bklmGh'*lbg\^ÊChaggr >=6?;8E8=61;>6B?>C2><2><<4=CB B_Lbk;h[@^e]h_\Zgenk^ma^f =10;3D228½B2>=B834A8=60;>20C8>= 2><<4=C8B5A446D0A380=2>D:>=I8=438=4I830=4½BF>A;3 8=?4==@D0AC4AF7827;02:B06A>24A 2D?74031DCCF7827740?>;>68I435>A>=F43=4B30H hnm_hkEbo^1%ma^gB]hgÍml^^par Z`h'BmÍlZelhabl_bklmGh'*hgma^ ghm'!Hma^kmaZgma^_Z\mmaZmma^r \hngmkr\aZkmbg+*r^Zkl'Ik^mmr ]hgÍmk^Zeer`^mZehg`'" `k^Zm%^a8 B?4=3C>>AC<0:8=60AC 0acXbP[[X]cWTThT^UcWTQTW^[STaP]SaT[ PcXeTP]SRP]QTP]hcWX]VP]SQ[PWQ[PWQ[PWB^fWh_dcc^]b^UcX\TX]c^\PZX]VXc. 8]bcTPSYd\_^]cWTºFTQPac»\^eT\T]c^]TbdRW_XTRTPcbTRaTccTRW]^[^VhR^\ C>30H>=;8E4>=;8=4)FPbWX]Vc^]?^bcFWXcT7^dbTaT_^acTa=½C SXbRdbbTbcWT[PcTbcQdiiX]FPbWX]Vc^]Pc P\kfPbWX]Vc^]_^bcR^\[XeT^][X]T C7DAB30Hk & "! %k4G?A4BBk""

1XiP aa^u=ZgIbkZkh 2^ a]TaTSuFbd^ ;Ze]pbg #OLLABORATEWITHOTHERSIFYOUSOCHOOSE 7^a^bR^_T BUTREALIZETHEREARECERTAINTHINGSYOU CANONLYDOONYOUROWN INMOMENTS OFS OLITUDE 7nHiZaaVL ^ aYZg 20?A82>A=3TR!!9P] (3OMEONE 20=24A9d]T! 9d[h!! )TSTIME MA YBEK EEPI N GI M PORTANTI NFORMATIO NFR OM TOWORKMORECLOSELYWITHOTHERS YOU)FTHATSTHECASE YOULLHAVETOMAKEA #OOPERATIONCANINCREASEYOURCHANC KEYDECISIONBASEDSOLELYONINSTINCT ESOFSUCCESSANDBRINGGREATERREWARDS 0@D0A8DB9P]! 5TQ ' 4HE MORE YOU THANYOUEXPECTED SAYTHEMOREOTHERSARELIKELYTOPASSYOU ;4>9d[h!"0dV!! +EEP YOURSPIRITS BY3PEAKONLYWHENYOUINSISTONBEING UP ANDY OUCANBEASHININGEXAM PLETO HEARD ANDYOULLBESATISFIED OTHERSWHOSESITUATIONSARENOTNEARLY ?8B24B 5TQ ( 0dV!"BT_c!!9OUCANIMPRESS SOWEL L FOR Y O U MA Y BEW ORTHASEC OND OTHERSWITHWHATYOUDONTDOJUSTASDRA TRY9OUCANPUTONAGOODSHOW MATICALLYASWITHWHATYOUDO4HINGS 0A84BRc!! $ONTIGNOREOR CHANGEIT ,EAVEWELLENOUGHALONE AND DISCOUNTMESSAGESANDSIGNSTHATYOU ENJOYTHEFRUITSOFYOURLABORS DONOTUNDERSTAND$ O EVERYTHINGY OU C0 DADB 0_aX[! < P h! 9OURELIKELYTO CANTOINCREASEAWARENESS GETMORETHANYOUBARGAINEDFORFROMA B2>A?8>>Rc!"=^e!  !TRENDIS ,IBRANATIVEWHOHASBECOMEINVOLVEDIN CONTINUINGTHATALLOWSYOUTOTAKEFUR YOU ROW NAFFAI RSATT H EWO RKPLACE  ?^^RW2PUTuIZne @beeb` Z g THERADVANTAGEO FCIRC U M STANCEST HAT 64<8=8

lmZg]bg` Zlma^khe^ fh]^emaZma^ ;TccTab bl%ghklahne]bmieZ\^abfZfhg ` ma^ebd^lh_Fbd ^MrlhghkE4 A064!^li^\bZee rFZmm phne]cnlmb_rabl[^aZobhk%\ho^k & Lp^glhgÍl\henfgMn^l]Zr"bg Z`^Zeeho^kma^phke]aZlk^ihkm & >qik^llho^kma^a^Z]&[nmmbg` ^] hgFZm^ kZssbÍlbglnemh_Sb]Zg^ Íl ?TPa[b1 TU^aTBfX]TuLm^i aZ gIZlmbl bg\b]^ gmZmma^Phke]MFG Zmae^m^% ]h^lbg ghpZr]bfbgblaabl PZlabg`mhg%='<'

FA8C4C>4G?A4BB) 8]R[dST]P\TW^\Tc^f]P]ScT[T_W^]T]d\QTaBdQ\XbbX^]b\PhQT TSXcTS 4\PX[c^X]Q^g/aTPSTg_aTbbR^\^a\PX[c^4g_aTbb;TccTab?> 1^g &"& 0a[X]Vc^]E0!!! %

C^SPhX]7Xbc^ah

u@e^ggF\


(&& HOURSHITTHE.EW9ORK !00(/4/ #ITYAREA &ORD-OTOR#OPRESIDENT,EE)ACOCCA ,EE)ACOCCAWASFIREDAS WASFIREDBYCHAIRMAN(ENRY&ORD) ) (&'PRESIDENTOF&ORD-OTOR #OBYCHAIRMAN(ENRY&ORD) ) PLACETORAISEMONEYFOR!FRICASSTARV h,IVE!ID vAN INTERNATION INGPEOPLE ('$ ALR OCKCONCERTIN,ONDON "EIJ INGWASAWARD EDTHE 0HILADELPHIA -OSCOWAN D3YDNEY TOOK ! /LYMPICS "#k4G?A4BBk & "! %kC7DAB30H

A4CA> *ANICE$ICKINSON 2WTah[CXTVb COULDKICKBOTH ATVPX]bcWT THEIRBUTTS D__Ta7P]S Lni^kfh]^e obhnlerfZkkb^] 27A8BC841A8=:;4H mhC^Zg&?kZg hbl Zg]_hnkmaanl[Zg] :eeZnq%lbg`^k;beer I^m^k

!0 kZm^]'ÊR^l%bmÍlmkn^'Ma^ Kb\aZk]MZn[fZg'La^ .OWTHEVEGEMELONHASCREDIBILITY \hnie^aZll^iZkZm^]%Ëin[eb& Zg]Ch^eaZo^Z]Zn`am^k%Zg] \blm>eebhmFbgmslZb]'C74>B8B ;kbgde^rfZkkb^]bg*22/Zg]aZo^ bff^]bZm^\hg\^kgbl_hka^k\abe& CPbcT\PZX]V6^Sb1Tbc^f Z]Zn`am^k';kbgde^r%.+%pZlik^& ]k^g%ËFbgmslZb]'0? 6aPRTD_^]D]W^[h7hQaXS :lA468B?78;18=lmkn``e^]pbmaabl lZemZg]i^ii^klaZd^kl%:4;;HA8?0 ?A>2A0BC8=0C8>= mZlm^]ma^EhnblbZgZ&`khpgh]]bmr >W9dbc6Tc8c>eTaFXcW \Zee^]Zo^`^f^ehg'Ma^gla^mhhd KZii^k5>GH1A>F=%\aZk`^]pbma Z[bm^'ÊBmÍl`hh]%ËlZb]KbiZhg ZllZnembg`mphgZbelZehgphkd^kl P^]g^l]Zrfhkgbg`ÍlÊEbo^pbma ho^kma^\hlmh_ZfZgb\nk^%aZlaZ] K^`blZg]D^eerËlahp'BmÍlebd^Z a^kmkbZe]^eZr^]ngmbeg^qmfhgma' Êe^ll&lp^^m\ZgmZehni^ËmaZmphne] ;khpglahp^]niP^]g^l]Zrbg

[^Êo^kr`hh]pbmaoh]dZ'Ë0? #(2)30)::%,,/!0 FZgaZmmZg==0 ,/5)3,!.:!./!0 ikhm^\mbhg_hkma^gZbephkd^kl ¼FTXaS .OMATTERHOWLONGSHEPUTSITOFF THIS Z`Zbglm;khpg'0? 0Q^dc= 3O 3>==070=>E4A 2PVTUXVWcGGGG½ B[^cWUd[7^dbT7dbQP]Sb BEAUTI pZl ]bohk\^] &ANSOFh4HE3IMPLE,IFEvWILLBESEEINGMOREOFEX FRIENDS?0A8B AdX]TS4eTahcWX]VU^aF^\T] FUL AND _khfKn]heia 78;C>=AND=82>;4A82784%WILLAIRAFIFTHSEASONOFTHESERIES Ê>o^krphkdbg`fhfblZlni^kphfZg%ËNfZ SOWISE @bnebZgbZ_m^ka^ WHICHSHOWSTHECELEBUTANTESINEVERYDAYSITUATIONSWITHREAL MankfZglZrlbgma^ni\hfbg`blln^h_IZkZ]^' \a^Zm^]hga^k PEOPLE4HESHOWMOVEDTO%AFTER&OXCANCELEDIT!NEWFORMAT Ê?hkfhlmh_ma^phke]%bmÍlk^ZeerZ Z_m^k+)r^Zklh_ ALLOWSTHEFEUDINGFRIENDSTOHAVENOTHINGTODOWITHEACHOTHER g^\^llbmr'Ma^lmZr&Zm&ahf^fhf fZkkbZ`^'La^eZm^kk^dbg]e^]eho^ h4HE3IMPLE,IFEˆTIL$EATH$O5S0ART vWHICHAIRS3UNDAYS blho^kghmcnlm[^\Znl^h_phf^gÍl pbmaZab`al\ahhelp^^ma^Zkm'Ghp% PM HAS(ILTONAND2ICHIEˆINSEPARATESCENES OFCOURSEˆ eb[^kZmbhg[nm[^\Znl^h_f^gÍl AZgho^kblinmmbg`maZm^qi^kb^g\^mh PLAYINGAhWIFEvANDRUNNINGAHOUSEHOLD0? eb[^kZmbhg_khfpZgmbg`mh[^ nl^ZlZg:HEEho^ L^q



C7DAB30Hk & "! %k4G?A4BBk"$ DONATE your CAR 888-272-6728 www.carshelpingpeople.org

0aT]½cH^dBfTTc.

02A>BB #APTAINAND 3PANISH 4ENNILLETITLE MUNCHIES  4OKENROOM 6EGETABLEOR  $ROPSTHEBALL TOMATO EG  0IE MODELINK  )NDUSTRY  "IRDINACRAZY MAGNATE SIMILE GRAPHIC& DESIGN multimedia  #OMEUP  (ARD TO  ,HASA??? PRONOUNCEWORD  -EMORABLE  6ENDED 2OBINSONROLE  *AI??? Call Today  0ATTYOF  &AMOUS"UTLER h0EANUTS  3ANCTION 1-866-811-6459  3OMEQUEENS  )CARUS EG APPENDAGE  DEGREES TO  ,EEAND MARINERS 4EASDALE  5NSPECIFIED www.westwood.edu AMOUNT 3>F= Annandale 7619 Little River Turnpike, 5th Floor • Annandale, VA22003  )TALIANBOWLING  'IVEAPOINTTO Arlington Ballston 1901 N. Ft. Myer Drive, Suite 300 • Arlington, VA22209 GAME 2OCKCONCERT Accredited by the Accrediting Commission of Career Schools and Colleges of Technology (ACCSCT). Westwood College - Arlington  3PANKYANDTHE VENUE SOMETIMES Ballston (Arlington, VA) is a Branch of Westwood College - Long Beach (Torrance, CA) and has been certified to operate in Virginia GANG 0LUMBERS by the State Council of Higher Education for Virginia (SCHEV). Westwood College - Annandale Satellite (Annandale, VA) is a satellite campus of Westwood College - Arlington Ballston (Arlington, VA), a branch of Westwood College - Long Beach (Torrance,  #OMPANYCAR CONCERNS CA) and has been certified to operate in Virginia by the State Council of Higher Education for Virginia (SCHEV). EG 6IPER Not all programs offered at all campuses.  3CREECH FORONE "OARDSWITHUPS  6ARIETIESOFNUTS ANDDOWNS  3UPER"OWL6 h$YNASTY %$)4%$"94)-/4(9%0!2+%2 WINNERS ACTRESS AMERICAN UNIVERSITY  0ICKTHEPICKOF 3HERIFF4AYLORS HARDTOSWALLOW  #HARACTERIN THELITTER EG BOY  &ALSIFY INAWAY GANGSTERFILM HTbcTaSPh½bB^[dcX^] KOGOD SCHOOL OF BUSINESS  0REFIXFOLLOWER -ILBRANCH  !USSIEHOPPERS SPOOFS  )TEMOFFINALITYIN 0ERSONAL BRIEFLY  3UBURBANITE ON THEPAPER BRIEFLY TRAINERSTARGET  )TSADRAG SOMEAUTUMNDAYS  )NSANELY  *IM DANDY  'OBLETFEATURE  0RINCE6ALIANTS  )TMAYBE  6ITAMINADDITIVE  "ALLPLAYER4Y WIFE DELIVEREDATA SOMETIMES  3HAWMFOLLOWER  3OMEPASTRIES NIGHTCLUB  /PENERON  -AUGHAMSh???  &URTHERMORE  .OTEDCLOWN "ROADWAY OF,AMBETH  &ISCHERSCASTLE  !SSOCS  'IFTFORADIVA  2EINERAND  !CAFFEINE  $EEJAY#ASEY PERHAPS 0ERKINS SOURCE  %PITOMEOF  'REATTHINGTO  3ASKATCHEWAN  -C'REGOROF THINNESS BEON CITY h4RAINSPOTTING Is Your Career on Track?  0ENNAME  2OYALSYMBOL  -UGS  (ESTUNGLIKE  -AMAOFPOP  #IRCUS  ,AUNCHSITE ABEE Apply today, or join us for an information session. MUSIC CONFECTION  $UEL  h3O THEREYOU  7ORDINA  4HEYMAYBE PERSONALITY ARE MBA Information Sessions Tuesday, July 18 Bd k S^ k Zd $EGREEOF$IFFICULTY(!2$ Tuesday, August 8 6 - 8 p.m. &ILLINTHEBOXESSO EACHROW COLUMN AND BY SQUARE HTbcTaSPh½bB^[dcX^] MS in Accounting Information Session INCLUDESTHEDIGITS Wednesday, July 26 THROUGH&ORSOLU TION TIPSANDCOM 6 - 8 p.m. PUTERPROGRAM SEE WWWSUDOKUCOM MS in IT Management Information Session Wednesday, August 2 =TTS\^aT BdkS^kZd. 6 - 8 p.m. &INDANOTHER3UDOKU PUZZLEINTHE#OMICS SECTIONOFTHE0OST Free parking or take Metro to AU/Tenleytown and EVERY3UNDAYANDIN THE3TYLESECTIONEV the AU shuttle to main campus. ERY-ONDAYTHROUGH

3ATURDAY ¥05::,%3"90!00/#/- Currently accepting applications for Fall 2006 advanced degree programs.

?D1;8B74A¹27A8BC>?74A <0 k 64=4A0; <0=064A¹0A=84 0??;410D< k 438C>A¹30= 20220E0A> k 34?DCH 438C>A¹6A46 10A14A 0AC 38A42C>A¹B2>CC <220AC7H k =4FB 438C>A¹<0CC BF4=B>= k B42C8>= 438C>AB¹94==854A 10A64A 0A8>= 14A64A E82:H RSVP Today  70;;4CC 80= 74A14AC <0DA44= 7>27 27A8B <8=274A 7>;;H <>AA8B :A8BC4= ?064:8A1H 208C;8= C7>= k F41 438C>A¹ <82704; 6A0BB k 438C>A80; 34B86=¹B2>CC A>B4=14A6 k ?A>3D2C8>=¹<0C74F ;8338 k ?7>C>¹<0A280 70A34A k ?7>C>6A0?74A¹<8274;;4 A4?8B> k Call 202-885-1913 2>=C4=C 34E4;>?4AB¹C8< 5>;;>B 30A>=0 F8;;80=B2>1>G &"& 0A;8=6C>= E0 !!! % k 0 BD1B8380AH>5C74F0B78=6C>=?>BC2>=)! !""#%((!>A4<08;28A2D; Email [email protected] 4400 Avenue, NW 0C8>=/A4034G?A4BB2><k03E4AC8B8=6)20;;1>1:44=0=0C! !""#% !$>A4<08;03B/A4034G?A4BB2><k2;0BB8584303E4AC8B8=6)! !""#%! Visit kogod.american.edu/grad Washington, D.C. 20016 EO/AA and Employer University 36 EXPRESS 7.13.2006 THURSDAY XEINETEDSRC’ OTMNMNA SUNSETS. MONUMENTAL MOST DISTRICT’S THE EXPERIENCE pn umreeigo h ooa.Dnn.Dnig iemsc ouetlviews. Monumental music. Live Dancing. Dining. Potomac. the on evening Summer a Spend OKYU UMRSNE RIETODAY. CRUISE SUNSET SUMMER YOUR BOOK umrSne inrCus akg includes: package Cruise Dinner Sunset Summer Trehu vn etrn w-orcruise two-hour a featuring event —Three-hour Odyssey.com Setclrveso h ainsmonuments nation’s the of views —Spectacular Lgtfo tto inrmenu Dinner station food —Light Lv entertainment —Live 888/822.5997 UMRSNE SERIES SUNSET SUMMER uy2t,Ags s 8th & 1st August 25th, July M V 7bie"j^[Ybei_d]e\W]h[WjDWj_ed1J^[Heeji"F^WhYoZ[WdZJWb_XA[mb_edjekh

Ild H^YZh D[i]Z Hdji] C742>;>A>5<>=4H) CWT3aXeT1h BWT½bb\PacTacWP] CadRZTabP]S h^daPeTaPVT_^_cPacu4$ cWTB^dcWTa] SdP[Xchu4(

#/524%39,!&!#% • • TANGO • FOXTROT • WALTZ • CHA CHA • SALSA • RUMBA • MERENGUE • SAMBA • MAMBO • SWING • HUSTLE • NIGHTCLUB • TANGO • FOXTROT • WALTZ • CHA CHA • SALSA • RUMBA • MERENGUE • SAMBA • MAMBO • SWING • HUSTLE • NIGHTCLUB • TANGO • FOXTROT • WALTZ • CHA CHA • SALSA • RUMBA • MERENGUE COUNTRY & WESTERN

25% OFF • D DanceDaannccee TTheThhee TANGO • NN Nightiigghhtt AAAway!wwaayy!! WWW.ARTHURMURRAYDC.COM FOXTROT •

What you do on the dance floor is our business! WALTZ Classes

Columbia, MD Silver Spring • Hwy 29 N. Alex/Landmark Tysons Corner Bethesda Gaithersburg •

Forming Now Opening Soon! 301-681-4466 703-751-4336 703-556-0088 301-657-2700 301-590-0387 CHA

• SALSA • RUMBA • MERENGUE • RUMBA • SALSA • CHA CHA • WALTZ • FOXTROT • TANGO • NIGHTCLUB • TLE HUS • SWING • MAMBO • SAMBA • MERENGUE • RUMBA • SALSA • CHA CHA • WALTZ • FOXTROT • TANGO • GHTCLUB NI • HUSTLE • SWING • MAMBO • SAMBA • MERENGUE • RUMBA • SALSA • CHA CHA • WALTZ • FOXTROT • TANGO • • FOXTROT • WALTZ • CHA SALSA RUMBA • MERENGUE • WALTZ • FOXTROT 4!k4G?A4BBk & "! %kC7DAB30H ^]cWT b_^c ºFTbXc

=0<4)

6A8=3)-S%LFMANCANBRING'AFFNEYSMONEYTOHISREADING4HURSDAY Rhn\Zg[nrZikh`kZf_hkZ\hnie^ abl_bklm[hhdbgpab\aZefhlmZee H^d½eTcPaVTcTS]XRWT_dQ[XRPcX^]b h_ang]k^][n\dlmaZmieZrl\a^ll ma^phk]lZk^ahkbshgmZe' fXcWcWT\T_dii[Tb8c½bP__P[[ 8c½bWX[PaX^dbfWT]h^dd][^PS^]P VTc^dcb^daRTSc^\PRWX]Tb. Zmma^e^o^eh_hk[^mm^kmaZgfhlm X]VcWPcCWT=TfH^aZCX\Tb_Phb STPSQTPcbZPcX]V\PVPiX]TTSXc^a) Gh'Ma^\khllphk]\hglmkn\mhk `kZg]fZlm^kl%[nmi^hie^lmbee H^dRP[[h^dabT[UPRadRXeTaQP[Xbc  "$_TaSPX[h_dii[T[TbbcWP] º;^Xb4[U\P]XUh^d½aT^dccWTaT ch[pbeeg^o^k`hhnmh_[nlbg^ll% aZo^\a^llmhnkgZf^gml'MaZm_Zl& 0aT]½ch^dPUaPXS^UeX[[PVTabbW^f CPQQXTb\PVPiX]T h^dbcX[[^fT\T &$h^dQXcRW» cnlm[^\Znl^mphh_ma^mak^^iZkml \bgZm^lf^'B`n^llma^rlmbeeaZo^ X]Vd_fXcWc^aRWTbP]S_XcRWU^aZb. B]hgÍmfZd^insse^l_hkMa^G^p Bahi^la^k^Z]lmaZm'MaZmpZlZ anfZglhger\Zg]h%pab\ablma^ knggbg`kZ\^l%^o^gmahn`a\Zkl BmÍlaZii^g^]%Zg]rhncnlme^Zkgmh RhkdMbf^lZgrfhk^'BaZo^gÍmpkbm& mbf^pa^gBk^Zeer\hne]Ío^nl^] \en^lZg]\hfbg`nipbmama^f^l' ^qblm'I^hie^lmbeepZgmmhl^^paZm ebo^pbmama^iZbg' m^ghg^_hkma^fbglbqr^Zkl%fZr[^' ma^*0.[n\dl''''Pa^k^^el^ZfB :g]^o^gmaZmmabk]iZkm%maZm\hf& anfZgl\Zg]h'6;4==38G>= ;nmbm[hma^klf^':g]Bphne][^ `hggZl^eeZ_b`nk^&ldZmbg`\khll& inm^klZk^]hbg`[^mm^kZg][^mm^k% CWTf^aSS^Tbb^d]SbX]XbcTa o^kraZiirb_mabl[hhdlaZf^] phk]8 h_p^Zobg`ma^`kb]ma^fl^eo^lÉ ¨;hk]^kl%*1)*DLm'GP4Man'% BmÍlZlbgblm^kikh_^llbhg'P^lbm ma^fZgZ`^f^gmh_Ma^G^pRhkd rhnlmbeeg^^]ZanfZgpahdghpl /3,)i'f'%_k^^4+)+&-//&-222' Zkhng]mabgdbg`h_pZrlmh_hhe Mbf^lbgmhiZrbg`fhk^' FX[[Ra^bbf^aSQdX[SX]VTeT]cdP[[h paZmma^rÍk^]hbg`mhk^Zeermp^Zd !?ZkkZ`nmGhkma(?ZkkZ`nmP^lm" Join Us at the 13 th Annual Howard County POW WOW and SHOW

SATURDAY and SUNDAY SINGING SERVERS JULY 15 th and 16 th , 2006 Howard County Fairgrounds EVERY NIGHT West Friendship, MD • Gates open 11am on Saturday and Sunday • Grand Entry Noon “Parade of Nations” • Crafts, Jewelry, Native American Food $1 off • Beadwork, Rugs, Paintings, Moccasins adult ticket • Tipi Setup, Pony Rides & more • Face painting for children & others with this ad • Special guest Native American Flutist: Tsa’ne Do’se • Featuring Aztec Dancers RAIN* or SHINE Contact: The Show Promoter at 252-257-5383 or Howard County Fairgrounds 410-442-1022 [email protected] *If rain the event will be in the MAIN EXHIBITION HALL of the Fairgrounds 2120 P ST NW (DUPONT CIRCLE) I ENTERTAINMENT USUALLY STARTS AT 7PM FOR RESERVATIONS 202.464.6464 I MIMISDC.COM Adapt you. “Personal Tech” can give you cool and useful tools. Mondays.

X017e 5x1 C7DAB30Hk & "! %k4G?A4BBk4" 4]cTacPX]\T]ckFTTZT]S?Pbb

7^cCXRZTcb BZiVaÉhIZX]c^XVaHjeedgi #/.#%243 3(/73%6%.43/.3!,%./7 BWPS^fb5P[[\TaVTb fbllMankl]Zrgb`amÍllahpÉma^ LaZ]laZo^ghmieZr^]lbg\^eZlm cWaPbWSTPcW\TcP[ lnff^kZg]ma^bk\hngmkrpb]^ P]Sb^\T\PSbZX[[i mhnkbg`ieZglbglniihkmh_ma^bk eZm^lmlmn]bhh__^kbg`%Ê?Zeehnm

Lmka^llÉMhnk' ÊHnk[nlrl\a^]ne^hgerZeehpl ,!52%.4'),,)%2/.!0 ?hkmahl^ng_ZfbebZkpbmama^ nlmh]hhg^jnb\dmhnka^k^bgma^ B0=C0=0.ISSAN0AVILION 3EPT FZllZ\anl^mml&[Zl^]jnbgm^m%ma^ LmZm^l[^_hk^p^lmZkmphkdbg`hg TICKETSGOONSALE&RI   [Zg]\hf[bg^l^e^f^gmlh_aZk]& ma^g^qmZe[nf%lhp^Ík^`hbg`mh    \hk^%Lp^]bla]^Zmaf^mZeZg]Í1)l ieZrlhf^lhg`lp^Ío^g^o^k]hg^ ¼0=4=45C74?4>?;4½/LNEY makZlaf^mZemh_hkfZaZk]&kh\d [^_hk^%Ë^qieZbg^]?Zbk'ÊP^pZgmmh 4HEATRE#ENTER *ULY !UG ar[kb]'Bgma^^Zker+)))l%Zlhg\^& fZd^lnk^maZm^o^krhg^%bg\en]bg`     ihineZkkZif^mZeZ\mlebd^Ebfi hnkl^eo^l%aZlZ`k^Zmmbf^Zm^Z\a A0=283"LACK#AT !UG 

;bsdbmlmkn``e^]mhfZbgmZbgma^bk #/524%39!4,!.4)# lahp'Ë6A46>AHA4    _Zg[Zl^%LaZ]hpl?ZeeÍlab`aerm^\a& =824>5H>DC>3A>?8=)-ETALBAND3HADOWS&ALLISDOINGPRECIOUSFEWLIVEDATES B74AH;2A>F9>7=<0H4A gb\Zelmre^`Zbg^]ma^Z\\^imZg\^h_ ¨23,)

National Symphony Orchestra Emil de Cou, NSO@Wolf Trap Festival Conductor Leonard Slatkin, Music Director Carmina Roméo et Juliette PLAY! and The Ring in Concert A Video Game Symphony Emil de Cou, Stephen Lord, conductor. Arnie Roth, conductor. Vocalists from the Wolf Trap conductor; THIS Maureen McKay, Opera Company. A semi-staged The Master NEXT WEEK! soprano. Javier performance of Gounod’s opera Chorale WEEK! Abreu, tenor. based on Shakespeare’s tragic of Washington, Weston Hurt, love story. Sung in French with Donald baritone. English supertitles. McCullough, The Washington Chorus, Robert Saturday, July 22 music director. Award-winning music from Sonic the Hedgehog, Shafer, music director. Orff’s at 8:15 p.m. thrilling Carmina burana, plus World of WarCraft®, Battlefield 1942, orchestral excerpts from Wagner’s and other blockbuster video epic Ring Cycle and Shore’s games, accompanied by outstand- film score for Lord of the Rings. COMING IN AUGUST ing graphics on giant screens. Thursday, July 20 AUGUST 3: Renée Fleming Friday, August 4 at 8:15 p.m. AUGUST 5: The Wizard of Oz at 8:30 p.m. Terrace Theater Tickets $40 & $45 at the Box Office or charge by phone (202) 467-4600 Order online at kennedy-center.org Groups (202) 416-8400 Theater at the Kennedy Center is presented with the generous support of FOR TICKETS: 1(877)WOLFTRAP | WWW.WOLFTRAP.ORG Stephen and Christine Schwarzman.

The Kennedy Center welcomes patrons with disabilities. 4 EXPRESS 7.13.2006 THURSDAY [email protected] 866.658.4970 Call $300’s low $300’s. the high from the Townhomes from setting. homes historic family a Single in homes award-winning National Idlewild Fredericksburg of City [email protected] 800.961.7129 Call $400’s lots low scenic the on from homes family single Luxury Hills Carriage [email protected] $600’s mid 800.961.7124 the from Call sites acre 1 homes on family single Golf style Estate • Virginia Celebrate at Estates Battleground [email protected] 800.961.7089 Call $300’s low the from townhomes garage bedroom, 3-4 Square Courthouse County Stafford [email protected] 800.961.7148 Call $300’s high the from condominiums Lakes style Townhome Fair at Market East County Fairfax ahntnDC nbt otenVrii n ayad oepie ag rmtelw$0’ ote$700’s. the to $200’s low the from range prices Home Maryland. and Virginia Northern both in D.C. Washington er oeaotoraadwnigsnl-aiy on n odmnu omnte,lctdaround located communities, condominium and town, single-family, award-winning our about more learn W aeaottepol h u u oe ogatrteslspoesi vr oevstu and us visit Come over. is process sales the after long homes our buy who people the about care e V IRGINIA [email protected] 800.961.7149 Call $500’s low the from garages acres detached 1+ additional on with homes family single Luxury Crossing Stuart’s [email protected] 866.658.4999 Call $400’s low the homes from manor and family Single Parke Lee’s County Spotsylvania [email protected] 866.658.4992 Valley Call Shenandoah the in $300’s the from high homes family single Large Ridge Musket [email protected] 800.961.7145 Call $200’s mid townhomes the level from 3 bath, 2.5 4-bedroom, Court Hamilton [email protected] $300’s high 800.961.7143 the Call from acres homes 1/4+ family on single style estate Spacious Steeplechase City Winchester/Stephen’s tstm o agta caught you time It’s oebyn break... buying home 2 06 .9 aebsda51AMwt -- udw.1tya ae=29% n rrt .9,3dy ae= sales rate See yr documentation. 3rd full 3.99%, and = score rate credit yr 680 2nd to 2.99%, subject = 31, Rates rate August 6.743%. year by = 1st settle APR Buydown. 5.99%. that 3-2-1 = details. contracts a rate for new artistic with yr counselor to for ARM 5th applies are 5/1 and Offer rendering a Title. 4th and based and 4.99%, Photography rate Mortgage notice. 2.99% Ryland without using change 2006. to to tied subject *Incentive terms only. and purposes Prices welcome. Co-op Broker [email protected] 866.463.0809 Call $200’s mid $300’s the mid from Townhomes the from homes family Single Westbury County Mary’s St. [email protected] 800.961.7349 Call $500’s low the from homes family single Luxury Vineyards The [email protected] 800.961.7318 Call $300’s low the from condominiums style Townhome Place Watkin’s [email protected] 800.961.7153 Call $500’s high the from homes family single Luxury Fairwood County George’s Prince M ARYLAND . 99 uuysnl aiyhomes family single Luxury Ridge Taylor VA County, Shenandoah condominiums style Townhome Center Market VA County, William Prince oe vial Now! Available Homes ii hs communities these Visit n ayohr online others many and twww.Ryland.com! at usa Sna 0mt 6pm to 10am -Sunday Tuesday C l ae etr Open Centers Sales All OMING ody2-6pm Monday Rate Interest % S OON C7DAB30Hk & "! %k4G?A4BBk4$ 4]cTacPX]\T]ckFTTZT]S?Pbb C^_ Bc^_b

5>A2>=?>BC2><4=C4AC08=<4=C

0U^a\Ta_^_cPacfXcW ÊLmnib]@bkel%Ë_hkZeema^bk^`k^`bhnl =diE^c`fZm^kbZeblfZg]oZib]\hf^&hgl% P\QXcX^]bR^]U^d]Sb ma^gieZrlnima^FZm^kbZe@bkekhe^ P]SST[XVWcbWTaUP]b hgÊÍ

^f^k`^]hnmh_ma^eZm^&Í2)lm^^g& Z[hnm[ebg`[kZ``Z]h\bh' 02%34/.+%2%3470 ihi\hg_^mmb^qiehlbhg%Ibgdk^fZbgl BmÍl\e^ZkmaZmIbgdpZgmlmhlahp h'ARCON WEVEBEENWAITINGFOROUR hg^h_ma^lfZkm^lmZg]fhlmngik^& ahp^fhmbhgZeerZg]ilr\aheh`r WATERFORALMOSTSECONDSNOWv ]b\mZ[e^h_ma^ehm' \hfie^qla^bl'La^Ílg^^]rZg] :_m^kma^ln\\^llh_a^k+))) [khd^ga^Zkm^]hgÊPahDg^pË FPXcTab½APRT) ]^[nm%Êo^gmahn`abm ATP[Xch?Pach BWTR^d[S fZd^lgh]bk^\mk^_& P^Ík^ghmlnk^pahfb`am[^ln__^k& ^k^g\^lmhAnkkb\Zg^ bg`_khfZgZ[l^g\^h_ma^\Zlmh_ WPeTR^]cX] DZmkbgZ!pab\aaZl FMOÍlÊEZ`ngZ;^Z\a%Ë[nmb_rhn dTSc^_[Ph liZpg^]fZgr[Z]er dghpZgrhg^pahfbll^lDkblmbg pkbmm^gikhm^lmlhg`l"% Zg]'''maZm[ehg]^Zg]%na%maZm cWTZXRZQ^g la^`bo^l=n[rZma^ hma^k`nr%ma^\nm^hg^%ma^rÍee[^ fb]]e^_bg`^kpbmama^ ZmA+)_hkZf^^m&Zg]&`k^^m' X]VX]VT]dT [Z\daZg]^]\hfiebf^gm% A+H%1))PZm^kLm'LP4?kb'%2i'f'% ÊRhnÍo^\hf^Zehg`ZpZr% *.4+)+&-1-&/,))' l^^fbg`erbgm^gmhgk^\eZbfbg` _khfpabld^rZg]\h\Zbg^Ë kh\d_hkZeema^[kZmmrldZm^[hZk]& Mhpbmg^llahpZeeh_ma^l^ BdbP]2^fbX[[) ^klbgln[nk[Zg:f^kb\Z%bm]b]gÍm ]b__^k^gmbfinel^lng_he]mabl 5[hX]VB^[^ k^Zima^\hff^k\bZek^pZk]l Lng]ZrZmma^23,)7=

[^`bggbg`h_hnkÌk^eZil^ÍhkpaZm^o^k rhnpZgmmh\Zeebm%Ë

= mhikhm^\mFbee^kpabe^i^kfbmmbg` BmlhhgieZr^]bml_bklm='<']Zm^bg lhng]fZg(mZi^fZgbineZmhk;h[ blmaZmbg+))-Zg]Z`Zbgmablr^Zk% ma^[Zg]ma^^\\^gmkb\_nkrmaZm g^Zkermph]^\Z]^l' P^lmhg%ma^jnZkm^m]n[[^]maZm ma^rphne]]khiieZmm^klmaZmieZr ¨;eZ\d5A40B>=B 0UcTacWXbfTTZT]S iZkmb^l%Zg]ma^\nlmhf^klaZo^aZ] Z`k^Zmmbf^'Ë:g]bgd^^ibg`pbma cWTB^dcWTPbcR[dQ ma^\en[Íli^klhgZ%;hre^Zg]\k^p [P]S\PaZXb]^\^aT aZo^]^\b]^]mh\ehl^GZmbhgpbma Zlhgb\[hhf' >DC01>DCkMablp^^d^g] Mankl]Zrmakhn`aLZmnk]Zr% fZkdlma^^g]h_Zg^kZZlGZmbhg% ikhfhm^kl_hk:e\a^fr(:'E'B':'L% PZlabg`mhg%='<'ÍleZk`^lm]Zg\^ <—[bdZg]O^eo^mGZmbhgk^li^\mbo^& \en[%\ehl^lbml]hhkl_hk`hh]bg erpbeeZeeahlm\ehlbg`iZkmb^l':g] ma^gZf^h_nk[Zg]^o^ehif^gm' Ê[^\Znl^\hg\^kmlZk^lhfn\ah_ IeZgl_hkma^g^pGZmbhgZel[Zl^& paZmma^r]hZmGZmbhg%ËlZb];hre^% [ZeelmZ]bnf\Zee_hkma^\en[Zg] ma^[Zg]Fbg]e^llL^e_Bg]ne`^g\^ lnkkhng]bg`[nbe]bg`lmh[^mnkg^] pbee[^hgaZg]Fhg]Zr_hkhg^_bgZe bgmhh__b\^[nbe]bg`lÉZ]^o^ehi& gb`amh_ngbgab[bm^]]Zg\bg`' f^gm\h&hpg^kCbf;hre^lZb] :g]_hkmahl^\en[&`h^klpah

pZlgÍmg^\^llZkberpaZma^pZgm^] -)#(%,,%2%0)3/%802%33 lZrma^rÍeeg^o^k]Zg\^ma^lZf^ mhl^^aZii^gmhma^o^g^kZ[e^\en[' .ATIONCO OWNER*IM"OYLECLAIMSTHE Z`ZbgpbmahnmGZmbhg%]hgÍmmakhp ;hre^lZrlma^fhh]Zfhg`lmZ__^kl VENERABLECLUBISDOWNBUTNOTOUT hnmma^he]=0F8;;80Zlm4\ehlbg`iZkmb^l # 8BC74=4F"&)4HE3PECTRUM'ALLERYISCELEBRATINGITSTHANNIVERSARY Bgbml]^\Z]^h_^qblm^g\^%GZmbhg blmlZl_ZkZl\hg\^kml%Zeema^mhi Man'&LZm' Fhg'4+)+&..-&*.))% ITSNEWLOCATIONND3T.7 ANDANEWEXHIBIT h#ELEBRATE7ASHING aZl[^^gk^oZfi^]Zg]k^gZf^] =Clbgma^phke]%lhf^ehg`&knggbg` ikbfZ\r\hfiZgb^l'\hf(gZmbhg' TONv&ULVIA-USTI #IARLASh4HE#APITOL vABOVE CELEBRATES WELL YOUKNOW 8 EXPRESS 7.13.2006 THURSDAY Y NCABRERA RYAN POWTER DANIEL Katie Melua Cracker FEATURING STRHESS TOUR Closed for Donavon Frankenreiter TEDDY GEIGER TRICKY X /ROLLINSBAND JURASSIC 5 MAE The Clarks Numan Gary PRETENDERS THE RENTALS THE WRECKERS THE MN8 PRESENTS Breaking Benjamin Editors Candlebox Butch WalkerandtheLet’s-Go-Out-Tonites I SELASSIE MAJESTYHAILE IMPERIAL HIS OF BIRTHDAY THE CELEBRATE TO emmet swimming Secret Machines SHADOWS FALL ISRAEL VIBRATION Eric Roberson HIT SINGLE “BAD DAY” FEATURED ON AMERICAN IDOL AMERICAN ON FEATURED DAY” “BAD SINGLE HIT feat. w/ AsFast&BoysLikeGirls w/ JoshHoge&JayBuchanan w/ Mozella&HollyBrook Bury YourDead•StillRemains IHLEBRANCH MICHELLE w/ TheSpillCanvas&ArmyofMe w/ LakeTrout&Cedars ...... w/ Revival TICKETS.COM: 800-955-5566 •www.930.com w/ X-Clan w/ Driveblind w/ AriHest&Watershed ...... w/ NewSkin ...... VIRGIN FESTIVAL VIRGIN ...... w/ Dr.Dubenstein&Lionize ...... w/ Ozma w/ PoisonTheWell•DarkestHour ...... w/ TheRiverboatGamblers and w/ DroppingDaylight w/ JuniperLane&HonorByAugust w/ Nasio SEPTEMBER ...... AUGUST ...... JULY ...... ESC HARP JESSICA ...... 10:00 Doors 10:00 ...... 6:00 Doors $25 Doors 6:00 ...... Su 23 Tu 25 Tu 18 Tu 15 Th 20 Th 13 Th 24 Th 27 Sa 22 Sa 23 Sa 12 Sa 29 W 23 W 26 M 24 M 17 M 14 Su 6 F 21 F 14 F 18 F 11 F 28 Sa 5 Sa 5 W 9

THIS MONDAY! THIS SUNDAY! ONSO H UNDERGROUND THE OF SOUNDS MONTGOMERY GENTRY OBSAK•TREDY GRACE •HINDER DAYS •THREE BEN HARPER RVU WR•CNIA CORPSEANDMORE! TRIVIUM •GWAR •CANNIBAL WIDESPREAD TICKETMASTER: 202-397-SEAT •410-547-SEAT703-573-SEAT •800-551-SEAT WWW ILSOT•EYA BADU SCOTT •ERYKAH JILL SILYDYING LAY I AS UDYI H COUNTRY THE IN SUNDAY .TICKETMASTER. SUGARLAND In Association with CD Enterprises CD with Association In LITTLE BIGTOWN Nickelback UA AE FESTIVAL WATER SUGAR ohTre JackIngram Josh Turner• For fulllineupvisitwww.930.com SATURDAY, JULY29 UE LATIFAH QUEEN JACK’S MANNEQUIN FRIDAY, AUGUST4 PANIC AINMARLEY DAMIAN OECUERVO PRESENTS JOSE O.A.R. COM SEPTEMBER 10 & THEINNOCENTCRIMINALS • AUGUST 22 AUGUST 13 I.M.P. WWW FEATURING: JULY 26 JULY 17 JULY 16 KELIS .930. PRESENTS COM • WWW • .MERRIWEATHERMUSIC. LONESTAR W/ NFLAMES IN • COM SH FEATURING e DAISY C7DAB30Hk & "! %k4G?A4BBk4( 4]cTacPX]\T]ckFTTZT]S?Pbb

\kng\a';nmrhnphgÍml^^Zehmh_ F

Ahh]]kZpel' $!..9#,).#( lhg`É\hngm^]abfl^e_Z_Zg' :g]ln\ablma^]nZebmrh_ma^ C74HC>>70E4C7A446D8C0A8BCB)4HE4RUCKERSh3OUTHERN2OCK/PERAvISADOUBLE#$BASEDONTHEHISTORYOF3KYNYRD Ln\ablma^]nZebmrh_ma^ =kbo^&;rMkn\d^kl'ÊFr]Z]ÍlZ Lhnma^kgMabg`'1>1<0BB4H fnlb\bZg%ËlZrlAhh]'ÊPa^gingd aZil%lbg\^ma^^e]^kAhh]ieZr^] karmafl^\mbhg'ÊH_\hnkl^%ghp ma^:ma^gl%@^hk`bZ%jnbgm^mÍl aZii^g^]Bmahn`ambmpZlma^`k^Zm& [Zll_hk:k^maZ?kZgdebg%Pbelhg a^ÍlieZr^]hgma^eZlmmph?kZgd eZm^lmZe[nf%Ê:;e^llbg`Zg]Z ¨23,)

Mahn`am!MZkbjMkhmm^k"]h^lhg^ lhg`Z[hnmma^fnk]^kh_abliZk& ^gml4Zghma^kblZmkb[nm^mhk^o^k^] A^PSCaX_ abi&ahiikh]n\^kC=beeZ%pah]b^] bg?^[knZkr'Hma^kmng^lZ]]k^ll pZk%`ho^kgf^gmfhgbmhkbg`Zg] hma^klh\b^mZemhib\l'BmÍllZ]g^ll rhn\ZglaZd^rhnk[hhmrmh' Ebd^ma^Khhml%MZeb[Dp^ebaZl Zg^peZ[^e'Ê>Zk]knfËblleZm^]_hk L^im^f[^khgablhpg;eZ\dlfbma Fnlb\%Zg]bm_^Zmnk^l`n^lmZii^Zk& Zg\^l[rma^Ng]^k`khng]Dbg`s% GhkZaChg^l%LbsseZZg]C^Zg@kZ^% #)215%$53/,%), *534).&2!.#)33!,).%02/*%#4 _^Zmnkbg`ikh]n\mbhgl[rDZgr^P^lm% C74A>>CB0A4>=58A4)&ORESAKINGPRE RECORDEDSAMPLES THE2OOTSGAINEDGREATRENOWNASHIP HOPSPREMIERLIVEBAND Cnlm;eZs^%Ab&M^dZg]FZ]eb[' E^llaZle^Zd^]Z[hnmma^ 6^X]V6[^QP[ IaZk\r]^Íl_Zeek^e^Zl^%Ê>\e^\mb\ F70C)#IRQUEDU3OLEIL$ELIRIUM F?74A?>AC4A hURBAN TRIBALvFARETHEYSOUNDLIKE lhglmZkml%ma^l^o^m^kZgZ\mlZk^ ma^=^_CZfP^[lbm^]knff^k -ADONNA )NADDITIONTOMUSICIANS 4Man'% #IRQUEWILLPRESENTDANCERS EIGHT likbg`mkZbgbg`_hkabi&ahi'Ma^ Z`^mhnk' ]^l\kb[^]bmZlÊo^krfZmnk^%o^kr 2i'f'%+)4+)+&1-+&,-)*'!G^pRhkd& ACROBATSANDMUCHMORETOENSURE Khhml%MZeb[Dp^ebZg]ma^IaZk\r]^ :\mnZeer%ma^KhhmlZk^ZepZrl l^kbhnl%o^kr]Zkd'ËKZii^k;eZ\d ?ehkb]Z:o^'" THATYOURHEADSPINSCONTINUOUSLY 10 EXPRESS 7.13.2006 THURSDAY C7DAB30Hk & "! %k4G?A4BBk4 4]cTacPX]\T]ckFTTZT]S?Pbb

IeZrl?khf='<'IeZrpkb`amlËbl Zg^o^gbg`h_lmZ`^]k^Z]bg`lZm Lmn]bhMa^Zmk^Zm0i'f'M^kZa CZ\dlhg%Znmahkh_ÊAb]]^gIZ`^lË É]^l\kb[^][rbmlik^llk^e^Zl^ZlZ =^e"=deeZgÉh9Za^\]i \khll[^mp^^g=k'=k^Zg]PbeebZf LaZd^li^Zk^ÉlZrlabllahkmÊpbee 54BC8E0;BkMa^\nkmZbglZk^ni li^ZdmhZgr[h]r_khfma^='<' Zmma^D^gg^]r<^gm^kZg]Lmn]bh Zk^Z%[hkgZg]kZbl^]%ËZlma^`kZ_& Ma^Zmk^_hkma^_b_maZggnZe='<' _bmblmk^^m&ikhia^mZmma^\^gm^kh_ Abi&AhiMa^Zm^k?^lmboZe'P^ee% ablmZe^blghg^hma^kmaZg='<'Íl h__b\bZeer%ma^\nkmZbglaZo^[^^g hpg^enlbo^mZ``^k'FnmZ_ZÍl ma^Zmkb\Ze_^ZlmZk^ghmhger_k^^[nm Phk]l%;^Zml Eb_^Bg\'%Zlp^eeZl ZelhfZkbgZm^]bgZabi&ahi_eZohk Z_bgZeahhkZaZm:o^gn^Gb`am\en[ maZml^^dlmhbgob`hkZm^mkZ]bmbhgZe [^_hk^ma^_^lmboZe`h^l]Zkdngmbe ma^libZg\kZobg`l' g^qmr^Zk'30A>=0F8;;80

HgMankl]Zr%ma^_^lmboZelahp& #/524%39$#()0 (/04(%!4%2&%34)6!, \Zl^lZ\hnie^h_bmlfZbg^o^gml' B742>D;31418664AC70=1>A5)!SPARTOFTHE&IFTH!NNUAL$#(IP (OP4HEATER&EST THE$#5RBAN!RTS!CADEMY ¨OZkbhnlEh\Zmbhgl%makhn`aLZm'% Ê='<'Lahkml3M^gFbgnm^Abi&Ahi WILLOFFER$*INGDEMONSTRATIONS HIP HOPDANCECLASSESANDGRAFFITIWORKSHOPSON3ATURDAYFROMNOONTOPM _k^^4abiahima^Zm^k_^lm'\hf' I]ZHeg^c\[^ZaYHdjcY4 60;;4A84BkC740AC>5?4AB4E4A0=24 ETcXeTa½b0]Sh2PQXR hkln[mer[nbe]bg`]knflhkebgd& bg`k^i^mbmbo^oh\Zelbg\aZgm' cP[ZbPQ^dcQaX]VX]V QPRZVa^^eh\dbXR 3^h^dab^]VbcPZTcX\Tc^P__aT RXPcT.

ÊMh?bg]F^@hg^'Ëqik^llZ[hnmablk^mnkgmh 6ETIVERLOOKANDSOUNDRATHERMORELIKE PUUTRcTSh^da\dbXR. ='<'Zg]fhk^' A3AN&RANCISCOBANDTHANA$#BAND AhpBl^mnifrlhg`lZg]lmn__ ÉbmÍlcnlm]b__^k^gm''''BÍo^fho^] 3^h^d\X]SQTX]V[PQT[TSºU^[Z '''Ma^ikh]n\mbhgoZen^lZg]\kZ_mh_ hg%[nmbmÍlZmkbipa^gBmabgd a^RZ»^aºR^d]caha^RZ.» lhg`pkbmbg`_khf]^\Z]^lZ`hpZl Z[hnm\hfbg`[Z\da^k^'BÍfk^Ze& BaZo^ZaZk]mbf^]^l\kb[bg`paZm hkb`bgZeerbglibkbg`mhf^' erehhdbg`_hkpZk]mhma^lahpbg B]h'ÁMa^k^Íl^e^f^gmlh_ZeemaZm% ='<'Zg]l^^bg`Zehmh_he]_kb^g]l' [nmB]hgÍmehhdnihgbmZlhg^\^k& B^\T^Uh^dab^]VbPaT`dXcT\Tb 27A8B<8=274A4G?A4BB mZbg\Zm^`hkr' \TaXiX]VFPbcWPcPV^P[. #/524%39&/5.$29'!,,%29 =^_bgbm^er'Ma^lhg`lmaZmlhng] ¨PZk^ahnl^G^qm=hhk%*)*00maLm' =><>A4F0C4A)&OUNDRY'ALLERYSJURIEDEXHIBITh!FTERTHE3TORMv 0aTh^dPcWa^fQPRZ. maZmpZr%Bmkb^]mhZkkZg`^maZm GP4pbma;^gcr?^k^^%13,)i'f'%04 FEATURESPAINTINGSANDPHOTOGRAPHSFROM-ISSISSIPPI'ULF#OASTARTISTS Beblm^gmhZehmh_he]^kfnlb\' pZr%pa^ma^kmakhn`ak^i^mbmbhg +)+&01,&,2,,'!Fm'O^kghgLj'" MANYOFWHOMLOSTTHEIRHOMES STUDIOSANDWORKIN(URRICANE+ATRINA 12 EXPRESS 7.13.2006 THURSDAY Center’s missiontoitscommunityandthenation. arts accessibletoeveryoneinfulfillmentoftheKennedy James A.JohnsonandMaxineIsaacstomaketheperforming The MillenniumStagewascreatedandunderwrittenby AFPIEFO DRINKS & HALF-PRICE FOOD RN OE AS56P.M. NIGHTLY GRAND FOYERBARS5–6 REPROMNE AL T6P.M.! PERFORMANCESDAILY AT FREE of MusicatTheCatholicUniversityAmerica. Company andtheBenjaminT. RomeSchool In conjunctionwithTheSummerOperaTheatre perform. Students fromtheWNOprogram FOR YOUNG SINGERS WASHINGTON NATIONAL OPERA Mon., July17: Members performchambermusic. NSO SUMMERMUSICINSTITUTE Sat., July15&Sun.,16: Performing ArtsSociety, and Washington In cooperationwithMetro, vocalist Algebra. sensation StephanieJordanandR&B Opening actsareNewOrleansjazz born RicardoLemvoandhisband. for hotAfro-LatinmusicfromCongo- Bring yourlawnchairsorblankets STEPHANIE JORDAN/ALGEBRA RICARDO LEMVO&MAKINALOCA/ Fri., July14,6-9p.m.: 20th century. Music fromtheRenaissanceto Thu., July13: UPCOMING PERFORMANCES for your labpups. He’d make agoodfather CAEN UNIVERSITYCHOIR Sponsored byStarbucks. RICARDO LEMVO OUTDOORS ONTHESOUTHPLAZA OUTDOORS until midnight. shuttle departingevery15minutes station andridethefreeKennedyCenter Take MetrototheFoggyBottom/GWU FRIDAY 7.14 “A culturalinstitutionwithinainstitution” NORMANDY’S WHUR ALGEBRA 96.3. FRIDAY 7.14 kennedy-center.org/millennium artist information,andmoreat: Live Internetbroadcast,videoarchive, mission ontheArtsandHumanities,MillenniumStageEndowmentFund,KennedyCenterWashingtonCommittee ontheArt Foundation, StarbucksCoffeeCompany,TheMeredithDr. Deborah RoseandDr. JanA.J.Stolwijk,Temple-Inland, Inc., Foundation, withadditionalfundingprovidedbytheU.S.DepartmentofEducation,HoraceW. GoldsmithFoundation,AmericanLega The MillenniumStage,underwrittenbyJamesA.JohnsonandMaxineIsaacs,isbroughttothepublicTarget Storesand Fannie al(0)416-8340. call (202) and SaturdaySundayfrom10a.m.-1p.m.Forinformation, tour guides.Tour hours:MondaythruFriday,10a.m.-5p.m., TOURSaregivendailybytheFriendsofKennedyCenter FREE and Colombianrhythms. Andrés Cepedablendsrock, Zuleta perform CochaMolinaandPoncho holiday. show commemoratetheJuly20th Colombian performancesandfashion Sat., July22: Students performavarietyofworks. Fri., July21: by SirArthurConanDoyle. sound effects.Thismonth,astory “Live radiotheater”withmusicand HOLMES SHERLOCK NIGHT KITCHENRADIOTHEATER: Thu., July20: Members performchambermusic. NSO SUMMERMUSICINSTITUTE Tue., July18&Wed.,19: FESTIVAL PIANOPROGRAM INDEPENDENCE DAY CELEBRATION OUTDOORS ONTHESOUTHPLAZA OUTDOORS OCR EISA 5P.M. AT CONCERT BEGINS IN THEFAMILY THEATER EASTERN MUSIC vallenato COLOMBIAN 7.15-16; TUESDAY-WEDNESDAY 7.18-19; SUNDAY 7.23 NSO SUMMERMUSICINSTITUTE TheKennedyCenter www.readexpress.com 202-334-6200 Place yourClassifiedadtoday. Find ahomeforpets music, and Classified ads appearinExpress andTheWashington Post. bolero A Publicationofthe , SATURDAY-SUNDAY American FolklifeCenter concert series,presentedbyTheLibraryofCongress ▲ Music anddancefromLaos. Wed., July26: turned soulfulvocalist. Swedish nationalsoccerplayer Tue., July25: perform. Participants fromthelocalcompany DC YOUTH ENSEMBLE Mon., July24: andmore. Tchaikovsky Elizabeth Schulze,conductor. Works by NSO SUMMERMUSICINSTITUTE Sun., July23: INPANH THAVONEKHAM DANCERS &MUSICIANSFEATURING ARE SUBJECTTOCHANGEWITHOUTNOTICE. ALL PERFORMERSANDPROGRAMS Part ofthe . — GHI The Washington Post IN THECONCERT HALL Homegrown: The Music of America of Music The Homegrown: in Express. ( For moreinformationcall: 22 416-8524 (202) parking forfreeperformances. PLEASE NOTE: 202 SATURDAY 7.22 ANDRÉS CEPEDA NICOLAI DUNGER NATASINH ) persons withdisabilities. The KennedyCenterwelcomes 467-4600 There isnofree ▲ TTY DCCom- Mae cy s. X167g 3x2 Ariel Dorfman A World Premiere by P boxofficetickets.com THURSDAYS HIRSHHORN Get I www.theaterj.org (800) 494-TIXS C A Rain orShine Exhibition Tour Anselm Kiefer: HeavenandEarth 7 pm Black HeritageBand MFA Kera andMike Russellwiththe 5:30 pm Galleries open 5:30 to8pm Tonight, 13 July Art www.hirshhorn.si.edu S S | relationshipsand muchmore O 7th St.atIndependence Ave. SW ’ S is... health|fitness |nutritiongroomingbeauty fashion C Night L July 23 Thru O Tuesdays inExpress S E and beyour best. A weekly sectionabouthow tolookandfeel T Vst www.pastimebaseballleague.com Visit 21 Years andOverwithNo Age Limit! AdultBaseballLeague out’s,No try nocuts, nowaiting list! Nw registering Now too! Great fieldandgreatuniforms Guaranteed bestpricing intown! for fall2006 playsandeverybody Everybody Mild competitionlevel, skillset call Johnie@(571)228-6198 or for more information has agreattime! A publicationof nt important! not (Hardball) GHI XX142c 2x1.5 C7DAB30Hk & "! %k4G?A4BBk4 " 4]cTacPX]\T]ckFTTZT]S?Pbb LZaXdbZ! CdlAZVkZ >fT]FX[b^]_[PhbP lrfiZma^mb\mh=nik^^Ílfbl_hk& mng^Zg]mhe^kZgmh_ablng\hnma bcdQQ^a]W^dbTVdTbc aZ[bmlZg]Z]he^l\^gm[^aZobhk% X]¼H^d

!FZmm=beehg"lhhg`khpp^Zkrh_ 5.)6%23!,345$)/3 70=68=60A>D=3k?k^la_khfabl =nik^^Íl]^lmkn\mbo^ik^l^g\^';nm ?DCH>DA544CD?)+ATE(UDSONAND-ATT$ILLONTRYTOBEPOLITEWITHEXASPERATINGROOMIE$UPREE PLAYEDBY/WEN7ILSON [eh\d[nlm^kabmÊP^]]bg`=4=C4AC08=<4=C=4FBF8A4 CPZT 8]SXTb0acXTb BWPa_CTTcWB^Uc5da

4(%7!3().'4/.0/343&),-#2)4)#3 !&)CELEBRATESh9EARS 4!#+,%4()37%%+3"/8 /&&)#%4/0 4HRILLS vWITHAPROGRAMOFSHOCKERS CREEPFESTSANDFREAKOUTS.UMBER E^gViZhd[i]Z8Vg^WWZVc/ 4WOONTHE)NSTITUTESLISTIS3TEVEN 9ZVYBVcÉh8]Zhi 3PIELBERGSPITCH PERFECTMON *OHNNY$EPPISSTILLTHELOVABLERAS STERMOVIEh*AWS vSCREENING&RIDAY CALWITHFRILLYSLEEVES SCHEMINGEYES AND3ATURDAYATANDPM!LSOAT

ANDFEYMIEN*USTDONTLOOKFORTHE $)3.%9 !&)3ILVERTHISMONTHARETHEANIMATED COLLISIONOFINNOCENCEANDDANGER 20B78=68=)4HERESGOLDBURIEDINFRANCHISESh0IRATESvBROKEBOX OFFICERECORDS FILMSh4HE-UPPET-OVIEv4HU THATMADETHEFIRSTFILMSOPROVOCATIVE PM h-IRRORMASKv&RI AM

34BB>=C7>= ISH SELF ABSORBED SMUGLITTLEWEENIE RIDICULOUSBC4?74=7D=C4A ANDh4HE'REAT-UPPET#APERv3AT 5.)6%23!,345$)/3 BC4?74=7D=C4A 3UN PM PARTOF-UPPETS 4E4AH1>3H>DC)h*AWSvTAUGHTA HjeZgbVcGZijgch! I]Z;VhiVcYi]Z' -ASKS AND-AZES4HE*IM(ENSON GENERATIONTOBEAFRAIDOFTHEWATER 7HATSMISSINGISAPLOT"UTTHENEWS 8Vgh$ ;jg^djh/Id`nd9g^[i &ILM,EGACYSERIES ISGOOD3UPERMANHASRETURNED AND h#ARSvISSETINAWORLDSOAUTO NOR )TISINDEEDFASTLOTSOFCARSGOINGVRR ¨:?BLbeo^k%1/,,=C7>= TIONOFTHESAMENAME +)+&/,,&-11)'!LfbmalhgbZg" 4 #k4G?A4BBk & "! %kC7DAB30H FTTZT]S?Pbbk4]cTacPX]\T]c

;8E4A>2:k;>F4AH½B2>D=CAHA>03B &)" _\% 1XaRW\TaT)9^W]2^aQTcc0\hB_TPRT &)" _\!$ CWT 1[PRZ2Pc)?aXTbcTbbF^^[h]T9Pb^]BcTT[T]T _\$ 5da)CWTA^^cbCP[XQ:fT[X?WPaRhST (_\!  “ 8^cP)AXRWPaS1dRZ]Ta9T]]XUTa>½2^]]^a THE FUNNIEST (_\ ! ’ 9P\\X]½9PeP)CWT1^QbCWTC^]T MOVIE YOU LL SEE AP]VTab'_\!  9Pgg)7dac1^QB_X[c')" _\ $ THIS SUMMER! :T]]TSh2T]cTa)2PT]D]XeTabXchRW^Xa ”Funny, charming and relentlessly honest!” %_\UaTT Mark S.Allen, UPN ;^eT)39FX[[XP\390]P[hiT(_\UaTT “THE WILDEST, FUNNIEST fXcW_PbbUa^\[^eTcWTR[dQR^\QTU^aT _\! PUcTa AND MOST HILARIOUS =PcX^])0[RWT\hR[^bX]V_Pach'_\  MOVIE OF THE YEAR!” ()" 2[dQ)BcaWTbbC^daBWPS^fb5P[[ SHAWN EDWARDS, FOX-TV ?^Xb^]cWTFT[[3PaZTbc7^da1dahH^da 3TPSBcX[[AT\PX]b%)" _\!  ?[PcX]d\)ATVVPTATVVPTc^]39b@XR BX[eTaB\^ZTh9^T9^b|UaTTfXcW_Pbb Ua^\_[PcX]d\R[dQSRR^\ $PUcTa _\ BcPcTCWTPcaT)?TSa^BdPaTiETacXi '_\#  BcaPcW\^aT)2[PbbXRP[7Xc?PaPST)2WTTa X]VCRWPXZ^ebZh'_\!$ CfX]b9Pii)\TVP1P]S BX\_[TBd_aTT\(_\ 

© 2006 COLUMBIA PICTURES INDUSTRIES, INC. ALL RIGHTS RESERVED. DISTRIBUTED FPaTW^dbT=Tgc3^^a)6Xbc;Xcc[T;XVWc THROUGH SONY PICTURES RELEASING ')" _\' UNIVERSAL PICTURES PRESENTS A STUBER-PARENT/AVIS-DAVIS PRODUCTION A RUSSO BROTHERS’ PICTURE MUSIC OWEN WILSON KATE HUDSON MATT DILLON “YOU, ME AND DUPREE” SETH ROGEN AMANDA DETMER AND MICHAEL DOUGLAS BYTHEODORE SHAPIRO ¨ 5A830H EXECUTIVE PRODUCED WRITTEN PRODUCERS MICHAEL FOTTRELL SEAN PERRONE AARON KAPLAN BY SCOTT STUBER MARY PARENT OWEN WILSON BY MICHAEL LE SIEUR 0_Tg)39aRWTbcaP&)" _\UaTT RIVERTOWNE 12 PHOENIX THEATRES (301) 949-9201 COUNTRYSIDE 50 Mass. Ave. N.E. REGAL CINEMAS AMC TYSONS CORNER 16 ✽ACADEMY 8 VIRGINIA MERRIFIELD, VA SHOPPING CENTER (202) 842-4455 Oxon Hill, MD WORLDGATE 9 AMC (703) 502-4060 BETHESDA 7850 Tysons Corner Center GREENBELT, MD AMC STERLING, VA (703) 998-4AMC (703) 998-4AMC Herndon, VA (301) 513-0111 2WXRZ7P[[½bBdaU2[dQ);Ta^hCW^\Pb REGAL Bethesda, MD (703) 318-9290 MAGIC JOHNSON HOFFMAN CENTER 22 NATIONAL AMUSEMENTS 800-FANDANGO #394 GALLERY PLACE AMC LOEWS 800-FANDANGO #569 CONSOLIDATED AMC CAPITAL CENTER 12 CENTREVILLE ST. CHARLES REGAL COUNTRYSIDE EISENHOWER AVE REGAL CINEMAS STADIUM 14 REGAL CINEMAS KINGSTOWNE 16 ✽ 800 SHOPPERS WAY & TELEGRAPH RD. MULTIPLEX CINEMA ✽ IhSTR^A^PSad]]Tab(_\!  TOWNE CTR. 9 STADIUM 20 RIVERTOWNE 12 LARGO, MD MANASSAS CINEMA 14 707 Seventh Street, N.W. BOWIE STADIUM 14 Kingstowne Towne Ctr OXON HILL, MD (703) 998-4AMC CENTREVILLE, VA ROUTE 66 TO EXIT 47B 800-FANDANGO #1721 Waldorf, MD 15200 Major Lansdale Blvd. Alexandria, VA (703) 822-4956 Sterling, VA 800-FANDANGO #844 (703) 502-4060 800-FANDANGO #745 800-FANDANGO #394 (703) 998-4AMC AMC 11380 BULLOCH DRIVE 2[PaXRTB\XcW2T]cTa)9^W]BfP]]P 800-326-3264 #454 NATIONAL AMUSEMENTS MARLOW 6 (800) 326-3264 #490 MARYLAND AMC LOEWS ✽ NATIONAL AMUSEMENTS AMC LOEWS REGAL CINEMAS ARLINGTON BLVD/ REGAL MANASSAS 3899 BRANCH AVENUE POTOMAC MILLS 18 WHITE FLINT 5 LEE HIGHWAY STADIUM 14 ✽RIO CINEMAS 18 TEMPLE HILLS, MD WOODBRIDGE, VA FAIRFAX CORNER 14: ✽ &_\ ! ACADEMY 8 GERMANTOWN (703) 998-4AMC Bethesda, MD STADIUM 14 MULTIPLEX CINEMAS Exit 47B off Interstate 66. 9811 WASHINGTONIAN CTR. (301) 316-1031 CINEMA DE LUX at Beltway Plaza 800-FANDANGO #741 GAITHERSBURG, MD (301) 220-1155 Merrifield, VA (703) 502-4060 800-326-3264 #490 AMC FAIRFAX, VA Germantown Town Center 800-FANDANGO #740 MUVICO 2[dQ0\Pi^])APaT4bbT]RT _\  CONSOLIDATED 800-326-3264 #455 NATIONAL AMUSEMENTS REGAL CINEMAS ◆SPRINGFIELD MALL 10 (703) 502-4060 AMC LOEWS MAJESTIC 20 EGYPTIAN 24 CENTER PARK 8 REGAL CINEMAS CENTREVILLE POTOMAC YARD @ARUNDEL MILLS SPRINGFIELD, VA 900 Ellsworth Dr. ROCKVILLE STADIUM 13 STADIUM 16 ◆ (443)755-8992 (703) 971-3991 SORRY, NO PASSES ACCEPTED FOR THIS ENGAGEMENT. [PSXTbUaTTQTU^aT _\ Beltsville, MD Silver Spring, MD MULTIPLEX CINEMAS 800-FANDANGO #739 (240) 393-4826 Rockville,MD Centreville, VA Rte. 1 off S. Glebe Rd. 800-FANDANGO #248 (703) 502-4060 (703) 739-4040 SPECIAL ENGAGEMENTS NO PASSES OR DISCOUNT COUPONS ACCEPTED CHECK THEATRE DIRECTORIES OR CALL FOR SOUND INFORMATION AND SHOWTIMES AND AT A THEATER NEAR YOU 32();XQTaPcX^]3P]RT?Pach()" _\$ C7DAB30Hk & "! %k4G?A4BBk4 $ 4]cTacPX]\T]ckFTTZT]S?Pbb

CWTBRT]T Lgdc\Hij[[^c 5XeT)3^R)?PachfXcWRPbc^U;PVd]P1TPRW I]ZG^\]iL^c\ (_\ $ 8^cP)CWT6[^ahP]ScWT7=340=ma^fZgfhlm_Zfhnl_hkbg_hkf&   bg`Kb\aZk]GbqhgmaZmma^k^pZlZ\Zg\^k 9P\\X]½9PeP)CWT1^Qb&)" _\!  hgablik^lb]^g\r%\hgmbgn^lmhl\knmbgbs^ma^mhg^ ?^[XcXRZb4eTah^]TQdc?TcT()" _\ Zg]]bk^\mbhgh_ma^\hgl^koZmbo^fho^f^gmbg`^g&   ^kZeZg]ma^K^in[eb\ZgiZkmrbgiZkmb\neZkbgabl 9Pgg)3^f]c^CWXbCWaTTBcPa:Pa\P g^p[hhd%Ê

Ua^\[^eTcWTR[dQR^\QTU^aT _\!  #()03/-!$%6),,!'%449)-!'%3 +)+&/,1&0/*)'!@Zee^krIeZ\^&aRWTbcaPBd\\Ta)B^d[5^^SBPcdaSPhb(_\!  $$ 1TaahfX]T?[P]cPcX^]b)ATVVPTfX]T FT;^^Z0fPhcWTEXQT$)" _\ ! ')" _\' 8^cP)BdbP]2^fbX[[()" _\ ! CfX]b9Pii)aRWTbcaP%_\UaTTCPX_TX?WX[ ?aX]RT?Pd[;XbPº;PSh?R^`»?TVaP\ BTP]7PhTb&_\ $ DCda])CWT0:b?TbbX\Xbc?PaPSTcWT 1XaRW\TaT)CaXbcP]?Tcch\P]aRWTbcaP)ºCPXfP]=XVWcb» b_^ZT]f^aSPacXbcb !_\UaTT 9Pgg):1TcPB^dcW_Pf2  $ ET[eTc;^d]VT)BfPa\^UcWT;^cdb 0dc^ZX]^c^]CaX_[TCfX]b(_\' #ONTINUEDON% ¨ B0CDA30H 0_Tg);X`dXS;PSXTb39AP]ShFWXcT (_\' cWTf)"# =^a\P]0eTaRWTbcaP&)" _\UaTT ]^]0eT0[TgP]SaXP*& "$#(&$  5^acAT]^)2WTbP_TPZTBcaTTc ;^eT) "$ >ZXTBc=4*! !%"%( "  ET[eTc;^d]VT)( $DBc=F*! !#%! CWT2PcWTSaP[2WdaRW^UBPX]c 1[PRZ2Pc) '  #cWBc=F*! !%%& =TQaPbZP0eT]dT=F*! !%&"&%#&

60;;4A84Bk80<=>C30H 3XbcaXRc5X]T0acb)º:PcaX]PAT\T\ QTaTS»bXgAH)!XELLE2IOULTSSITE SPECIFICINSTALLATIONh.ONSANSÏMOI!S),AY-YSELFx vIN&LASHPOINT ^UbTPbRP_TbSX^aP\PbfPgUXVdaTbP]S XRP»Tg_[^aTbX\PVTb^URWX[SaT]P]ScWTXa 'ALLERYEXPLORESIDENTITY SELFANDPRESENTATIONUSINGMEDIAINCLUDINGVIDEO TEXTILES PHOTOGRAPHYANDSCULPTURE ^cWTaPacXUPRcbST_XRccWTaXRWWXbc^ah^U aT[PcX^]bWX_c^cWT0\TaXRP]`dTbcU^a !SDOHUMANBODIESANDPERSONALITIES THEEXHIBITIONWILLEVOLVEANDCHANGEOVERTIMEITSUPTHROUGH!UG  #ONTINUEDON% ]PcX^]P[XST]cXchcWa^dVWBT_c &ºFX[ [XP\FTV\P]¹5d]]ThBcaP]VT»P fXSTaP]VX]V[^^ZPccWTf^aZb^UFX[[XP\ 0a[X]Vc^]0acb2T]cTa)º=Tf0ac4gP\ Adv. Tix on Sale YOU, ME AND DUPREE (PG-13) # FTV\P]Ua^\cWT (% bc^cWT_aTbT]c X]TS»f^aZbQh! %a[TP]b1[PRZ 2^]]Ta2^]cT\_^aPah)º2dc»eXST^P]S Adv. Tix on Sale DCI QUARTERFINALS (NR) # 730 800 1020 Adv. Tix on Sale THE DESCENT: SNEAK PREVIEW - NCM PIRATES OF THE CARIBBEAN 2 - DIGITAL WAIST DEEP (R) - ID REQ'D DIG (1200 230 500) 740 1030 UUXRT)ºAd[Tb»P]PaRWXcTR # (1145 1215 1245 115 145 300 345 400 430 510) 700 715 745 800 THE BREAK-UP (PG-13) DIG (140) 650 OC: CLICK (PG-13) DIG (415) 930 830 1020 1045 CLICK (PG-13) DIG (1115 145) 700 X-MEN 3 (PG-13) DIG 740 1040 RWdbTccb0eT=F*! !&'$! #  cdaP[X]cTaeT]cX^]QhQb^[TcT>SSP]S0Qb^ FAST & THE FURIOUS 3 (PG-13) DIG 720 1000 GARFIELD: A TALE OF TWO KITTIES (PG) DIG (1205 220 440) ATP[XbcPacXbcb6^SUaTh5aP]ZT[P]S7T[T] [dcT[h>^ZhBcdUUUa^\cWT30A

ACADEMY 8 at Beltway Plaza Center Court Beltway Exit 23, W. on301-220-1155 Greenbelt Rd. R-ID required (!) No Pass/No Discount Ticket ALL SHOWS BEFORE 6 PMPIRATES ONLY $5.00 OF THE CARIBBEAN: DEAD MAN’S CHEST (PG-13) (!) 12:45, 1:00, 4:00, 4:35 7:15, 7:30, 10:30, 10:45 SUPERMAN RETURNS (PG-13) (!) 12:30, 3:45, 4:25, 7:00,FAST 7:45, AND 10:15 FURIOUS: TOKYO DRIFT(!) (PG-13) 1:30, 10:40 THE DEVIL WEARS PRADA (PG-13) (!) 1:15, 4:00, 7:20, 10:00 WAIST DEEP (R) (!) 1:00, 3:15, 5:40, 8:10,CLICK 10:45 (PG-13) (!) CARS (G) (!) 1:20, 4:20, 7:00, 9:45 Moviefone (301 or 202) 333-FILMBargain Mats. all shows before 6 pm #805 WORDPLAY (PG) 1:35, 2:35, 4:05, 5:00, 6:45 7:35, 9:15, 9:55 AN INCONVENIENT TRUTH (PG) 1:30, 2:30, 4:00, 4:50 7:45, 9:20, 10:00 THE LOST CITY (R) 2:05, 5:05, 8:05 A PRAIRIE HOME COMPANION (PG-13) 1:55, 4:25, 7:10, 9:40 WATER (PG-13) 1:40, 4:15, 6:50 KEEPING UP WITH THE STEINS2:15, (PG-13) 4:40, 7:20, 9:30

ie o hrdy uy1,2006 13, July Thursday, for Times X4c3x2.5 XX141c 4:40, 9:20 1:50, 4:20, 7:10 1:30, 4:20, 6:50, 9:15 12:00, 3:30, 7:00, 10:30 % % % % 2:20, 5:10, 7:30, 9:45 12:00, 2:30, 5:00, 7:40, 11:10, 12:15, 1:45, 2:50, 1:10, 4:10, 7:20 4:20, 9:45 5:30, 8:15, 10:40 12:50, 3:15, 5:40, 8:20 12:15, 1:45, 2:45, 4:30, 2:30, 5:00, 7:20, 9:50 T T T T 1:30, 6:55 C C C C E E E E Advanced Ticketing 12:05, 3:35, 7:05, 10:10 11:00, 11:45, 12:35, 1:25, 2:15, 12:05, 1:00, 3:35, 4:30, 7:15, 11:15, 12:00, 2:45, 3:30, 6:15, JF L L L L 12:30, 3:55, 7:20, 10:35 E E E E at MovieWatcher.com S S S S - Descriptive Video Service C C C C 11:20, 2:45, 6:10, 9:30 1:00, 7:20 4:25 J M M M M  A A A A 1350 19th St. 703-998-4262 2:10, 4:35, 7:00 1:05, 3:30, 5:55, 8:10, 10:30 703-998-4AMC 703-998-4AMC 703-998-4AMC North Bethesda GHI 202-244-0882 714 202-872-9555 711 310-423-1014 741 12:45, 3:00, 5:25 12:30, 2:40, 4:50, 7:10, 9:10 12:00, 12:30, 3:30, 4:05, 7:00, 7:30 11:30, 12:30, 3:00, 4:00, 6:30, 7:30, 10:00, 10:45 11:20, 12:10, 1:00, 1:50, 2:45, 3:40, 4:25, 5:15, 2:45, 5:30, 7:40, 10:00 12:35, 1:30, 3:10, 4:35, 5:35, 7:10, 8:10 12:45, 3:10, 5:30, 8:00, 10:10 7:50 1:15, 4:15, 7:00, 9:45    2:00, 4:30, 7:00, 9:30 12:30, 1:00, 3:00, 4:00, 4:30, 6:15, 7:30, 8:00 12:00, 3:30, 7:00, 10:00 JF 12:10, 2:35, 5:00, 7:30, 10:00 11:05, 12:25, 1:35, 3:00, 4:15, 5:35, 7:05, 8:05, 9:40, 12:40, 3:05, 5:30, 8:00 12:00, 2:30, 5:00, 7:30, 10:00 1:00, 4:10, 7:10, 9:45 $ $ $ $ 2:10, 7:10 Courthouse and Birch Rd. 7850 Tysons Corner Center 4000 Wisconsin Avenue, N.W. G13) LOEWS DUPONT 5 1:30, 4:15, 7:15, 9:50 11:00, 12:00, 1:40, 2:50, 4:20, 7:15, 9:55 12:25, 1:20, 3:25, 4:30, 6:30, 7:40 1:00, 4:05, 6:45, 9:30 Exit 4A I-95, 1/2 mi. on Oxon Hill Rd. AMC RIVERTOWNE 12 LOEWS WHITE FLINT 5 LOEWS WISCONSIN AVE. 6 AMC TYSONS CORNER 16 Country Club Mall on Vocke Rd near Route 68. AMC COUNTRY CLUB MALL 6 AMC COURTHOUSE PLAZA 8 A of publication FAST AND THE FURIOUS 3 (PG13) THE LAKE HOUSE (PG) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S NACHO LIBRE (PG) MISSION: IMPOSSIBLE III (PG13) THE LAKE HOUSE (PG) A PRAIRIE HOME COMPANION (PG13) THE KING (R) THE HEART OF THETHE GAME ROAD (PG13) TO GUANTANAMOWORDPLAY (R) (PG) KEEPING UP WITH THEWATER STEINS (P (PG13) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S THE DEVIL WEARS PRADA (PG13) SUPERMAN RETURNS (PG13) CLICK (PG13) CARS (G) THE DEVIL WEARS PRADA (PG13) SUPERMAN RETURNS (PG13) CLICK (PG13) FAST AND THE FURIOUSNACHO 3 LIBRE (PG13) (PG) CARS (G) THE DA VINCI CODE (PG13) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S THE DEVIL WEARS PRADASUPERMAN (PG13) RETURNS (PG13) CLICK (PG13) WAIST DEEP (R) FAST AND THE FURIOUSGARFIELD 3 2 (PG13) (PG) CARS (G) X-MEN 3 (PG13) CLICK (PG13) WAIST DEEP (R) FAST AND THE FURIOUS 3 (PG13) GARFIELD 2 (PG) CARS (G) X-MEN 3 (PG13) A PRAIRIE HOME COMPANION (PG13) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S SUPERMAN RETURNS (PG13) SUPERMAN RETURNS (PG13) CLICK (PG13) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S play The fun addictive logic game—every day! 10:45 6:10, 7:00, 7:50, 8:35, 9:30, 10:20, 11:00 - Closed Captioning · 3:10, 4:05, 4:55, 5:40, 6:35, 7:30, 8:25, 9:10, 10:05, 10:50 8:30 7:00, 9:45, 10:30 5:15, 7:15, 7:45, 9:40, 10:15 10:20 4:20, 5:25, 7:10, 8:20, 9:45, 10:55 F 7:45, 9:55 11:45, 2:15, 4:45, 1:50, 4:30, 7:10, 9:30 2:50, 6:20, 9:50 1:20, 4:40, 7:30, 9:50 % % % % % 2:30, 5:20, 7:50, 10:20 11:55, 2:40, 5:25, 8:05, 12:10, 1:50, 2:50, 4:30, 2:25, 4:55, 7:25, 9:55 12:05, 2:35, 5:15, 7:50, 6:50, 9:20 1:00, 3:40, 7:00, 9:40 T T T T T 7:05, 9:40 12:15, 2:45, 5:00, 7:30, 9:40 1:30, 4:50, 7:20, 9:20 C C C C C E E E E E 12:50, 4:00, 7:15, 10:40 12:00, 12:45, 2:45, 3:30, 4:15, 12:05, 12:50, 2:50, 3:35, 4:20, JF RATED) 11:40, 4:15 L L L L L 9:00 PM 1:05, 7:00 E E E E E . www.sudoku.com. For solution, tips and computer program, visit © S S S S S C C C C C 12:30, 3:15, 5:30 1:00, 3:10, 5:15 11:55, 2:20, 4:35 2:15, 7:55 7:25, 9:45 11:30, 2:00, 4:30, 7:00, 9:30 7:05, 9:40 12:00, 2:30, 5:05, 7:20, 10:00 4:30, 10:20 7:20, 10:00 1:10, 3:50, 7:40, 10:00 M M M M M A A A A A 410-423-0520 703-998-4262 2:40, 5:10, 7:40, 10:15 12:40, 2:55, 5:10, 7:40, 9:55 12:15, 2:40, 5:10, 7:40, 10:05 - The best specialty films. 2:00, 5:00, 8:00 (NR–NOT T 703-671-0910 801 703-506-9857 802 301-324-4220 844 1:05, 3:05, 5:05 1:00, 3:00, 5:15 12:20, 2:20, 4:45 12:35, 2:55, 5:05 11:45, 12:30, 1:15, 2:30, 3:15, 4:00, 4:45, 6:00, 1:40, 4:10, 7:00, 9:10 8065 Leesburg Pike 1:30, 4:05, 6:30, 7:35, 9:00, 10:00 7:40, 9:50 1:35, 4:05, 6:35, 9:05 2:15, 4:55, 7:35, 10:20 2:20, 4:50, 7:20, 9:50 12:45, 4:00, 7:35, 10:00 7:55, 10:35 C  2772 South Randolph E 5:15, 10:25 1:00, 3:30, 4:15, 7:00, 7:30, 10:15, 10:45 11:45, 12:30, 2:30, 3:15, 4:00, 6:00, 6:45, 7:30, 9:30, 1:50, 4:20, 7:05, 10:05 12:15, 3:05, 5:45, 8:15, 10:45 12:40, 2:00, 3:25, 4:40, 6:20, 7:25, 10:10 $ $ $ $ $ L 10300 Patuxent Parkway 800 Shopper’s Way, Largo E S 1:10, 4:10, 7:10, 10:10 1:10, 4:10, 7:15, 10:05 12:50, 2:10, 3:40, 5:00, 6:30, 9:20 C 2700 Potomac Mills Circle, Ste 886 M LOEWS SHIRLINGTON 7 A Puzzles by Pappocom AMC POTOMAC MILLS 18 LOEWS FAIRFAX SQUARE 8 AMC COLUMBIA MALL 14 MAGIC JOHNSON CAPITAL CENTRE 12 AN INCONVENIENT TRUTH (PG) THE PROPOSITION (R) THE LOST CITY (R) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S THE DEVIL WEARS PRADASUPERMAN (PG13) RETURNS (PG13) CLICK (PG13) WAIST DEEP (R) FAST AND THE FURIOUSGARFIELD 3 2 (PG13) (PG) NACHO LIBRE (PG) CARS (G) THE OMEN (R) X-MEN 3 (PG13) THE LAKE HOUSE (PG) THE WAR TAPES THE ROAD TO GUANTANAMOWORDPLAY (R) (PG) A PRAIRIE HOME COMPANION (PG13) THE LAKE HOUSE (PG) WAIST DEEP (R) GARFIELD 2 (PG) THE BREAK-UP (PG13) X-MEN 3 (PG13) OVER THE HEDGE (PG) MISSION: IMPOSSIBLE III (PG13) THE LAKE HOUSE (PG) A PRAIRIE HOME COMPANION (PG13) AN INCONVENIENT TRUTH (PG) KEEPING UP WITH THEAKEELAH STEINS AND (PG13) THE BEE (PG) THE LAKE HOUSE (PG) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S THE DEVIL WEARS PRADA (PG13) SUPERMAN RETURNS (PG13) SUPERMAN RETURNS (PG13) CLICK (PG13) WAIST DEEP (R) FAST AND THE FURIOUSGARFIELD 3 2 (PG13) (PG) NACHO LIBRE (PG) CARS (G) THE BREAK-UP (PG13) THE DA VINCI CODEOVER (PG13) THE HEDGE (PG) PIRATES OF THECHEST CARIBBEAN: (PG13) DEAD MAN’S THE DEVIL WEARS PRADA (PG13) SUPERMAN RETURNS (PG13) CLICK (PG13) WAIST DEEP (R) FAST AND THE FURIOUS 3 (PG13) GARFIELD 2 (PG) NACHO LIBRE (PG) CARS (G) THE BREAK-UP (PG13) X-MEN 3 (PG13) THE DA VINCI CODEOVER (PG13) THE HEDGE (PG) 10:15, 11:00 6:45, 7:30, 8:15, 9:30, 10:15 - 6:15, 7:00, 7:45, 9:45 6:20, 7:05, 7:50, 9:50, 10:30, 11:10 All seats $4 or $5 before noon on Fri., Sat., & Sun. - denoted by ( ) 10:25 10:50 5:25, 7:10, 8:10, 9:50, 10:50 7:15, 9:55 in ink? No passes or discount coupons 11:20, 3:00, 6:40, 10:20 % % % 12:05, 1:30, 2:30, 4:10, 12:00, 1:00, 2:35, 3:35, 1:30, 4:20, 7:30, 10:00 10:55, 11:55, 1:40, 2:40, 4:40, 9:50 11:05, 4:35, 10:00 12:00, 3:00, 6:30, 10:00 A.M.Cinema T T T 12:05, 2:20, 4:40, 7:10, 9:40 C C C 12:01 AM E E E 11:45, 3:15, 7:00, 10:40 12:00, 12:45, 3:00, 4:15, 6:30, F 12:15, 1:00, 4:00, 4:45, 7:15, 11:20, 12:00, 12:40, 1:20, 3:00, JF L L L 12:30, 3:45, 7:05, 10:25 12:00, 3:15, 6:30, 9:45 11:25, 2:55, 6:35, 10:05 E E E S S S C C C 1:50, 7:20 1:15, 7:20 4:10, 9:40 1:55, 4:20, 7:35, 10:10 12:30, 3:00, 5:30, 8:00, 10:30 1:35, 7:05 M M M A A A 202-537-9553 703-971-3991 12:20, 2:40, 5:00, 7:25, 9:50 1:20, 4:30, 7:10, 9:30 11:15, 1:50, 4:15, 6:45, 9:20 703-998-4AMC 12:15, 2:45, 5:15, 7:45, 10:15 202-966-5400 713 202-342-6441 821 1:00, 3:00, 5:00 12:05, 2:35 11:00, 11:45, 12:30, 1:15, 2:00, 2:45, 3:30, 4:00, 3111 K Street, N.W. 4:30, 10:20 1:30, 4:15, 7:10, 9:30 7:15, 9:40 11:40, 1:05, 2:20, 3:45, 4:55, 6:30, 7:35, 9:10, 1:45, 7:25  Jenifer and Wisconsin 12:00, 12:30, 1:15, 3:15, 4:00, 4:45, 6:45, 7:30, 8:15, 12:00, 12:30, 3:15, 3:45, 6:30, 7:00, 9:45, 10:15 12:00, 2:25, 5:05, 7:50, 10:30 12:15, 2:45, 5:15, 7:45, 10:15 F 1:45, 4:50, 7:40, 10:10 11:50, 12:50, 2:50, 3:50, 4:50, 5:50, 6:50, 7:50, 8:50, $ $ $ Loisdale and Franconia Road 3426 Connecticut Avenue N.W. 1:00, 3:50, 6:40, 9:35 12:45, 4:05, 7:00, 9:45 1:10, 4:10, 7:00, 9:45 11:35, 1:10, 2:25, 4:05, 5:45, 7:15, 8:45, 10:10 LOEWS UPTOWN 1 AMC MAZZA GALLERIE Eisenhower Ave and Telegraph Road in Alexandria have you tried it LOEWS GEORGETOWN 14 AMC HOFFMANN CENTER 22 AMC SPRINGFIELD MALL 10 -SPECIAL ENGAGEMENT SUPERMAN RETURNS (PG13) THE DA VINCI CODE (PG13) THE LAKE HOUSE (PG) AN INCONVENIENT TRUTH (PG) CLICK (PG13) WAIST DEEP (R) NACHO LIBRE (PG) CARS (G) THE BREAK-UP (PG13) THE DEVIL WEARS PRADA (PG13) SUPERMAN RETURNS (PG13) SUPERMAN RETURNS (PG13) YOU, ME AND DUPREE (PG13) PIRATES OF THE CARIBBEAN:CHEST DEAD (PG13) MAN’S CARS (G) THE BREAK-UP (PG13) THE DA VINCI CODE (PG13) THE DEVIL WEARS PRADA (PG13) CLICK (PG13) CLICK (PG13) WAIST DEEP (R) THE LAKE HOUSE (PG) FAST AND THE FURIOUS 3GARFIELD (PG13) 2 (PG) NACHO LIBRE (PG) CARS (G) THE DEVIL WEARS PRADA (PG13) SUPERMAN RETURNS (PG13) CLICK (PG13) WAIST DEEP (R) PIRATES OF THE CARIBBEAN:CHEST DEAD (PG13) MAN’S THE DA VINCI CODE (PG13) THE LAKE HOUSE (PG) GARFIELD 2 (PG) NACHO LIBRE (PG) CARS (G) THE BREAK-UP (PG13) X-MEN 3 (PG13) SUPERMAN RETURNS (PG13) CLICK (PG13) WAIST DEEP (R) FAST AND THE FURIOUS 3 (PG13) THE DEVIL WEARS PRADA (PG13) SUPERMAN RETURNS (PG13) PIRATES OF THE CARIBBEAN:CHEST DEAD (PG13) MAN’S  9:50, 10:40 10:15, 10:45 10:15 4:45, 5:30, 6:15, 7:00, 7:30, 8:15, 9:00, 9:45, 10:30 7:45, 10:00 8:00, 10:30 3:40, 4:20, 5:00, 6:40, 7:20, 8:00, 8:40, 10:20 5:10, 7:00, 8:00, 9:45, 10:45 5:10, 6:30, 7:55, 9:15, 10:30 4:25, 5:25, 7:10, 8:10, 9:55, 10:45 4 'k4G?A4BBk & "! %kC7DAB30H FTTZT]S?Pbbk4]cTacPX]\T]c

;>20;74A>4Bk740CB44:4AB CWTBRT]T #ONTINUEDFROM%

9P_P]cWa^dVW9d[h" º1Th^]S1adbW f^aZ)Bh\Q^[Xb\X]2WX]TbT?PX]cX]V» cWa^dVW=^e!%9TUUTab^]3aXeT !cW BcaTTcBF*! !%""#''  6P[[Tah )5[^aT]RT?dccTa\P]½bPQbcaPRc _PX]cX]Vb_aX]cbP]SbRd[_cdaTbST_XRccWT aT[PcX^]bWX_QTcfTT]P]X\P[bP]S_T^ _[TcWa^dVW9d[h!  $ (2^]]TRcXRdc0eT DreamingTheir Way =F*! !!"!""!% 6P[[Tah?[P]1)?PX]cX]VbQh6Pah5XbWTa Australian Aboriginal Women Painters June 30 - September 24, 2006 P]S9^W]CP[ZX]Vc^]SaPfX]VbQhCP]YP 1^bcWa^dVW0dV!  $"  #cWBc=F* ! !!"#!&  6PcTfPh½b7T[X_^ac6P[[Tah)º2^\\d 1250 New York Avenue, NW • Two blocks north of Metro Center • www.nmwa.org ]XchB_XaXc»7dbbTX]BPXSX½bPacU^RdbTb^] 10 – 5 5 • $8 • 202.783.5000 Open Mon. – Sat., ; Sun., Noon - Admission R^\\d]XchP]SUP\X[hQ^cWX]WXbW^\T Emily Kngwarreye, Anooralya (detail), © ARS/VISCOPY R^d]cahCP]iP]XPP]SX]cWTD]XcTS BcPcTbfWTaTWT½b[XeTSU^a hTPab cWa^dVW0dV"' :T]]TccBcBdXcT" BX[eTaB_aX]V*" $%! #  6^TcWT8]bcXcdc)º6dcT0dbbXRWcT]) H^d]V6Ta\P]?W^c^VaP_WTab»f^aZbQh Blessed with a keen eye, Singh is fX]]Tab^UcWT bcP]S!]SP]]dP[6Ta making the Washington area’s dance \P]VaPSdPcT_W^c^VaP_WhR^\_TcXcX^] scene richer... George Jackson cWa^dVW0dV" ' !&cWBc=F*! ! #/524%39-!33-/6%-%.4/&4(%-/4( Dance View Times !'( !  6aTPcTaATbc^]0acb2T]cTa)º;P] 54E4AC>C4;;),OCALRECORDLABEL%XOTIC&EVERSFLAGSHIPBAND VdPVTb^UBX[T]RT»9aXVX]P[bUa^\cWT=PcX^]P[0aRWXeTb» #cWBc=F*! !!"#$%  bRP[TPQbcaPRcX^]bºPZ[P]SQh faXccT]UXabcWP]SPRR^d]cbPbfT[[Pb 7XabWW^a]Rc!&cW % (2^]]TRcXRdc0eT=F*! !"!' VaTbb\P]9^W];TfXbb_TPZX]VPQ^dc BcaTTc8]ST_T]ST]RT0eT]dTBF*! ! ($$ WXb (%$\PaRWUa^\BT[\Pc^<^]cV^\ Experience the Movement! %""  ;0BC270=24a[TP]b¹0BWPaTSB_PRT»bXgfT[[ and Sunday July 16 at 7:00 p.m. =F*! !!"#$ ! PRR^\_[XbWTSR^\_^bTaP]S_TaU^a\Ta Z]^f]3dcRWP]S0\TaXRP]PaRWXcTR With guest artist Aswathy Vasudevan Nair from India 8aeX]T2^]cT\_^aPah)º0]X\P[XP»QTPdch cWa^dVWBd] %!#2aTbRT]c?[=F*! ! cdaP[UXa\baTeTP[cWTXaTgRXcX]VSTbXV]bU^a Tickets range from $7-$20 and can be purchased by ^dc^UQTPbcbRdaPcTSQh7TPcWTaAdb ("($$%' cWTaTQdX[SX]V^U=Tf>a[TP]bcWa^dVW calling 202-269-1600 or visiting bT[[cWa^dVW9d[h!( # !?Bc=F*! ! ;;>F8=6)0ALENAS&RANK2UTAHASCREATEDAMENUTHATBRINGS FOOD LOVERSTO#LEVELAND0ARK.OW THEYMIGHTHAVETOGOTO$UPONT#IRCLE

IbheZblfhk^maZgcnlmibssZ'Bm [beelbml^e_ZlaZobg`i^k_^\m^]ma^ 4PcX]V Zkmh_ma^ibss^kbZ'Ma^_kZg\abl^ in[ebla^lbmlhpgÊibssZeb_^lmre^Ë fZ`Zsbg^%Zlhf^paZmi^kie^q& 0a^d]S bg`\hg\^im'Lbg\^ma^g^pIbheZ ibss^kbZpbee[^lm^il_khfq%ngo^be^]ma^g^pf^gnZmlb[& D?2><8=6<0H14 ebg`k^lmZnkZgmZg]]hpg&ma^& ?P[T]P;TPeX]V2[TeT[P]S lmk^^mg^b`a[hk;ZkIbeZk':laZ] ?PaZ^a=^cFW^:]^fb. [^^gZgmb\biZm^]%;ZkIbeZkÍlfn\a& KnfhklZk^_erbg`Z[hnmIZe^gZÍl [^eho^]mZm^kmhmlZk^h__b\bZeer]^Z]% ihllb[e^k^eh\Zmbhg%Zg]^o^gma^ k^ieZ\^]pbmaZgh__^kbg`h_lfZee ^qi^kml]blZ`k^^hgcnlmpaZmÍl ieZm^lmaZmpbee\aZg`^]Zber'<82704; `hbg`hgpbmama^eZn]^]k^lmZn& 6A0BB4G?A4BB kZgm'L\nmme^[nmmÉZg]Mn^l]ZrÍl ¨*1,,*-maLmk^^mGP4+)+&+/.&*0.*' ]bgbg`\aZmpbmaMh]]DebfZgh_ !NLm'&C?84B f^\\Zble^Zobg`bmlD. CLYDE’S RESTAURANTS: Clyde’s of Georgetown, Chevy Chase, Mark Center, Columbia, Reston, Tysons Corner, ma^liZ\^%iengd^]bgZ]kZ[h__b\^ ?[TPbTbT]S_aTbbaT[TPbTb_W^c^b Gallery Place; Old Ebbitt Grill; The Tomato Palace; Tower Oaks Lodge TASTE. THE DIFFERENCE. 202.333.9180 [nbe]bg`%blgÍmZeemaZm^q\bmbg`' P]SU^^Sc^SX]X]V/aTPSTg_aTbbR^\ 20 EXPRESS 7.13.2006 THURSDAY nmtosrdline red metro’s on vr10SosadRestaurants and Shops 130 Over oeie h rgno orjunyis itself. journey in your destination of a origin the Sometimes nine simplenumbers 15 SAVINGS unionstationdc.com % e er' c Cream Ice Jerry's & Ben uk onyCoffee County Bucks Levels 3 you learned byage 3 you learned OFF orwl Fries Boardwalk am Ilardo's Mamma uteAnne's Auntie rn Stein & Frank Häagen-Dazs ra Wraps Great FOOD Vittorio's u fLf Field Left of Out Images Optical Chocolatier Neuhaus Photo Moto History Making Art City Lost Murphy & Jewelers Johnston A & J Heydari Zimbabwe Great Ice & Fire DC Destination Crate Candy Collection Bouvier Station Union of Best Aurea Spirit America!'s Co. Flags Alamo Aerosoles RETAIL hpweehsoylives. history where shop ecads NY oeiesnot items Some ONLY. merchandise rsn hsa tUinSainto Station Union at ad this Present Puzzles byPappocom eev 5 f eual priced regularly off 15% receive nldd xie 8/31/06. Expires included. © Forsolution,tipsand computerprogram,visit www.sudoku.com. . ZipCar membershipandmore. the entirefamily. Ahuge shopping delight. ZipCarwillhave tentwithactivitiesfor andexhibitorsforyour someofthebestartisans bring h u ditv oi aeeeyday! The funaddictivelogicgame—every play publicationof A “Half Price Burger Nights” “Half Price The BeaconBAR&GRILL 7h&RhodeIslandAve., NW202-872-1126www.BBGwdc.com 17th & Sunday Champagne Half Price Bottlesof Half Price Wine from and fun. We willheatupthenightwithremarkable music An amazingDay andNightofgreatshopping, food,music Marie ReedSchoolPlaza18th &WyomingMarie M Unlimited BloodyMary’s, Sundays 11 AM To 3PM a hman,Mimosas Champagne, six bands Sunday Nights r www.DCWesternMarket.com Brunch Buffet Brunch i GHI e Wednesdays With Dinner R , coolyou offwithhome-madesorbetand e I I $21.95 SaturdayS July 15th e d I a I raffle S t 12pm -10pm1 I I July events c u 2 h I I for great art, Freeyear of for greatart, r I o p d o I m l a P I y l a - I z J 1 a u 0 1 l 8 p y t Open- 5-Closing h m Beer Buckets Wednesday - 1

ap Hour Happy

W

K C Margaritas,

Pitchers”

al

yo alifor & July IsFor

Saturday o

Mojitos, 5 mi

Sangria rama I I “Patio

$17.95 ng

$9.95 nia W t I I

18th St. h y I I Sky-Bar Sky-Bar Beacon Beacon Martini Martini Fl o I

USt. o I r XX141a 5x2

m ida Ave. i N n g C7DAB30Hk & "! %k4G?A4BBk4! 3X]X]VkFTTZT]S?Pbb

B^dcWTa]bch[TWdbW_d__h¹]^c Likbg`4,)*&./.&20))'!Lbeo^k ;hne^oZk]%+/+*Ngbo^klbmr;eo]' ;8E4>=;8=4 Ua^iT]^aUa^\PQPV¹X]32^a Likbg`" P^lm%Pa^Zmhg4+-)&+2)&2211' T]eXa^]b. ¨Ob]ZebZ%*22)FLm'GP4+)+&/.2& ¨?hkmng^%/+-2:kebg`mhg;eo]'%?Zeel 7iaJec Dbm\a^glmaZmdghpma^bkanlaini& *22)'!?ZkkZ`nmP^lm" Zlm

!=nihgm<B84CB4<0TALKSRES Lmk^^m" bg?ZeelZlm

PERFORMANCES PERFORMANCES PERFORMANCES PERFORMANCES PERFORMANCES PERFORMANCES

2005 Washington Post Best SILVER SPRING STAGE THEATER J Bets Winner for Live Theater TONIGHT AT 7:30 WHO’S AFRAID Sat at 8; Sun at 3 & 7:30

Group Sales: 202-312-1427 TKTS (202) 234-7174 The Thirteenth ,/2#!#/(%. To purchase Capitol Steps CD’s POTOMAC THEATRE & cassettes, for booking info: www.galatheatre.org PROJECT CALL: 703-683-8330 Parking garage behind theatre Grace Church or visit www.capsteps.com TONIGHT AT 7:30 Target is a proud sponsor 0cVYkVcXZd[i]ZXdc" WITH AN ‘Con Brio!‘ and friends featuring AIR PUMP Shaughn Dowd, Flute XZgi[^ab$YdXjbZciVgn TAIPEI Kim Miller, Violin LAZY SUSAN DINNER THEATRE Lawrence Molinaro, Harpsichord Æ>ÉbNdjgBVc!ÇgZXajh^kZ n 800.551.SEAT x Works include: Concerto for An area PREMIERE! olneytheatre.org Flute and Strings in e minor hdc\lg^iZgAZdcVgY8d" (Reconstruction from BWVs PHILHARMONIC 1059 and 35) and the Orchestral ]ZcdeZchje#qLihmeb`am BEEHIVE Suite No. 1 in C Major (BWV 1066) SINGERS AND Grace Episcopal Church The decade of the 60’s 1041 Wisconsin, N.W. 6ahd!\Zii^c\Y^ginVi as seen through the music KEYBOARD PLAYERS ORCHESTRA DANCE of the ladies of Pop & Rock! www.gracedc.org i]ZBjYYn7jYYnVYkZc" wanted for WORKING weekend variety Yoel Levi, conductor (202)333-7100 Dir: 10 mins S. of Beltway off 1-95 bands. Experience helpful, but not igjZgVXZ0i]Z8VidXi^c (703) 550-7385 required, transportation and Mozart, Taiwan Songs, Admission: $10 donation CLASSES personality a must. L^aYa^[ZGZhZgkZVcYOdd# Forming Now CALL: 301-294-8850 Strauss, Dvorak Rockville Musical Theatre “New World” Swing • Latin US Premiere: Ballroom SOUTH State College (PA) Chien-Tai Chen: 4 Week Course $49 Piano Concerto 703-528-9770 PACIFIC Jazz Festival, “Far Horizon” Huge Weekend Dances July 7, 8, 14, 15, 21, 22 July 21 & 22 Brian Ganz, piano CWTBRT]T www.dancefactory.com at 8pm Bucky Pizzarelli, Ken Peplowski, Sun., July 16, 8 p.m. July 16 & 23 at 2pm Russ Kassoff, Catherine Dupuis + Dance Factory, since 1976. others. lodging specials Kennedy Center Concert Hall #ONTINUEDFROM% Virginia Square Metro F.Scott Fitzgerald Theatre INFO: 888-221-6670 Tickets $70-$20 Rockville, MD =F*! !!&!!##' RESV/INFO: 240-314-8690 statecollegejazzfestival.com 202-467-4600 www.kennedy-center.org =PcX^]P[6P[[Tah^U0ac)º?W^c^VaP_WXR 3XbR^eTaXTb» (cWP]STPa[h! cWRT] cdah_W^c^VaP_WbQhePaX^dbPacXbcbbW^f W^fcWT]Tf\TSXd\STeT[^_TSX]c^P] Make sure your message gets there fast—and first— PacU^a\cWa^dVW9d[h" º0Ra^bbRc º7T]aXA^dbbTPd)9d]V[TbX]?PaXb» Bars/Clubs, Entertainment, Travel, Finance, MD/DC Retail A^dbbTPd½bUP]cPbh[P]SbRP_TbST_XRcP 202.334.4130 bTSdRcXeTP]ScTaaXUhX]VUPaPfPhf^a[S Real Estate Developers, Home Furnishings, Restaurants, Technology, Charities, VA Retail CWXbXbcWTUXabc\PY^a0\TaXRP]aTca^ b_TRcXeT^UcWTPacXbc½bf^aZX]! hTPab cWa^dVW>Rc $% 2^]bcXcdcX^]0eT =F*! !!'(""%  =PcX^]P[6T^VaP_WXRB^RXTch)º2Pbc[Tb GHI A publication of P]S2adbPSTb)0EXTfX]

XX140c 4x3.75 [PaVT\^ST[RPbc[TbP]SPQPiPPa C7DAB30Hk & "! %k4G?A4BBk4!" 4]cTacPX]\T]ckFTTZT]S?Pbb

P]S2[PaZ)CWT=PcX^]P[1XRT]cT]]XP[» 60A34=BkC746A44=8=6>532 cdaTP]SbdQc[TcXTb^U^daR^\\^]eXbdP[ PacXUPRcbP]S^cWTaaPaT^QYTRcbST_XRc Tg_TaXT]RTbP]S`dTbcX^]cWTW^\^VT CWTBRT]T cWTePaX^dbRd[cdaP[T]R^d]cTabcWTcf^ ]TXch^U^dacX\Tº02WP]VT^U?[P]b»P Tg_[^aTabWPSSdaX]VcWTXaY^da]ThcWa^dVW eXST^X]bcP[[PcX^]QhBh\\Tb6PaS]Ta fXcW\^aTcWP]! WP]S_PX]cTSUXV 0\TaXRPcWa^dVWBT_c  cWBcaTTc X]fWXRWPaP]VT^UWd\P]T\^cX^]bPaT daX]Tb_a^eXSTPV[X\_bTX]c^cWT2ad 2^]bcXcdcX^]0eT]dT*! !%""  _aTbT]cTSc^STbRaXQT^daTg_TaXT]RTX] bPSTbTaPcWa^dVWBT_c#º>]TF^a[S =PcX^]P[]TCaXQT¹ATiP»bT[TRcTSX\PVTbUa^\ 0acb)ºEXbcPbP]SEXbX^]b»[P]SbRP_T cWX]V\XVWc[XTQTh^]SQ^cWcWa^dVW0dV ^eTa" hTPab^Uf^aZQh_W^c^Y^da]P[Xbc _PX]cX]VbUa^\cWT\dbTd\½b_Ta\P $'!" 6T^aVXP0eTBX[eTaB_aX]V*"  ATiPST_XRccWTc^a\T]cb^UfPaP]SaTe ]T]cR^[[TRcX^]cWa^dVW9d[h(2WPZPXP % '(  ^[dcX^]cWa^dVW>Rc(ºB^RRTa)?[P]TcPc 1^^ZTadbTbRPacXaTbc^RaTPcTbRd[_cdaTb APRWT[BRW[TbX]VTa2^]RTac7P[[ ?[Ph»_W^c^bP]SeXST^WXVW[XVWcb^UcWT cWa^dVWBT_c#º3aTP\X]VCWTXaFPh» 0acb2T]cTa=E22)?W^c^VaP_WbQh VP\TQTX]V_[PhTSQhP\PcTdabPa^d]S cWTf^aZ^U0dbcaP[XP]0Q^aXVX]P[f^\T] 1PaQPaPB^dcWf^acWcWa^dVW9d[h!! cWTf^a[ScWa^dVW>Rc!( #$ &cWBc _PX]cTabcWa^dVWBT_c!# !$ =TfH^aZ " =^acW1TPdaTVPaSBc0[TgP]SaXP* =F*! !'$&&$'' 0eT=F*! !&'"$  & "'#$% %$ =PcX^]P[;XQaPah^U[S6T^aVTc^f]A^PS1TcWTbSP*"  =PcX^]P[dcfX] !((% #! #/524%3953"' RP]6^[S»Ua^\cWT6[PbbT[[2^[[TRcX^] 1^^RWTeTa?^acaPXc2^\_TcXcX^]! %» ;0BC270=24AT]fXRZ6P[[Tah) cWa^dVW=^e!%º5Xabc;^^Z)CWTFP[c cWTf^aZb^UbTeT]UX]P[XbcbUa^\cWTUXabc C74740AC6A>FB5A>=34A)4HE53"OTANIC'ARDENISFEATURING º6aP]cF^^S½bBcdSX^)1XacW_[PRT^U0\Ta 3Xb]ThCXbW\P]0UaXRP]0ac2^[[TRcX^]» TeTaDB]PcX^]P[_^acaPXcR^\_TcXcX^] h3UMMER2EUNION!'ATHERINGOF0LANT&AMILIESvTOSHOWCASEADIVERSE XRP]6^cWXR» % f^aZbcWa^dVWBd] %%  cWa^dVW3TR"($ 8]ST_T]ST]RT0eT cWa^dVW5TQ '! &'cW5bcaTTcb RANGEOFFLORAFROMDIFFERENTPLANTFAMILIES*USTLIKEYOUROWNFAMILY ?T]]bh[eP]XP0eT=F*! !%""!'$  BF*! !%""  =F*! !%""  REUNION THISEXHIBITPULLSTOGETHERCOLORFULCHARACTERSFROMALLOVERTHE BPRZ[Ta6P[[Tah)º5PRX]V4Pbc)?^acaPXcb =PcX^]P[]T2T]cI6aX[[»cWTaPaTbc^UDB faXccT]f^aScWa^dVW9d[h ( $ &DBc Q[PRZbc^]TfPaTP]SfWXcT_^aRT[PX]Qh Tg_[^aTbW^f_^acaPXcbWPeTTg_aTbbTS %""  bcP\_bcWa^dVW>Rc ! &!

Thursdays, Noon - 2 p.m. Rain date Friday

June 8 Art Sherrod Jr. Smooth Jazz, R&B A special presentation by VSA arts: The Matt Savage Trio Jazz Tokounou African Drum Group June 15 David Bach Consort World, Pop June 22 Teri-S R&B Vocals June 29 Anthony Walker R&B, Smooth Jazz $ July 6 Matt Marshak Smooth Jazz Studios from 857 July 13 Eric Marner Smooth Jazz, R&B 1 BR from $ 999 July 21 (Fri.) Darryl Jones Soul, Jazz $ July 27 Dean Crawford & Country, Southern Rock 2 BR from 1200 the Dunn's River Band August 3 Englishman INCLUDED: Utilities, Fitness Center August 10 Bobby Parker Blues Gated Community WALK TO: Downtown, Waterfront, Metro, Shopping, Balconies CONCERT LOCATION MORE INFORMATION Restaurants, Arena Stage Lots of closet space Farragut Square 202.463.3400 Small pets welcome! Connecticut Ave. & K Street, NW ALL NEW: Kitchen Cabinets, Floor to Ceiling Insulated Windows, www.gtbid.com Individually Controlled Thermostats METRO Farragut North (Red) In partnership with the 201 I Street, SW, Washington, DC 20024 Farragut West (Blue/Orange) U.S. National Park Service 1-888-207-7025 M-F 9-6, Sat. & Sun. 10-5 4!#k4G?A4BBk & "! %kC7DAB30H FTTZT]S?Pbb

1811 14TH ST NW www.blackcatdc.com

JULY SHOWS

THU 13 PRIESTESS WOOLY MAMMOTH

FRI 14 SI*SE GROOVE COLLECTIVE

FRI 14 BLACK CATATONIA:DJ DK

SAT 15 MISSION OF BURMA ANTELOPE

SAT 15 BINGE/DIRGE: DJS DEAN & JOSHUA

SUN 16 EXOTIC FEVER FEST: WRONG DAY TO QUIT RICKY FITTS AUTOKINOTON TRIPLE TWINS

MON 17 THE ENGINE ROOM BEBEK

TUE 18 MONSTERS ARE WAITING BANDCAMP

WED 19 J.B. BEVERLEY & THE WAYWARD DRIFTERS 0!2!-/5.40)#452%3 JUNKROD JOE & THE CADILLAC HEARSE

THU 20 DON CABALLERO HARAM

FRI 21 KONONO NO. 1 CHOPTEETH 6AdkZIg^Vc\aZ

SAT 22 RUN FOR COVER 5 ALKEM FOUNDATION BENEFIT

SUN 23 DIPLO CSS L^i]VEVg^hIdjX]

THU 27 ADOLESCENTS THE VACANCIES 0<>=6C74<0=Hbfikh[Z[bebmb^lbgLmZge^r=hg^gÍl*2.-

SAT 29 BLACK HEART khfZgmb\\hf^]rÊLZ[kbgZ%Ëi^kaZilma^fhlmcZkkbg`blma^ PROCESSION CASTANETS \Zlmbg`h_Anfiak^r;h`ZkmZllh[^kfZgh_[nlbg^llZg]]nmb_ne lhgEbgnlEZkkZ[^^'HkfZr[^bmÍl:n]k^rA^i[nkgÍl^Zkerl\^g^l CONCERT-LINE 202-667-7960 Zl_knfirLZ[kbgZ?Zbk\abe]%lmnib]erbgeho^pbmaieZr[hr=Zob] FRI JULY 14 EZkkZ[^^!PbeebZfAhe]^g"';nm]^libm^ma^[nk]^gh_fZdbg`mabl [bsZkk^eho^mkbZg`e^\hgobg\bg`%]bk^\mhk=hg^gineelh__ma^pahe^ f^llh_fblieZ\^]a^ZkmlZg]IZkblfZd^ho^klpbmaiZgZ\a^'Bm l\k^^glhg?kb]ZrZm-3,)i'f'Zg]Lng]ZrZm+3+)i'f'ZliZkmh_ Hnk?ZbkEZ]r3Ma^?beflh_:n]k^rA^i[nkgZm:?BLbeo^k%1/,, Rc ºBd\\TaATd]X^])06PcWTaX]V 8b[P]SbP]ScWT4_XadbATVX^]»cWa^dVW ^U?[P]c5P\X[XTb»PbTaXTb^UVPaST]b BT_c"!"! BBc=F*! !%%& ##  bW^fRPbX]V SXUUTaT]c_[P]cUP\X[XTb A Publication of the GHI ;0BC270=24C^a_TS^5PRc^ah)º0[XeT cWa^dVW>Rc $ D=CAHk8CC0:4BCF>

URBAN-STYLE CONDOMINIUMS IN THE HEART OF THE HISTORIC DISTRICT.

• Private garaged parking • 1 1/2 blocks to MARC Train • Near dining, shopping, theaters • From the low $200’s to the $700’s and nightlife One- and Two-Bedroom Condominiums Visit Our Sales Center Today! Directions: I-270 North to Exit 31A, MD Route 85, Buckeystown Pike. Turn left onto Route 355. Continue 1 mile on Market St. to 69 South Market St. Sales Center will be on the left. Open daily. #/524%393/.9 (240) 529-1630 • www.MaxwellPlaceCondo.com 7>=:HC>=:740AC1A40:4AB)4HEGUYSINCOUNTRYDUO-ONTGOMERY 'ENTRYWEARTHEIRDAMAGEDHEARTSONTHEIRROLLED UPSLEEVESANDSTAY TRUETOTHEIRWORKING CLASSBACKGROUND/NCETHEOPENINGACTFOR+ENNY #HESNEYAND"ROOKS$UNN THESEHELL RAISINGHUNKSNOWHAVETHEIROWN SPOTINTHESUN ORINTHISCASE AT-ERRIWEATHER0OST0AVILIONON3UNDAY MHBR No.4760

Tg_[^aTb`dTbcX^]b^UbRXT]cXUXRaTb_^]bX Fine Dining Civil War History Outdoor Activities QX[XchP]ScWT^UcT]R^\_TcX]Vf^a[SeXTfb CWTBRT]T ^UbRXT]RTP]SPaccWa^dVW9d[h!" $ Jefferson County >[]ThCWTPcaT2T]cTa! >[]ThBP]Sh

CWP]cWTBf^aS)CWTBPcXaXRP[?T]^U:P[» B_aX]VA^PS>[]Th*" Shopping Outlet (!#"#  Festivals Racing Horse & Slots WestVirginia’s Eastern Gateway RT[TQaPcTbcWTf^aZb^U_^[XcXRP[RPac^^] ^[]ThcWTPcaT^aV Xbc:TeX]:P[[PdVWTaPZP:P[UTPcdaX]V 0bbPbbX]b)BXV]PcdaTCWTPcaTcPZTbP b^\T^UWXbQTccTaZ]^f]RPac^^]bP]S bW^cPccWTB^]SWTX\\dbXRP[PQ^dcf^a[S RPaXRPcdaTbUa^\CWT1P[cX\^aTBd]P]S [TPSTab½\^bcTUUTRcXeTT]T\XTbcWa^dVW CWT4R^]^\XbcPbfT[[Pbb^\T[TbbTa 9d[h!"" "' %B5^dada CWT1^aa^fTab)0SP_cTSUa^\]^e C^f]»PbT[TRcX^]^U4Pbc2^PbcPacXbcb T[bQh=;H0[[cWT6aTPc Tg_[^aTbcWT_^fTa^UaP_b^P\T[SX]V^U 1^^ZbPQaXSVTS)0Wd\^a^dbY^da cWT_^Tcah^URP[h_b^fXcWcWTR^]bRX^db ]ThcWa^dVWPR^]ST]bTSeTabX^]^UcWT ]Tbb^Ub^RPcWa^dVW9d[h" !'"! f^a[S½bVaTPc[XcTaPahf^aZbcWa^dVWBd] 60;0CWTPcaTCXe^[XB`dPaT"""" #cW # #$:T]]TSh2T]cTa!& 5Bc Bc=F*! !!"#& &#VP[PcWTPcaT^aV Antiquing C&O Canal Appalachian Trail Farms =F*! !# %'##'ZT]]TShRT]cTa^aV C78BF44:>=;H2WXRPV^)CWT 0]4g_TaX\T]cFXcWP]0Xa?d\_) C^]hPfPaSfX]]X]V1a^PSfPh\dbXRP[ BWT[PVWBcT_WT]b^]X]cTafTPeTbcf^ U^RdbTb^]cf^\daSTaTbbTbET[\P:T[[h John Brown’s Raid Harpers Ferry National Historical Park SXbcX]RccX\T_TaX^SbX]cWXb_[PhcWPc #ONTINUEDON% 4!%k4G?A4BBk & "! %kC7DAB30H FTTZT]S?Pbbk4]cTacPX]\T]c

BC064k4G?4A8<4=CB8=C4AA>A CTT]PVT1[^RZWTPS)1TacEA^hP[½b RP[aTedT^U1T[VXP]b^]VfaXcTa9PR`dTb d]PdcW^aXiTS_Pa^Sh^U0\TaXRP½bUPe^a 1aT[P]ScWT?PaXbXP]bfW^T\Q^ShWXb CWTBRT]T XcTR^\XRbcaX_cWa^dVW0dV%!$Bcd \dbXRUTPcdaTb!&4]V[XbWeTabX^]b^U SX^CWTPcaT $  #cWBc=F*! !""! WXbb^]VbcWa^dVW9d[h" cW"### #ONTINUEDFROM% "" bcdSX^cWTPcaT^aV >[]ThCWTPcaT2T]cTa! >[]ThBP]Sh P]SA^gXT7PacfW^UXVWcU^acWTXaUP\T ;0BC270=246P[PRcXZP)0RWX[SaT]½b B_aX]VA^PS>[]Th*" (!#"#  P]SUaTTS^\X]cWTV[XciP]SV[P\^da^U bW^f^UUTaX]VP]T]cTacPX]X]VfPhc^[TPa] ^[]ThcWTPcaT^aV (! b2WXRPV^cWa^dVWBd] '%$ PQ^dcPbca^]^\hcWa^dVWBd] ! $ C78BF44:4=3>=;H:TeX] F^[UCaP_5X[T]T2T]cTa %#$CaP_A^PS 2[PbbXZPCWTPcaT # B!'cWBc0a[X]V ?^[[PZ)BcP]Sd_R^\TSXP]:TeX]?^[[PZ EXT]]P*& "!$$ ( f^[UcaP_^aV c^]*& "'!#%! R[PbbXZP^aV WPbP__TPaTS^]º2T[TQaXch?^ZTa»2^\ C78BB0CDA30H>=;H2aXcXRP[ 7TSSP6PQ[Ta)7T]aXZ8QbT]½bUP\^db[h TSh2T]caP[P]SX]cWTUX[\bº7^bcPVT» 1aTPZbBW^fRPbT)0SP]RTcWTPcaT T]XV\PcXR_[PhPQ^dcaTbc[Tbb]Tf[h º05Tf6^^S[]ThCWTPcaT2T] ;XZT5PcWTa;XZTB^])CWXbUP\X[hSaP\P 34!."!2/5( PcaT $  #cWBc=F*! !""!""  cTaU^acWT0acb! >[]ThBP]Sh ST_XRcbcWTcT]bX^]bQTcfTT]P\^cWTa bcdSX^cWTPcaT^aV B20AHB284=24)#URRENTLYPLAYINGAT/LNEY4HEATRE#ENTER h!N B_aX]VA^PS>[]Th*" (!#"#  bcadVV[X]Vc^YdVV[Tf^aZP]SUP\X[hP C78BF44:4=3>=;H3PZbWX]P %XPERIMENT7ITHAN!IR0UMPvJUXTAPOSESTWOTIMEPERIODSAND ^[]ThcWTPcaT^aV UPcWTaUPX[X]VPcWXbY^QP]SPb^]STP[ 3P]XT[?W^T]XgBX]VW2^\ INWHICHSOCIETYWASATTHEBRINKOFAMAZINGANDLIFE CHANGINGSCIENTIFIC C78BF44:4=3>=;H8]cWT2^]cX] X]VfXcWcWT[TVPRh^USTbcadRcXeTPccX _P]h)2[PbbXRP[8]SXP]SP]RT\TTcb\^S DISCOVERIES3HELAGH3TEPHENSONSEEMLESSLYWEAVESTHESETWOSTORIES dd\)Cf^_[PhfaXVWcbPRc^ab_[PhS^i cdSTb_PbbTSS^f]Ua^\VT]TaPcX^]c^ Ta]U^a\bBPcBd]&! 3P]RT TOGETHERWITHTOUCHESOFDARKHUMORTOASKWHERESCIENCEISTAKINGUS T]b^Ua^[TbX]cWXb_[PhPQ^dccWT_a^Q[T\ VT]TaPcX^]cWa^dVW0dV%! 0c[Pb ?[PRT"!!$'cWBc=4*! !!%( %  ^U78E083BP\^]V0UaXRP]P]S0UaXRP] CWTPcaT """7Bc=4*! !"((&((" SP]RT_[PRT^aV 0\TaXRP]f^\T]_Pac^UcWT$cW0]]dP[ Pc[PbPacb^aV C78BF44:4=3>=;H32BW^acb* 5TbcXeP[CWd5aXUaTTBcdSX^CWT PQ[T[XUTP]S\dbXR^UcWTYPii[TVT]S3dZT 327X_7^_CWTPcaT5TbcXeP[5aXBPc ;Xcc[TF^\T])CWT1a^PSfPh\dbXRP[ CT]

* Summer FREE PRINTER! 4x6 *FREE after rebates and purchase of any Digital digital camera over $149 Photo $130 SALE $129.99 - $50 - $50 - $30=FREE* Value Sale ends 7/15/06. ! Printer *After Mail-In Rebates INCLUDED WITH PURCHASE OF ANY DIGITAL CAMERA: $300 DIGITAL PACKAGE • Free Software • Discount Coupons • Free Digital Prints FREE XTRA • Free Inkjet Paper • Free Photos on CD • And More! VALUE! million $50 Gift Card by mail Pentax 6.0 pixels Nikon 10x Optical Zoom FREE! ist DL Digital Canon * CoolPix® S4 *After $100 SLR Camera Digital Camera EOS Digital Mail-In w/Pentax 18-55mm Rebel XT Rebate AF Zoom Lens Canon $ 99 PowerShot A530 w/Canon 18-55mm $599.99 - $100= AF Zoom 349 Digital Camera $899.99 - $100= $ 99* million FREE Printer $130 499 pixels No Rebates! million $ 99* million *After $100 6.1 Value $ 99 5.0 pixels 8.0 pixels 4x Optical Zoom 799 Mail-In Rebate Photo Printer 199 Canon Free Gadget Digital Camera Prints Nikon DC10 DVD Bag & Tripod Pentax CoolPix® L4 with purchase Digital Camcorder $100 Value! Optio E10 Digital Camera As fast as Digital Camera * 2.4'' LCD $149.99 - $10= $ 95* 10 ¢ $ 99* 599 $ 99* *Before Instant Savings minutes each million 139 million 199 6.0 pixels *After Instant Savings 4.0 pixels as low as *Before Instant Savings 3x Optical Zoom 3x Optical Zoom 19*with prepaid DigiPrint Card Not responsible for typo- FREE graphic errors. Prices subject Photo Classes OVER 65 to change without notice. with camera purchase Some merchandise may be Area Locations limited in quantities or avail- able only at select locations. C7DAB30Hk & "! %k4G?A4BBk4!& FTTZT]S?Pbb

;42CDA4Bk1;0BC5A><C74?0BC

TakeTake a SummerSummer BreakBreak inin NewNew YorkYork CityCity

This summer New York is offering you great savings on #/524%39-# hotels, dining, shopping, theater, museums, attractions 0B:0=4G?4AC)4HROUGH&RIDAY -ONTGOMERY#OLLEGES'ERMANTOWNCAM and more, all when you use your American Express® PUSOFFERShACTOR SCHOLARSvDELIVERINGSPEECHESINTHEPERSONAEOFHISTORICAL FIGURES INCLUDING,EONARDO$A6INCIAND#OCO#HANEL!FTERTHAT THEYLLTAKE Card. To get your free Summer Breaks Savings guide, QUESTIONSˆFIRSTINCHARACTER THENASTHEMSELVES4HEFREEEVENTSWILLBE stop by an Official Visitor Information Center or Kiosk. PRECEDEDBYPERFORMANCESOFPERIODMUSICBYLOCALMUSICIANS

X]cWTBWTPaac^]½bºCWTAdUUXP]^]cWTBcPXa» 2^\_P]h#$ &cWBc=F*! !$#& !! P]S2WPa[Tb1dbRW½bTPa[h (' bSaPV BWPZTb_TPaTCWTPcaT^aV R[PbbXRºEP\_XaT;TbQXP]b^UB^S^\» =^4]S^U1[P\T)0eXeXST_XR_^acaPhP[ ^_T]b5aXcWa^dVW0dV "" $  ^UcWTT]VPVT\T]c^UcWTPacXbcP]ScWT 2WdaRWBcaTTcCWTPcaT &#!2WdaRWBc bcPcTcWa^dVW9d[h!" $>[]ThCWTPcaT =F*! !""!($! PcfSR^aV 2T]cTaU^acWT0acb! >[]ThBP]Sh ;0BC270=24DB0)BcPVTPSP_cP B_aX]VA^PS>[]Th*" (!#"#  cX^]^U3^]?Pbb^½bR[PbbXRbPVPRP_cdaX]V ^[]ThcWTPcaT^aV cWTP[[daTP]S_a^\XbT^U0\TaXRPX]cWT C7DAB30H>=;H?aXb^]?^TcahQh ! bcRT]cdahcWa^dVW9d[h $!"!( ?P_X:h\^]T5aTT\P])>]TPRc_[Ph CWTPcTa886d]bc^]0acb2T]cTa!&  U^[[^fbcWTcWaTT\T]Ua^\cWaTTSXUUTa B;P]VBc0a[X]Vc^]*& "$$"'&'! T]cVT]TaPcX^]bfW^bWPaTcWTbP\TYPX[ P\TaXRP]RT]cdah^aV

RT[[^]T]XVWc_Pac^UcWT$cW0]]dP[32 CWTFPXcX]VA^^\)0bPcXaXRP[[^^ZPc NYC & Company is the city’s official tourism organization. Official Visitor Information Centers and Kiosks 212.484.1222: Midtown 810 Seventh Avenue 7X_7^_CWTPcaT5TbcXeP[CWdUaTTBcd f^\T]fW^PccT\_cc^_TaUTRccWTXaQ^S at 53rd Street Lower Manhattan NYC Heritage Tourism Center, City Hall Park Row Chinatown the triangle where Canal, Walker and Baxter Streets meet. SX^CWTPcaT $  #cWBc=F*! !""! XTbX]^aSTac^[XeTd_c^\P[TUP]cPbXTb "" bcdSX^cWTPcaT^aV P]ScWTWTP[cWaT_TaRdbbX^]bcWPcT]bdT COORDINATOR CASE MANAGER WEB DEVELOPER NETWORK ENGINEER APPLICATION C78BF44:4=3>=;H?a^[XUXR5XV cWa^dVW9d[h!!  !$ ;PdaT[QbTaePcX^]3aXeT XPcTTPRW^cWTaP]SSaPf^dcbTRaTcb TELEMARKETER RECEPTIONIST STAFF ATTORNEY VETERINARY TECHNICIAN 6Ta\P]c^f]