SPINLW1 Monoclonal Antibody (M02A), Clone 4G3

Total Page：16

File Type：pdf, Size：1020Kb

SPINLW1 monoclonal antibody (M02A), clone 4G3 Catalog # : H00057119-M02A 規格 : [ 200 uL ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Recombinant protein) Description: SPINLW1. ELISA Immunogen: SPINLW1 (NP_065131, 22 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKK CLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNN NFQSKANCLNTCKNKRFP Host: Mouse Reactivity: Human Isotype: IgM Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (38.06 KDa) . Storage Buffer: In ascites fluid Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Recombinant protein) Protocol Download ELISA Gene Information Entrez GeneID: 57119 Page 1 of 2 2020/6/26 GeneBank NM_020398 Accession#: Protein NP_065131 Accession#: Gene Name: SPINLW1 Gene Alias: EPPIN,EPPIN1,EPPIN2,EPPIN3,WAP7,WFDC7,dJ461P17.2 Gene serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) Description: Omim ID: 609031 Gene Ontology: Hyperlink Gene Summary: This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq Other OTTHUMP00000031137,OTTHUMP00000031138,WAP four-disulfide Designations: core domain 7,epididymal protease inhibitor,serine peptidase inhibitor- like, with Kunitz and WAP domains 1,serine protease inhibitor-like, with Kunitz and WAP domains 1 (eppin) Related Disease Genetic Predisposition to Disease Infertility, Male 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2020 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2020/6/26.

Copy Link

Recommended publications

Small Cell Ovarian Carcinoma: Genomic Stability and Responsiveness to Therapeutics
Gamwell et al. Orphanet Journal of Rare Diseases 2013, 8:33 http://www.ojrd.com/content/8/1/33 RESEARCH Open Access Small cell ovarian carcinoma: genomic stability and responsiveness to therapeutics Lisa F Gamwell1,2, Karen Gambaro3, Maria Merziotis2, Colleen Crane2, Suzanna L Arcand4, Valerie Bourada1,2, Christopher Davis2, Jeremy A Squire6, David G Huntsman7,8, Patricia N Tonin3,4,5 and Barbara C Vanderhyden1,2* Abstract Background: The biology of small cell ovarian carcinoma of the hypercalcemic type (SCCOHT), which is a rare and aggressive form of ovarian cancer, is poorly understood. Tumourigenicity, in vitro growth characteristics, genetic and genomic anomalies, and sensitivity to standard and novel chemotherapeutic treatments were investigated in the unique SCCOHT cell line, BIN-67, to provide further insight in the biology of this rare type of ovarian cancer. Method: The tumourigenic potential of BIN-67 cells was determined and the tumours formed in a xenograft model was compared to human SCCOHT. DNA sequencing, spectral karyotyping and high density SNP array analysis was performed. The sensitivity of the BIN-67 cells to standard chemotherapeutic agents and to vesicular stomatitis virus (VSV) and the JX-594 vaccinia virus was tested. Results: BIN-67 cells were capable of forming spheroids in hanging drop cultures. When xenografted into immunodeficient mice, BIN-67 cells developed into tumours that reflected the hypercalcemia and histology of human SCCOHT, notably intense expression of WT-1 and vimentin, and lack of expression of inhibin. Somatic mutations in TP53 and the most common activating mutations in KRAS and BRAF were not found in BIN-67 cells by DNA sequencing.
[Show full text]
Primate Specific Retrotransposons, Svas, in the Evolution of Networks That Alter Brain Function
Title: Primate specific retrotransposons, SVAs, in the evolution of networks that alter brain function. Olga Vasieva1*, Sultan Cetiner1, Abigail Savage2, Gerald G. Schumann3, Vivien J Bubb2, John P Quinn2*, 1 Institute of Integrative Biology, University of Liverpool, Liverpool, L69 7ZB, U.K 2 Department of Molecular and Clinical Pharmacology, Institute of Translational Medicine, The University of Liverpool, Liverpool L69 3BX, UK 3 Division of Medical Biotechnology, Paul-Ehrlich-Institut, Langen, D-63225 Germany *. Corresponding author Olga Vasieva: Institute of Integrative Biology, Department of Comparative genomics, University of Liverpool, Liverpool, L69 7ZB, [email protected] ; Tel: (+44) 151 795 4456; FAX:(+44) 151 795 4406 John Quinn: Department of Molecular and Clinical Pharmacology, Institute of Translational Medicine, The University of Liverpool, Liverpool L69 3BX, UK, [email protected]; Tel: (+44) 151 794 5498. Key words: SVA, trans-mobilisation, behaviour, brain, evolution, psychiatric disorders 1 Abstract The hominid-specific non-LTR retrotransposon termed SINE–VNTR–Alu (SVA) is the youngest of the transposable elements in the human genome. The propagation of the most ancient SVA type A took place about 13.5 Myrs ago, and the youngest SVA types appeared in the human genome after the chimpanzee divergence. Functional enrichment analysis of genes associated with SVA insertions demonstrated their strong link to multiple ontological categories attributed to brain function and the disorders. SVA types that expanded their presence in the human genome at different stages of hominoid life history were also associated with progressively evolving behavioural features that indicated a potential impact of SVA propagation on a cognitive ability of a modern human.
[Show full text]
Sequence Diversity of Pan Troglodytes Subspecies and the Impact of WFDC6 Selective Constraints in Reproductive Immunity
GBE Sequence Diversity of Pan troglodytes Subspecies and the Impact of WFDC6 Selective Constraints in Reproductive Immunity Ze´lia Ferreira1,2,3,4,*,y, Belen Hurle1,y, Aida M. Andre´s5,WarrenW.Kretzschmar6, James C. Mullikin7, Praveen F. Cherukuri7, Pedro Cruz7, Mary Katherine Gonder8,AnneC.Stone9, Sarah Tishkoff10, Willie J. Swanson11, NISC Comparative Sequencing Program1,7, Eric D. Green1, Andrew G. Clark12,and Downloaded from Susana Seixas2 1National Human Genome Research Institute, National Institutes of Health, Bethesda, MD 2Institute of Molecular Pathology and Immunology of the University of Porto (IPATIMUP), Porto, Portugal 3Department of Zoology and Anthropology, Faculty of Sciences, University of Porto, Porto, Portugal http://gbe.oxfordjournals.org/ 4Department of Computational and Systems Biology, University of Pittsburgh 5Department of Evolutionary Genetics, Max Planck Institute for Evolutionary Anthropology, Leipzig, Germany 6Genomic Medicine and Statistics, Wellcome Trust Centre for Human Genetics, University of Oxford, Oxford, United Kingdom 7NIH Intramural Sequencing Center (NISC), National Human Genome Research Institute, National Institutes of Health, Rockville, MD 8Department of Biology, Drexel University 9School of Human Evolution and Social Change, Arizona State University 10Departments of Genetics and Biology, University of Pennsylvania at Max Planck Institut Fuer Evolutionaere Anthropologie on February 11, 2014 11Department of Genome Sciences, University of Washington 12Department of Biology of Molecular Biology and Genetics, Cornell University *Corresponding author: Department of Computational and Systems Biology, University of Pittsburgh. E-mail: [email protected]. yThese authors contributed equally to this work. Accepted: December 2, 2013 Abstract Recent efforts have attempted to describe the population structure of common chimpanzee, focusing on four subspecies: Pan troglodytes verus, P.
[Show full text]
Topological Network Analysis of Differentially Expressed Genes In
CANCER GENOMICS & PROTEOMICS 12 : 153-166 (2015) Topological Network Analysis of Differentially Expressed Genes in Cancer Cells with Acquired Gefitinib Resistance YOUNG SEOK LEE 1, SUN GOO HWANG 2, JIN KI KIM 1, TAE HWAN PARK 3, YOUNG RAE KIM 1, HO SUNG MYEONG 1, KANG KWON 4, CHEOL SEONG JANG 2, YUN HEE NOH 1 and SUNG YOUNG KIM 1 1Department of Biochemistry, School of Medicine, Konkuk University, Seoul, Republic of Korea; 2Plant Genomics Laboratory, Department of Applied Plant Science, Kangwon National University, Chuncheon, Republic of Korea; 3Department of Plastic and Reconstructive Surgery, College of Medicine, Yonsei University, Seoul, Republic of Korea; 4School of Korean Medicine, Pusan National University, Yangsan, Republic of Korea Abstract. Background/Aim: Despite great effort to elucidate into the complex mechanism of AGR and to novel gene the process of acquired gefitinib resistance (AGR) in order to expression signatures useful for further clinical studies. develop successful chemotherapy, the precise mechanisms and genetic factors of such resistance have yet to be elucidated. Although chemotherapy is the most common treatment for Materials and Methods: We performed a cross-platform meta- various cancer types, the development of acquired resistance analysis of three publically available microarray datasets to anticancer drugs remains a serious problem, leading to a related to cancer with AGR. For the top 100 differentially majority of patients who initially responded to anticancer expressed genes (DEGs), we clustered functional modules of drugs suffering the recurrence or metastasis of their cancer (1- hub genes in a gene co-expression network and a protein- 3). Acquired drug resistance (ADR) is known to have a multi- protein interaction network.
[Show full text]
Distribution of Eppin in Mouse and Human Testis
MOLECULAR MEDICINE REPORTS 4: 71-75, 2011 Distribution of Eppin in mouse and human testis YAN LONG, AIHuA Gu, HuA YANG, GuIxIANG JI, xIuMEI HAN, LING SONG, SHOuLIN WANG and xINRu WANG Key Laboratory of Reproductive Medicine, Institute of Toxicology, Nanjing Medical university, Nanjing 210029, P.R. China Received August 31, 2010; Accepted November 29, 2010 DOI: 10.3892/mmr.2010.403 Abstract. The human Eppin (hEppin) (SPINLW1; Epididymal Previous studies have shown that a number of the key protease inhibitor) gene was first described and sequenced in processes regulating the activity and fate of many proteins 2001, and later identified as an immunocontraceptive target involved in epididymis are strictly dependent on proteolytic for males in 2004. The expression and function of the mouse events. Therefore, proteases and protease inhibitors, which eppin (mEppin) gene was first described in 2003, and recent are implicated in tight junction/adherent junction (TJ/AJ) studies have shown that mEppin protein has a similar male assembly (3), are important regulators of Sertoli cell TJ contraceptive effect in mice. In this study, we designed a dynamics (4). probe to detect mEppin mRNA in frozen sections from the Human eppin (hEppin) is a member of a highly conserved testes of 60-day-old mice as well as in the GC-1, GC-2 and family of protease inhibitors that are expressed in the testis MLTC-1 cell lines, using a hyperbiotinylated oligonucleotide and epididymis, and was first identified and sequenced as a DNA probe. In addition to Sertoli cells, the expression of novel serine protease inhibitor in 2001.
[Show full text]
Androgen Signaling in Sertoli Cells Lavinia Vija
Androgen Signaling in Sertoli Cells Lavinia Vija To cite this version: Lavinia Vija. Androgen Signaling in Sertoli Cells. Human health and pathology. Université Paris Sud - Paris XI, 2014. English. NNT : 2014PA11T031. tel-01079444 HAL Id: tel-01079444 https://tel.archives-ouvertes.fr/tel-01079444 Submitted on 2 Nov 2014 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. UNIVERSITE PARIS-SUD ÉCOLE DOCTORALE : Signalisation et Réseaux Intégratifs en Biologie Laboratoire Récepteurs Stéroïdiens, Physiopathologie Endocrinienne et Métabolique Reproduction et Développement THÈSE DE DOCTORAT Soutenue le 09/07/2014 par Lavinia Magdalena VIJA SIGNALISATION ANDROGÉNIQUE DANS LES CELLULES DE SERTOLI Directeur de thèse : Jacques YOUNG Professeur (Université Paris Sud) Composition du jury : Président du jury : Michael SCHUMACHER DR1 (Université Paris Sud) Rapporteurs : Serge LUMBROSO Professeur (Université Montpellier I) Mohamed BENAHMED DR1 (INSERM U1065, Université Nice)) Examinateurs : Nathalie CHABBERT-BUFFET Professeur (Université Pierre et Marie Curie) Gabriel
[Show full text]
Characterisation of Eppin Function: Expression and Activity in the Lung
ORIGINAL ARTICLE LUNG BIOLOGY Characterisation of eppin function: expression and activity in the lung Aaron Scott1,7, Arlene Glasgow1,7, Donna Small1, Simon Carlile1, Maelíosa McCrudden2, Denise McLean2, Ryan Brown1, Declan Doherty1, Fionnuala T. Lundy2, Umar I. Hamid2, Cecilia M. O’Kane2, Daniel F. McAuley2, Malcolm Brodlie3, Michael Tunney4, J. Stuart Elborn2, Chris R. Irwin5, David J. Timson 6, Clifford C. Taggart1 and Sinéad Weldon1 Affiliations: 1Airway Innate Immunity Research Group, Centre for Experimental Medicine, Wellcome-Wolfson Institute for Experimental Medicine, Queen’s University Belfast, Belfast, UK. 2Centre for Experimental Medicine, Wellcome-Wolfson Institute for Experimental Medicine, Queen’s University Belfast, Belfast, UK. 3Paediatric Respiratory Unit, Great North Children’s Hospital and Institute of Cellular Medicine, Newcastle University, Newcastle upon Tyne, UK. 4Halo, School of Pharmacy, Queen’s University Belfast, Belfast, UK. 5Centre for Dentistry, Queen’s University Belfast, Belfast, UK. 6School of Pharmacy and Biomolecular Sciences, University of Brighton, Brighton, UK. 7Joint first authors. Correspondence: Cliff Taggart, Airway Innate Immunity Research Group, Centre for Infection and Immunity, Wellcome-Wolfson Institute for Experimental Medicine, Queen’s University Belfast, Belfast, BT9 7BL, UK. E-mail: [email protected] @ERSpublications Eppin is a low-molecular-weight protein which is expressed in the human lung during inflammation http://ow.ly/WZuQ30aELEI Cite this article as: Scott A, Glasgow A, Small D, et al. Characterisation of eppin function: expression and activity in the lung. Eur Respir J 2017; 50: 1601937 [https://doi.org/10.1183/13993003.01937-2016]. ABSTRACT Eppin is a serine protease inhibitor expressed in male reproductive tissues. The aim of this study was to investigate the localisation and regulation of eppin expression in myeloid and epithelial cell lines, and explore its potential role as a multifunctional host defence protein.
[Show full text]
The DNA Sequence and Comparative Analysis of Human Chromosome 20
articles The DNA sequence and comparative analysis of human chromosome 20 P. Deloukas, L. H. Matthews, J. Ashurst, J. Burton, J. G. R. Gilbert, M. Jones, G. Stavrides, J. P. Almeida, A. K. Babbage, C. L. Bagguley, J. Bailey, K. F. Barlow, K. N. Bates, L. M. Beard, D. M. Beare, O. P. Beasley, C. P. Bird, S. E. Blakey, A. M. Bridgeman, A. J. Brown, D. Buck, W. Burrill, A. P. Butler, C. Carder, N. P. Carter, J. C. Chapman, M. Clamp, G. Clark, L. N. Clark, S. Y. Clark, C. M. Clee, S. Clegg, V. E. Cobley, R. E. Collier, R. Connor, N. R. Corby, A. Coulson, G. J. Coville, R. Deadman, P. Dhami, M. Dunn, A. G. Ellington, J. A. Frankland, A. Fraser, L. French, P. Garner, D. V. Grafham, C. Grif®ths, M. N. D. Grif®ths, R. Gwilliam, R. E. Hall, S. Hammond, J. L. Harley, P. D. Heath, S. Ho, J. L. Holden, P. J. Howden, E. Huckle, A. R. Hunt, S. E. Hunt, K. Jekosch, C. M. Johnson, D. Johnson, M. P. Kay, A. M. Kimberley, A. King, A. Knights, G. K. Laird, S. Lawlor, M. H. Lehvaslaiho, M. Leversha, C. Lloyd, D. M. Lloyd, J. D. Lovell, V. L. Marsh, S. L. Martin, L. J. McConnachie, K. McLay, A. A. McMurray, S. Milne, D. Mistry, M. J. F. Moore, J. C. Mullikin, T. Nickerson, K. Oliver, A. Parker, R. Patel, T. A. V. Pearce, A. I. Peck, B. J. C. T. Phillimore, S. R. Prathalingam, R. W. Plumb, H. Ramsay, C. M.
[Show full text]
Supplementary Tables S1-S3
Supplementary Table S1: Real time RT-PCR primers COX-2 Forward 5’- CCACTTCAAGGGAGTCTGGA -3’ Reverse 5’- AAGGGCCCTGGTGTAGTAGG -3’ Wnt5a Forward 5’- TGAATAACCCTGTTCAGATGTCA -3’ Reverse 5’- TGTACTGCATGTGGTCCTGA -3’ Spp1 Forward 5'- GACCCATCTCAGAAGCAGAA -3' Reverse 5'- TTCGTCAGATTCATCCGAGT -3' CUGBP2 Forward 5’- ATGCAACAGCTCAACACTGC -3’ Reverse 5’- CAGCGTTGCCAGATTCTGTA -3’ Supplementary Table S2: Genes synergistically regulated by oncogenic Ras and TGF-β AU-rich probe_id Gene Name Gene Symbol element Fold change RasV12 + TGF-β RasV12 TGF-β 1368519_at serine (or cysteine) peptidase inhibitor, clade E, member 1 Serpine1 ARE 42.22 5.53 75.28 1373000_at sushi-repeat-containing protein, X-linked 2 (predicted) Srpx2 19.24 25.59 73.63 1383486_at Transcribed locus --- ARE 5.93 27.94 52.85 1367581_a_at secreted phosphoprotein 1 Spp1 2.46 19.28 49.76 1368359_a_at VGF nerve growth factor inducible Vgf 3.11 4.61 48.10 1392618_at Transcribed locus --- ARE 3.48 24.30 45.76 1398302_at prolactin-like protein F Prlpf ARE 1.39 3.29 45.23 1392264_s_at serine (or cysteine) peptidase inhibitor, clade E, member 1 Serpine1 ARE 24.92 3.67 40.09 1391022_at laminin, beta 3 Lamb3 2.13 3.31 38.15 1384605_at Transcribed locus --- 2.94 14.57 37.91 1367973_at chemokine (C-C motif) ligand 2 Ccl2 ARE 5.47 17.28 37.90 1369249_at progressive ankylosis homolog (mouse) Ank ARE 3.12 8.33 33.58 1398479_at ryanodine receptor 3 Ryr3 ARE 1.42 9.28 29.65 1371194_at tumor necrosis factor alpha induced protein 6 Tnfaip6 ARE 2.95 7.90 29.24 1386344_at Progressive ankylosis homolog (mouse)
[Show full text]
Genomic Approach in Idiopathic Intellectual Disability Maria De Fátima E Costa Torres
ESTUDOS DE 8 01 PDPGM 2 CICLO Genomic approach in idiopathic intellectual disability Maria de Fátima e Costa Torres D Autor. Maria de Fátima e Costa Torres D.ICBAS 2018 Genomic approach in idiopathic intellectual disability Genomic approach in idiopathic intellectual disability Maria de Fátima e Costa Torres SEDE ADMINISTRATIVA INSTITUTO DE CIÊNCIAS BIOMÉDICAS ABEL SALAZAR FACULDADE DE MEDICINA MARIA DE FÁTIMA E COSTA TORRES GENOMIC APPROACH IN IDIOPATHIC INTELLECTUAL DISABILITY Tese de Candidatura ao grau de Doutor em Patologia e Genética Molecular, submetida ao Instituto de Ciências Biomédicas Abel Salazar da Universidade do Porto Orientadora – Doutora Patrícia Espinheira de Sá Maciel Categoria – Professora Associada Afiliação – Escola de Medicina e Ciências da Saúde da Universidade do Minho Coorientadora – Doutora Maria da Purificação Valenzuela Sampaio Tavares Categoria – Professora Catedrática Afiliação – Faculdade de Medicina Dentária da Universidade do Porto Coorientadora – Doutora Filipa Abreu Gomes de Carvalho Categoria – Professora Auxiliar com Agregação Afiliação – Faculdade de Medicina da Universidade do Porto DECLARAÇÃO Dissertação/Tese Identificação do autor Nome completo _Maria de Fátima e Costa Torres_ N.º de identificação civil _07718822 N.º de estudante __ 198600524___ Email institucional [email protected] OU: [email protected] _ Email alternativo [email protected] _ Tlf/Tlm _918197020_ Ciclo de estudos (Mestrado/Doutoramento) _Patologia e Genética Molecular__ Faculdade/Instituto _Instituto de Ciências
[Show full text]
A Genomic Analysis of Rat Proteases and Protease Inhibitors
A genomic analysis of rat proteases and protease inhibitors Xose S. Puente and Carlos López-Otín Departamento de Bioquímica y Biología Molecular, Facultad de Medicina, Instituto Universitario de Oncología, Universidad de Oviedo, 33006-Oviedo, Spain Send correspondence to: Carlos López-Otín Departamento de Bioquímica y Biología Molecular Facultad de Medicina, Universidad de Oviedo 33006 Oviedo-SPAIN Tel. 34-985-104201; Fax: 34-985-103564 E-mail: [email protected] Proteases perform fundamental roles in multiple biological processes and are associated with a growing number of pathological conditions that involve abnormal or deficient functions of these enzymes. The availability of the rat genome sequence has opened the possibility to perform a global analysis of the complete protease repertoire or degradome of this model organism. The rat degradome consists of at least 626 proteases and homologs, which are distributed into five catalytic classes: 24 aspartic, 160 cysteine, 192 metallo, 221 serine, and 29 threonine proteases. Overall, this distribution is similar to that of the mouse degradome, but significatively more complex than that corresponding to the human degradome composed of 561 proteases and homologs. This increased complexity of the rat protease complement mainly derives from the expansion of several gene families including placental cathepsins, testases, kallikreins and hematopoietic serine proteases, involved in reproductive or immunological functions. These protease families have also evolved differently in the rat and mouse genomes and may contribute to explain some functional differences between these two closely related species. Likewise, genomic analysis of rat protease inhibitors has shown some differences with the mouse protease inhibitor complement and the marked expansion of families of cysteine and serine protease inhibitors in rat and mouse with respect to human.
[Show full text]
Integrative Genetic and Epigenetic Analysis Uncovers Regulatory
bioRxiv preprint doi: https://doi.org/10.1101/054361; this version posted May 19, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. 1 Integrative genetic and epigenetic analysis uncovers regulatory 2 mechanisms of autoimmune disease 1;2 2;3 1;2;4;5 3 Parisa Shooshtari , Hailieng Huang , and Chris Cotsapas 4 May 19, 2016 1 5 Department of Neurology, Yale School of Medicine, New Haven CT, USA 2 6 Program in Medical and Population Genetics and Stanley Center for Psychiatric Research, Broad 7 Institute of Harvard and MIT, Cambridge, Massachusetts, USA 3 8 Analytic and Translational Genetics Unit, Department of Medicine, Massachusetts General Hos- 9 pital and Harvard Medical School, Boston, Massachusetts, USA 4 10 Department of Genetics, Yale School of Medicine, New Haven CT, USA 5 11 Correspondence to CC, [email protected] 12 13 Genome-wide association studies in autoimmune and inflammatory diseases (AID) 1,2 14 have uncovered hundreds of loci mediating risk . These associations are preferen- 3,4 15 tially located in non-coding DNA regions and in particular to tissue–specific DNase 5,6 16 I hypersensitivity sites (DHS) . Whilst these analyses clearly demonstrate the over- 17 all enrichment of disease risk alleles on gene regulatory regions, they are not designed 18 to identify individual regulatory regions mediating risk or the genes under their con- 19 trol, and thus uncover the specific molecular events driving disease risk.
[Show full text]