Volume 22 2018 / 2019 Natural Retail Catalog HEALTH & BEAUTY Discover More from Africa • Over 850 Body and Fragrance Oils • The Largest Selection of African Anywhere • Black Soaps • Healthcare • Skin Care • Body Oils • African Herbal Remedies • Dental Hygiene • Incense • More

See the latest products inside 2

Find the most effective African and herbal remedies for your body. Choose from over 100 different African soaps, and over 800 different oils. Find a huge selection of ethnic skin care SURGXFWV7KHUH¶VQRLVVXHWKDW\RXFDQ W¿[ now: from acne to aging and everything in between. African skin care helps you and your entire family!

It's all here.

Enjoy natures purity Sample all our best selling from morning till night Skin Care Products

Dudu-Osum Herbal Bath-Body-Hair Kit &ROOHFWDOO¿YH&RPHVZLWK natural shampoo, raw lotion, African black , conditioner, and oil & moisturizer. M-P198 $39.90 Save $10.00

Natural Healing Oils Sampler Set This set of ten ½ oz. oils will give you a solution to numerous health and beauty concerns. X-020 $29.90 Black Soap Kit Kit includes: Black Soap Body Wash, Black Soap Paste, Natural Black Soap. M-P251 $18.22 20% savings! Purchase separately for $22.78.

African Skin Care Sampler Kit 7KLVNLWOHWV\RXVDPSOHDOOWKHSURGXFWVWR¿QGRXWZKLFK SURGXFWVEHQH¿W\RXWKHPRVWX-025 $19.90 3 TABLE of CONTENTS

Soaps & Cleansers See Pages 4-19

HealthcareH SeeS pages 20-25

Skin and Hair Care See pages 26-45

Oils and Oil Burners See pages 46-59

Incense See page 60-61

Shea Butter See page 62-63 4 #1 BEST SELLing soap • All-Natural

• Hand-Made

• The Famous African Recipe

Enriched with Shea Butter

Only $3.98

Dudu-Osun Healing Soap :KHQ'XGX2VXQZDV¿UVWLQWURGXFHGWRWKH86ZHZHUHRYHUZKHOPHGE\WKHUHVSRQVH We had hundreds of customers telling us how this soap had healed their psoriasis, their eczema, or their stretch marks! Since then it’s become our best-selling soap and the people who use it swear by it! Made with a unique blend of shea butter, tropical herbs, and native honey for the best in skin care. 5.25 oz. Made in . M-S501 $3.98 each

Premium Raw Black Soap This soft black soap does wonders for irritated, sensitive skin that is in need of gentle natural Shea Butter Black Soap healing. The soap deeply cleanses while providing 5 oz. M-S463 $3.98 skin with a protective layer of moisture and vitamins. 8 oz. M-S217 $7.90 5 Natural Black Soaps

Hand-Crafted Natural Black Soap The traditional recipe, made using cocoa pod powder, plantain skins, tropical honey and shea butter. Save more with larger sizes! M-S520

Available in all these sizes:

½ lb. (8 oz.) - $7.90 6 lbs. - $59.40 1 lb. - $13.90 7 lbs. - $69.30 2 lbs. - $23.90 8 lbs. - $76.00 3 lbs. - $33.90 9 lbs. - $83.70 4 lb. - $41.90 10 lbs. - $91.00 5 lbs. - $49.50

Money Saver With Fragrance

Get the healing power of natural black soap ZLWKWKHH[WUDOX[XU\ of essential oil fragrances.

Cucumber Melon Tropical Mango Natural Black Soap Natural Black 5 oz. Soap 5 oz. M-S481 $5.98 M-S484 $5.98 Lavender Natural Lemongrass Black Soap 5 oz. Black Soap 5 oz. M-S482 $5.98 M-S485 $5.98 Unscented Natural Raw Natural Black Soap Bar Black Soap 5 oz. 6 oz. M-S514 $3.58 each M-S483 $5.98 6 A. B. C. D. E.

Dudu-Osum Virgin Hair-Gro Cream Amazing blend of African Herbs for hair growth and condi- tioning. M-S118 $8.98

Get them all! Save $5.00 Dudu-Osum Herbal Bath-Body-Hair Kit Comes with natural shampoo, raw shea butter lotion, African black soap, conditioner, and oil & moisturizer. M-P198 $39.90

A. Dudu-Osum Liquid Black D. Dudu-Osum Natural Moist Soap Conditioner Get natural cleansing with With anti-bacterial Tea the power of natural Nigerian Tree oil, healing African ingredients including aloe, Neem oil and herbs. shea butter, honey, and Restores moisture, prevents more. M-S506 $8.98 breakage, and detangles and adds shine. B. Dudu-Osum Healing Raw M-S116 $8.98 Shea Lotion 100% natural shea butter E. Dudu-Osum Oil & with aloe vera, ginseng Moisturizer and an array of therapeutic This natural treatment is Dudu-Osum herbs, botanical essential enriched with shea butter Anti-Itching RLOVDQGSODQWH[WUDFWV and jojoba oil to soothe and Braiding Spray M-S117 $8.98 heal hair, scalp, skin and No build up residue. nails. 8 oz. Made in Nigeria. Braided styles last C. Dudu-Osum Softening M-S119 $8.98 longer. Conditions, Shampoo moisturizes, elimi- All-natural. Heals irritated nates itchy dry scalp, scalp, rids scalp of dandruff, reduces breakage, cleanses, and gives hair an and provides healthy intense sheen. 8 oz. Made in sheen. Made in Nigeria. M-314 $8.98 Nigeria M-S120 $8.98 Liquid African Soaps and 7 Shampoos Naturally Nourish Your Skin and Hair

African Dudu-Shea Black Seed Oil Honey Soap Liquid Black Soap 8 oz. Made in Niger. 8 oz. M-S109 $7.58 M-S114 $7.90

Liquid Black Soap and Body Wash This black soap is enriched with shea butter to heal and soften the skin. 8 oz. Made in the 86$M-S110 $6.98

Lavender Liquid Peppermint Liquid Black Soap Soap 8 oz. M-S108 $7.58 8 oz. M-S107 $7.58 8 As Buttery As You Can Get BEST Shea butter beats out the competition with this huge SELLER 5.5 oz. bar of buttery, skin- softening soap. You’ll feel instantly soft and smooth in the shower when you use this soap. • Heals stretch marks • Heals chapped, dry skin • Fights away aging and scarring Shea Butter Soap Bar M-S455 $3.98

4 Fragrances | 4 Ways to Revived Skin Supersized Black Soap Bars in your Favorite Fragrances All soaps have a uniform color and Choose your favorite fragrances! packaging style. #1 Baby Powder M-S451 $3.98 #2 White Diamond M-S452 $3.98 All Original African Black Soaps are large #3 Egyptian Musk M-S461 $3.98 5 oz. bars 6H[2Q7KH%HDFK M-S453 $3.98

#1 #2

$3.98 each

#3 #4 9

Miracle Soap

Tightens and softens skin at the same time. Available no where else. 2QFH\RXH[SHULHQFHLW\RXZLOO never want to live without it again.

It holds moisture in for additional skin health; and leaves you with fresh feeling skin instantly. It’s amazing...instantly. 7KHPRPHQWWKDW\RX¿QLVK washing with this, you will feel the difference.

Your skin will feel much softer and healthier.

1 lb. Test it yourself: Before you wash, rubub your face lightly to compare the beforeoree and after feel of your skin. 4 oz. M-S100 $11.90 8 oz. M-S102 $19.90 4 oz. 1 lb. M-S101 $29.90 8 oz.

Soaps included in these sets may change regularly

Enjoy the Top 12 Customer-Favorite Get all Fifteen Nubian Heritage Soaps and Soaps! Save! Get the top twelve best-selling soaps of all Each one is made with all-natural ingredients, time in this all-inclusive set. Includes the VRPHRUJDQLFFHUWL¿HGDQGHVVHQWLDORLODURPD following: Twelve best-selling soaps blends. M-S300S $75.90 M-S002 $47.90 10 Nubian Heritage Soaps

“I literally can’t keep up with the sell of these soaps, my customers are constantly purchasing them and asking for more.” ~ Caren in New York

Frankincense and Myrrh Soap Abyssinian Oil & Chia Seed Soap Condition and soothe your skin with Addresses the premature signs of this shea enriched soap. aging. 5 oz. M-S315 $5.98 5 oz. M-S307 $5.98

Peppermint Soap with Patchouli & Buriti Soap Lemongrass and Tea Tree Baking Soda M-S314 $7.58 Soap 5 oz. M-S305 $5.98 5 oz. M-S309 $5.98

Honey and Black Seed Olive Butter Avocado Soap Cocoa Butter and Soap A great way to heal stretch Chocolate Soap Moisturizes skin while marks! 5 oz. M-S304 $5.98 A tempting concoction of healing imperfections. 5 oz. chocolate, cocoa butter, and M-S306 $5.98 hazelnuts. 5 oz. M-S308 $5.98 All-Natural Cleansing and 11 Nourishment

Coconut and Papaya Soap Nourish your skin with this vitamin and mineral enriched soap. 5 oz. M-S310 $5.98 Black Soap with Shea Butter One of our best-selling soaps, this black soap All soaps on this page with oats and shea butter works to purify, H[IROLDWHDQGPRLVWXUL]H\RXUVNLQR] $5.98 each! M-S301 $5.98

Shea Butter Soap with Lavender and Mango Butter Soap :LOGÀRZHUV This mango butter soap smells so good you’ll Revel in the delicate scent, while giving your want to eat it! 5 oz. M-S303 $5.98 skin moisture and nutrition. 5 oz. M-S302 $5.98

Indian Hemp & Haitian Goats Milk and Chai Soap Carrot and Pomegranate Vetiver Soap 5 oz. M-S311 $5.98 5 oz. M-S312 $5.98 5 oz. M-S313 $5.98 12 Dead Sea Soaps

Set Of 6 Dead Sea Minerals Soap Get the six best sellers and save $8.00. M-S700 $39.90

Shea Butter & Argan Oil Lemon Sage Shea/Argan Eucalyptus Shea/Argan Soap Soap Soap 7 oz. M-S704 $7.98 7 oz. M-S707 $7.98 each 7 oz. M-S706 $7.98 each Dead Sea Salt Soap Dead Sea Mud Soap Vanilla Oatmeal Shea/ 7 oz. M-S702 $7.98 each 7 oz. M-S701 $7.98 each Argan Soap 7 oz. M-S708 $7.98 each Lavender & Argan Soap Blackberry Pear Shea/ 7 oz. M-S703 $7.98 Argan Soap 7 oz. M-S705 $7.98 each

Sunaroma Soaps

Get all four and save Set Of 4 Soaps M-S400S $29.90

Patchouli Soap Peppermint Soap Conditioning Goat’s Organic Coconut 8 oz. M-S420 $7.98 8 oz. M-S423 $7.98 Milk Soap Soap 8 oz. M-S422 $7.98 8 oz. M-S421 $7.98

Our customers love the goat’s milk soap!!!! It has a great refreshing scent not to mention the lather is awesome. I would highly recommend. ~ Frank in Wilmington, NC Sunaroma Soaps 13

BEST SELLER

Oatmeal & Vitamin E Lotion ÀR]M-P331 $7.90

Oatmeal and Vitamin E Shea Butter and Aloe Vera Moisturizes your skin with natural anti-aging properties. 4.25 oz. M-S405 $3.98 4.25 oz. M-S414 $3.98

Egyptian Musk Black Soap Honey and Almond Soap African Black Soap with 4.25 oz. M-S401 $3.98 4.25 oz. M-S404 $3.98 Cocoa Butter and Vitamin E 4.25 oz. M-S406 $3.98

Papaya Soap with Strawberry Soap with Eucalyptus Soap with Sweet Almond Oil Jojoba Butter Lemongrass 5 oz. M-S417 $5.98 5 oz. M-S416 $5.98 5 oz. M-S418 $5.98 14

8 oz.

100% Natural African Black Soap for Face, Body and Hair Made with , palm kernel oil and plantain leaves, this soap is famous for relieving the effects of acne and removing blemishes. It is also an effective hair shampoo, preventing dry, itching scalp and dandruff. Hand-made in West Africa.

8 oz. M-S492 $7.90 1 gallon M-S494 $79.90 16 oz. M-S493 $13.90 (62¢/oz.) 5 gallon M-S495 $318.00 16 oz. (50¢/oz.)

Other fragrances:

Peppermint

Egyptian Musk Pink Grapefruit

Aroma Therapy Black Soap Gel - 8 oz. Ingredients: Pure African Black Soap containing palm kernel oil, palm oil, roasted cocoa pods and plantain leaf ash, fragrance. M-P348 $7.90 each Strawberry

The ultimate discovery for clear skin

Black Soap - Natural Blemish Remover 8VHWRUHPRYHEOHPLVKHVIURP\RXUIDFH Just apply to face and skin. Ingredients: African Black Soap with tea tree essential oil and African coffee M-P376 $19.90 15

Cocoa Butter & Black Seed Soap Mango & Shea & Oatmeal Black Soap 5 oz. M-S353 $3.98 5 oz. M-S356 $3.98

Virgin Coconut & Goats Cinnamon Soap Chamomile Soap Milk Soap 3½ oz. M-S624 $2.98 3½ oz. M-S623 $2.98 5 oz. M-S354 $3.98

Moringa Herbal Soap Black Seed Herbal Soap Neem & Black Seed Herbal M-S545 $4.58 M-S544 $4.58 Soap M-S546 $4.58 16 Soaps by Madina

Shea Butter and Aloe Vera Soap Black Soap with Cocoa Butter and The clean of African black soap meets the Vitamin E rich moisture of shea butter and the healing 3.5 oz. M-S201 $3.98 power of aloe vera. 3.5 oz. M-S202 $3.98

Black Jamaican Castor Oil Argan & Mongongo Soap Activated Charcoal Soap Soap 3.5 oz. M-S227 $3.98 3.5 oz. M-S229 $3.98 3.5 oz. M-S228 $3.98

Pure African Black Soap Milk Whitening Soap Tea Tree Soap 2.8 oz. M-S221 $3.58 Naturally whitens and 3½ oz. M-S226 $3.98 $3.58 lightens with milk proteins. 3½ oz. M-S220 $5.98 17

Black Seed Soap Three in One Body Butter Papaya Soap This new soap blends the Soap ([IROLDWHVSXUL¿HVDQG anti-aging properties of Made with shea, mango, and softens skin with papaya and black seed with the healing cocoa butter. 3.5 oz. M-S206 shea butter. 3.5 oz. properties of shea butter and $3.98 M-S215 $3.98 jojoba oil. 3.5 oz. M-S213 $3.98 Nature's Spirit

Argan Oil & Shea Butter Soap Olive Butter Soap 5 oz. M-S462 $3.98 5½ oz. M-S460 $3.98

Aloe Butter Soap Avocado & Poppy Seed Soap 5½ oz. M-S459 $3.98 5½ oz. M-S458 $3.98 18 More choices From Nubian Heritage

100% ORGANIC

Nubian Heritage Raw Shea Butter Bath Kit Bath kit is made up of Nubian Heritage's raw shea butter hand cream, lotion, body wash, and soap. M-P197 $49.90

African Black Soap Lemongrass & Tea Tree Soap 5 oz. M-S301 $5.98 Soap 5 oz. M-S309 $5.98 Lotion 13 oz. M-137 $19.90 Lotion 13 oz. M-129 $19.90 Body Wash 13 oz. M-537 $15.90 Body Wash 13 oz. M-529 $15.90 Hand Cream 4 oz. M-737 $10.78 Hand Cream 4 oz. M-729 $10.78

Honey and Black Seed Olive and Green Tea with Avocado Soap 5 oz. M-S306 $5.98 Soap 5 oz. M-S304 $5.98 Lotion 13 oz. M-136 $19.90 Lotion 13 oz. M-134 $19.90 Body Wash 13 oz. M-536 $15.90 Body Wash 13 oz. M-534 $15.90 Hand Cream 4 oz. M-736 $10.78 Hand Cream 4 oz. M-734 $10.78

Mango Body Butter Goats Milk and Chai Soap 5 oz. M-S303 $5.98 Soap 5 oz. M-S311 $5.98 Lotion 13 oz. M-133 $19.90 Lotion 13 oz. M-127 $19.90 Body Wash 13 oz. M-533 $15.90 Body Wash 13 oz. M-527 $15.90 Hand Cream 4 oz. M-733 $10.78 Hand Cream 4 oz. M-727 $10.78

Indian Hemp and Haitian Vetiver Patchouli & Buriti Soap 5 oz. M-S313 $5.98 Soap 5 oz. M-S314 $7.58 Lotion 13 oz. M-126 $19.90 Lotion 13 oz. M-125 $23.90 Body Wash 13 oz. M-526 $15.90 Body Wash 13 oz. M-525 $19.90 Hand Cream 4 oz. M-726 $10.78 Hand Cream 4 oz. M-725 $13.98

Lavender and Wild Flowers Abyssinian Oil & Chia Seed Soap 5 oz. M-S302 $5.98 Soap 5 oz. M-S315 $5.98 Lotion 13 oz. M-132 $19.90 Lotion 13 oz. M-138 $19.90 Body Wash 13 oz. M-532 $15.90 Body Wash 13 oz. M-538 $15.90 Hand Cream 4 oz. M-732 $10.78 Hand Cream 4 oz. M-738 $10.78

Coconut and Papaya Raw Shea Butter Soap 5 oz. M-S310 $5.98 Soap 5 oz. M-S307 $5.98 Lotion 13 oz. M-128 $19.90 Lotion 13 oz. M-131 $19.90 Body Wash 13 oz. M-528 $15.90 Body Wash 13 oz. M-531 $15.90 Hand Cream 4 oz. M-728 $10.78 Hand Cream 4 oz. M-731 $10.78 Bath & Body Oil 8 oz. M-831 $19.90 Black Jamaican Castor Oil 19 Shampoo and Conditioner

Black Jamaican Castor Oil Shampoo Black Jamaican Castor Oil Conditioner M-P349 $7.90 M-P353 $7.90

African Bone Soap Tray: Rectangular Soap Tray Bamboo Soap Dish Assorted Designs ó´[¾”. Made from juniper [M-409 $11.90 $9.90 M-408 $9.90 each wood. M-404 $7.90

Set of 13 Lotions Each bottle is 13 oz. Only $16.76 each (in set of 13) M-139 $217.90 Set of 13 Body Washes Only $12.91 each (in set of 13) M-530 $167.90 20 Africa’s Health Secrets

Soursop Bitters Herboganic Moringa Gye Nyame: Black Seed May be used against Bitters Bitters asthma, coughs, stomach Promotes good eye health, Relieves constipation and distress, high blood increased energy levels, and poor bowel movement. SUHVVXUHVH[XDOZHDNQHVV a healthy immune system. 16 oz. M-P225 $39.90 and more. 16 oz. H-065 16 oz. H-035 $39.90 $39.90

Herboganic Black Seed Koromantee Corkscrew Moringa Bitters - 16 Oz. Bitters Bitters Fights a wide range of health &OHDQVHDQGWRWDOO\GHWR[LI\ Cleans out the stomach, conditions M-P424 $39.90 your body with black seed intestines and colonic area bitters. 16 oz. H-034 $39.90 16 oz. H-023 $39.90

Jamaican Wood & Root Ashanti Weight Loss & D'Bayor Organic Living Tonic - 16 oz. Energy Tonic 32 oz Bitters - 16 oz. Remedy for the blood, body 5LGWKHERG\RILQÀDPPDWLRQ M-P422 $39.90 and nerves. H-022 $39.90 H[FHVVIDWDQGZDWHUDQGFXUE the appetite. H-025 $59.90 Sexual 21 Performance

Strong Horse: Herbal Aphrodisiac (30 capsules) 6WURQJ+RUVHDSKURGLVLDFVXSSRUWVKHDOWK\OLELGRDQGVH[XDOIXQFWLRQ7KLVFDSVXOHDFWVWR VXSSRUWKHDOWK\EORRGÀRZWRWKHJHQLWDODUHDDQGGHOLYHUFRUUHVSRQGLQJVXSSRUWIRUDKHDOWK\ VH[GULYH6WURQJKRUVHDOVRGHOLYHUVDVXVWDLQHGDQGPDVVLYHHQHUJ\UXVKWDEOHWV M-560 $39.90

Gourmet African Bird Pepper From Northern West Africa,African Bird Pepper Ghanaian Woman Back African Manback Tonic has been successfully Tonic Traditionally used for all used to help treat arthritis, Made from a combination of weaknesses in the male psoriasis, cluster headaches, roots and barks from Ghana reproductive system, spine and pain as well as lower :HVW$IULFD8VHGE\ZRPDQ back and nerves. 16 oz. the rate of cardiovascular in Ghana as a General Tonic H-024 $47.90 disease. Contains carotene and harmonize for the female molecules that have potent biological make up. 100% DQWLR[LGDQWHOHPHQWVR] natural. 16 oz. H-064 $47.90 M-P276 $5.90 22 Healing and Cleansing

Black Seed Honey Booster Pure Black Seed Capsules 100% Noni Capsules Made from a powerful blend 0DQ\DQWLR[LGDQWSURSHUWLHV Cleanses the body of of manuka honey, royal jelly, which help keep your skin harmful bacteria and black seed oil, and other youthful and clear. 90 increases cell function. 50 all-natural herbs. 16 oz. capsules. M-558 $27.90 capsules. 517 mg. M-550 $27.90 M-559 $27.90

Healing Noni Juice

32 oz. 16 oz. Bottle Bottle

100% Noni Goji Find All-Over Healing with 100% Juice Pure Noni *HWDOOWKHEHQH¿WV Grown in the lush, tropical jungles of of noni juice with the Hawaii, Noni juice has been used for White Ceremonial Sage added nutrients of centuries for its far-reaching health 8VHIUDJUDQWVDJHOHDYHVWR Goji berries. 32 oz. EHQH¿WV purify the air in your , M-544 $47.90 16 oz. M-541 $35.90 ward off illness, headaches, 32 oz. M-542 $47.90 IHYHUDQGWR[LQVR]%DJ M-P146 $19.90 Life Giving Teas 23

Asian Lemongrass Have a Cup of Medicinal Tea Africa’s Steaming Lemongrass has been recommended by HotHot HealingHealing TeaTea practitioners for many different ailments. 20 Bags M-492 $7.90 20 bags 100 bags 100 Bags M-493 $23.90 Exotic Mango Nutritional Tea Mango is considered to be the “King of fruits” due to its delicious taste and nutritional value. 20 Bags M-494 $7.90 20 bags 20 bags 100 bags 100 Bags M-495 $23.90 Chinese Antioxidant Green Tea 100 bags One of the fastest growing teas in African Red Bush Rooibos popularity today is Tea for Skin and Senses green tea. 5RRLERVKDVQDWXUDODQWLR[L- 20 Bags M-490 $7.90 dants that help delay the 100 Bags M-491 $23.90 aging process, and drinking 20 bags 100 bags a cup of rooibos before bed Healthy Teas can ensure a restful sleep, Sampler Set and cure headaches. It 18 Bags. 6 different contains no caffeine. teas. M-500 $15.90 Pack of 20 bags. M-480 $7.90

100 bags for the most savings! M-487 $23.90 Cleansing Tea Hibiscus Tea

20 bags 100 bags Cleanse Your Body With African Hibiscus Healing Healing From Nature Tea This tea combines a Hibiscus, native to Africa, combination of 12 specially is highly cherished for its selected herbs to assist the refreshing, healing, and ERG\LQWKHGHWR[L¿FDWLRQ DQWLR[LGDQWTXDOLWLHV process. 30 Tea Bags. 20 Bags M-488 $7.90 Cleansing Black Seed 100 Bags M-489 $23.90 Herbal Tea M-485 $23.90 24 Deodorants

Honey & Black Seed African Black Soap Coconut & Papaya Indian Hemp & Natural Deodorant Deodorant Deodorant Haitian Vetiver M-P136 $19.90 M-P359 $19.90 M-P360 $19.90 Deodorant M-P361 $19.90

Herbal Tea Tree African Natural Aloe Herbal Herbal Deodorant Deodorant Deodorant Mist Deodorant 1.75 oz M-P165 0DGHLQ86$ 8 oz. M-P184 $7.90 2.65 oz. M-P185 $9.90 $7.90 each M-P255 $15.90

Save with a set

Set Of 12 Deodorants Set may vary from the photograph. M-P393S $109.90 $99.00 ($8.25 each)

Crystal Stone Deodorant: For Women Coconut & Papaya Deodorant M-P382 $11.90 $9.90 M-P384 $11.90 $9.90 Neem Deodorant Pure & Natural Crystal Mist M-P389 $11.90 $9.90 M-P383 $11.90 $9.90 Crystal Stone Deodorant: For Men Peppermint Deodorant M-P381 $11.90 $9.90 M-P391 $11.90 $9.90 Patchouli & Indian Hemp Deodorant Frank & Myrrh Deodorant M-P390 $11.90 $9.90 M-P386 $11.90 $9.90 Moringa Deodorant Tea Tree & Lemongrass Deodorant M-P388 $11.90 $9.90 M-P392 $11.90 $9.90 Jamaican Black Castor Oil Deodorant Egyptian Musk Deodorant M-P387 $11.90 $9.90 M-P385 $11.90 $9.90 Show Your Best Smile 25 With Natural Dental Solutions from Africa

Neem Advance Toothpaste Neem Essential Toothpaste Neem leaf, a natural antibacterial has been 6.5 oz. Fluoride free. M-P354 $4.58 each combined with herbs to give you complete natural oral hygiene. Has a fresh mint taste. 6.42 oz. Fluoride free. M-P129 $3.90

Natural Tea Tree Whitening Toothpaste Herbal Essential Toothpaste M-P267 $7.90 M-P375 $4.58 Natural Tea Tree Mouthwash This alcohol-free mouthwash with Tea tree oil will leave your mouth totally clean and KHDOWK\ZKLOH¿JKWLQJDZD\ gum disease and plaque buildup. 12 oz. M-P269 $11.90

Neem Licorice Toothpaste M-P261 $13.90 $11.90

*HWDVDPSOHEDJZLWKWZRRIHDFKưDYRU 12 sticks total. M-171 $11.98 African Chew Sticks For that White Smile You’ve Always Wanted. Ayurvedic Neem Mouthwash - 16 Oz. Flavors are: Cherry, Grape, Peppermint, Straw- M-P403 $23.90 EHUU\9DQLOODDQG8QÀDYRUHGM-170 $23.90 *HWWKHVHWRIVL[EDJVRIFKHZVWLFNV M-170A $119.90 ($19.98 per bag). 26 Hair Growth Black Jamaican Castor Oil

Black Jamaican Castor Oil 4 oz. M-P221 $19.90 16 oz. M-P221LB $49.90

For generations, Jamaicans have been using castor oil for medicinal purposes, as well as skin care, hair care and Premium Blend Black Economy Grade Black everyday aches and pains. Jamaican Castor Oil Castor Oil Today, Jamaican Black castor Includes garlic and onion oils. 4 oz. M-P379 $11.90 Oil is used primarily for hair M-P277 $23.90 growth.

Original Argan Tea Tree Oil Jamaican Black Soothing essential Intense repair for Relieve troublesome Castor Oil: Coconut oils. 4 oz. damaged hair! 4 oz. hair. 4 oz. M-P297 4 oz. M-P332 $15.90 M-P293 $15.90 M-P296 $19.90 $11.90 $15.90 $11.90 27

Black Castor Oil Jamaican Black Shampoo Castor Conditioner Naturally healing Nourishes and shampoo. revitalizes hair while 8 oz. M-P298 $15.90 stopping breakage. 8 oz. M-P302 $15.90

Ultimate Hair Grow Ginkgo Jojoba Butter For Thinning Hair This shea butter enriched treatment Increases hair growth, softens hair, while strengthens roots, promotes hair growth, reducing itchiness and irritation. 4 oz. conditions and restores. Enriched with M-P130 $23.90 avocado oil. 4 oz. M-P122 $7.90

Africa’s Instant Fix 8.5 oz. Made in the 86.RVKHU Herbal Hair Growth Glycerin M-411 $9.90 Accelerator 100% Herbal and 100% Natural. 1 oz. M-P258 $23.90 28 Healthy hair

Coconut & Moroccan Argan Black Seed & Aloe Vera M-P243 $7.90 M-P241 $7.90 Black Castor & Tea Tree M-P242 $7.90

Indian Hemp & Rosemary Jojoba Oil & Jasmine Olive Oil & Lavender M-P244 $7.90 M-P245 $7.90 M-P246 $7.90

Indian Hemp Hair Pomade Herbal Hair Tonic African Shea Butter M-P180 $7.90 Made with all-natural ingre- Shampoo/Conditioner dients that nourish the scalp Gently cleans without and stimulate hair growth stripping and can be used while reducing hair loss. everyday. M-P233 $7.90 M-P106 $9.90 29

Superior Locking Gel For centuries, the Maasai have used natural ingre- GLHQWVWRORFNWKHLUKDLU8VHWKHVHVDPHQDWXUDO ingredients to maintain your locks naturally. 8 oz. M-P147 $9.90

Shampoo & Conditioner in One! This natural shampoo and conditioner is enhanced with coconut oil, avocado Healthy Hair Pomade oil and aloe to nourish the scalp, Made with natural herbs, oils, and vitamins that stimulate hair growth, and reduce hair nourish your hair to a healthy and natural shine. loss. 8 oz. M-P121 $7.90 Enriched with coconut oil and shea oil. 3.5 oz. M-P148 $9.90

Organic Coconut Oil Hair Pomade - 5.5 oz Organic Indian Hemp Hair Pomade - 5.5 oz Restore and Protect Dry, Damaged Hair..... Repair and Grow Dry, Broken, Frizzy Hair. Naturally! M-P394 $11.90 M-P395 $11.90 30 Longer hair Authentic Chebe products from Chad in central Africa

Bowl not included

Chebe Paste Chebe Powder - 50 Grams Chebe Butter 4 oz. M-P411 $23.90 M-P409 $23.90 4 oz. M-P414 $29.90

Chebe Coconut Oil 4 oz. M-P415 $19.90

Chebe Oil Chebe Jamaican Chebe Olive Oil 4 oz. M-P410 $27.90 Black Castor Oil 4 oz. M-P416 $19.90 4 oz. M-P417 $19.90

How to

Chebe (pronounced shea bay) save the most powder is a traditional hair growth The 3 most popular Chebe products remedy from Chad, Africa. It has been used for generations to for only $59.90 increase hair growth and prevent breakage. Includes: Chebe Collection • Chebe Powder M-P412S $59.90 • Chebe Paste • Chebe Oil 31

Black Soap Pure African Black Soap 6 oz. M-P937 $3.98 Black Soap Gel - 8 oz. M-P941 $7.90 M-P937 Liquid Black Soap 8 oz. M-P942 $7.90

Set Of 6 Afrikan Republic Shea Butters: *HWDVHWRIVL[VFHQWVRIVKHDEXWWHUR] M-P948 $19.90 1 oz. Scented Shea M-P929 Vanilla Butter $3.90 each M-P930 Black Black Jamaican Black Jamaican M-P910 Lavender Cherry Castor Conditioner Castor Shampoo - Vanilla M-P933 Coconut -16 oz 16 oz. M-P911 Patchouli M-P951 8QVFHQWHG M-P950 $15.90 M-P949 $15.90 M-P912 Lavender M-P913 Vanilla Ylang Ylang Golden Creamy Shea Butter Whipped Shea Butter: Shea Butter & Silk Lotion 13 oz. M-P917 $15.90 Unscented 8 oz. M-P925 $15.90 $11.90 7 oz. M-P918 $9.90 4 oz. M-P931 $19.90 $15.90 &DOHQGXOD 6XQÀRZHU 25 oz. M-P923 $27.90 Whipped Shea Butter: Cream Virgin White Shea Butter: Frank&Myrrh 4 oz. M-P936 $9.90 $7.90 Unscented 4 oz. M-P932 $19.90 $15.90 Black Love Butter 8 oz. M-P905 $15.90 4 oz. M-P183 $13.90 $11.90 Virgin White Shea Butter: Dead Sea Mud Vanilla 8 oz. M-P927 $15.90 8 oz. M-P907 $19.90 $15.90 Green Tea and Tea Tree Face Cream M-P181 $15.90

Acne Abolisher Whipped Shea Black Seed Cream 4 oz. DD-100 $39.90 Butter Miraculous mineral Coffee Butter Cream 3 oz. DD-106 $23.90 content for ultimate 2.5 oz. DD-102 $15.90 $9.90 skin health. 4 oz. DD-112 $11.90 $9.90 Desired Diva: IBC! Healthful Hair Face And Body Conditioner Jojoba Cream Cream 16 oz DD-108 $15.90 Anti-aging. 4 oz. DD-113 $11.90 $5.90 5 oz. DD-103 $15.90 Argan Oil Cream I’ve Been Carded! Skin softener. 4 oz. Black Jamaican Black Soap Facial DD-111 $11.90 $9.90 Castor Oil Eyelash Treatment Treatment 1.7 oz. DD-104 $15.90 DD-119 $5.90 32 Genuine African Formula

DermaClaire Natural Fade Cream - 2 oz. M-P358 $17.90

SuperGrow Hair Gel: Extra SuperGrow Hair Gel: Elephant Balm Analgesic Hold Regular Hold Ointment 4 oz. M-P309 $11.90 4 oz. M-P356 $11.90 2 oz. H-036 $11.90

Hair Thickening Let-It-Grow Therapeutic Nine Herbs Shampoo Conditioning Massage Oil Detoxifying 8 oz. Shampoo ÀR] Bath Formula M-P336 $15.90 8 oz. M-P308 $11.90 M-P330 $19.90 ÀR]M-P312 $11.90 Egyptian Black seed therapy 33

Black Seed Cream This all-natural cream made with essential black VHHGRLOOHDYHV\RXUVNLQWRQHG¿UPDQGVPRRWK M-269 $6.98

Black Seed Lotion This lotion is bursting with goodness RIQDWXUDOH[WUDFWVWKDWKHOSOHDYHWKH VNLQOLJKWHU¿UPHUDQGVPRRWKHU 8.45 oz. (250 mL) M-P223 $7.90

Black Seed Beauty Collection Kit includes: • Black Seed Soap • Black Seed Oil • Black Seed Cream M-P264 $17.90

100% Pure Black Seed Oil Discover the 2000-year-old skin care secret of black seed oil. ,PPHQVHO\SRSXODUWKURXJKRXWWKHZRUOGIRULWVVNLQFDUHEHQH¿WV Black seed oil contains a high vitamin, mineral and essential fatty acid content, which make it an amazing skin treat. The pharaoh Tutankamun even had a bottle of the oil in his tomb! Black seed is OLVWHGDVRQHRIWKHPRVWHIIHFWLYHDQWLELRWLFVDQWLLQÀDPPDWRU\DQWL bacterial, and immune boosting agents around. 1 oz. M-266 $9.90 4 oz. M-267 $23.90 1 lb. M-268 $69.90 $59.90 34 Vitamin E Oil Find out how to make your skin smooth and supple with vitamin (RLO9LWDPLQ(RLOLVIXOORIDQWLR[LGDQWVDQGQDWXUDOPRLVWXUL]HUV to heal and protect your skin! Vitamin E is famous for healing the HIIHFWVRISVRULDVLVVFDUULQJVWUHWFKPDUNVDQG¿QHOLQHVDQG wrinkles. Vitamin E oil also can protect your skin, hair, and nails from harsh environmental factors like wind, pollution, and intense sunlight. Not intended for use as a sunscreen. Ingredients: 7RFRSKHU\O$FHWDWH 9LWDPLQ( 2LO0DGHLQ86$

1 oz. M-320 $15.90 $13.90 4 oz. M-321 $47.90 $27.90 16 oz. M-322 $119.90 $75.90

4 oz. 16 oz. 1 oz. Healing Oil Wellness Set

Jojoba Oil 4 oz. M-230 $29.90 1 lb. M-231 $75.90 1 gallon M-232 $399.90 Set includes: • 4 oz. Black Seed • 4 oz. Shea Nut Oil Oil • 4 oz. Jamaican • 4 oz. Vitamin E Oil Black Castor Oil Healing Oils Wellness Set NEW Reduce signs of aging, soften your skin, and enjoy clear, radiant skin. Save over 15% on each oil when you purchase this set. X-027 $55.90 4 oz. 16 oz.

Tea Tree Oil Macadamia Nut Oil Tea tree is a highly Nourish your skin with effective antifungal/ rapidly-healing macadamia antibacterial skin nut oil. This oil tones aged smoother, derived or dry skin, softening and from the native tree healing wounds, scarring, 'Meleleuca alternifolia' lines, and stretch marks. in Australia.

4 oz. M-P111 $7.90 $6.98 4 oz. M-263 $39.90 16 oz. M-P112 $23.90 $17.90 16 oz. M-263LB $99.90

4 oz. 16 oz.4 oz. 16 oz. 35 Skin and Hair Revitalizing Argan Oil

Beautifying Moroccan Argan Oil Rejuvenate your hair and skin with this rare Moroccan oil. This oil regenerates and renews skin cells making your skin softer and more supple, more toned, and more resistant to pollution. The vitamin E in argan oil makes it effective for relieving muscle aches and joint pains. For Your Hair: Argan oil repairs, hydrates, moisturizes and adds shine to your hair. It is non-greasy and instantly conditions while eliminating frizz. 4 oz. M-P166 $31.90 $29.90 1 lb. M-P166LB $79.90 $75.90

4 oz. 16 oz.

Healing, Soothing Virgin Hemp Seed oil Emu Oil 4 oz. M-P347 $7.90 4 oz. M-P163 $59.90 16 oz. M-P347LB $49.90 $19.90 1 lb. M-P164 $159.90 $139.90

4 oz. 16 oz.4 oz. 16 oz.

Organic Virgin Baobab Sweet Almond Oil Seed Oil 4 oz. M-P108 $7.90 1 oz. M-356 $19.90 $13.90 1 lb. M-P109 $23.90 4 oz. M-357 $55.90 $39.90 $19.90

4 oz. 1 oz. 4 oz. 16 oz. 36

Wrinkle Reducing Stretch Mark and 6NLQ5HSDUDWLYH Soothing Mango Butter Scar Healing 2OLYH%XWWHU and Softening Cocoa Butter $YRFDGR%XWWHU

Perfectly Pure Mango Butter Olive Butter From South Africa. From South Africa 4 oz. jar M-240 $11.90 4 oz. M-238 $9.90 1 lb. (16 oz.) M-241 $29.90 1 lb. (16 oz.) M-239 $25.90 The Raw butter! Cocoa Butter Avocado Butter From Ghana From Zanzibar. 4 oz. M-245 $11.90 4 oz. M-350 $11.90 1 lb. (16 oz.)M-246 $29.90 1 lb. (16 oz.) M-351 $29.90

Stress-Relieving Immunity Enhancing Moisturizing Chamomile Beta-Carotene Shea Butter Butter Butter Cream

Chamomile Butter Beta-Carotene Butter Amonche Shea Butter Calms the mind and eases Helps prevent skin disorders, Cream IHDUDQ[LHW\DQJHUZRUULHV enhance immunity, protects Moisturize your skin with and tension during times of DJDLQVWWR[LQVFROGVÀXDQG shea butter, pure honey, aloe stress. LQIHFWLRQV,WLVDQDQWLR[LGDQW vera, lime juice, and lemon 4 oz. M-P159 $9.90 $7.90 and protector of the cells juice. These ingredients are 1 lb. (16 oz.) while slowing the aging known to help relieve skin M-P160 $25.90 $21.90 process and moisturizing and problems such as eczema, softening skin. DFQH¿QHOLQHZULQNOHV 4 oz. M-P153 $9.90 $7.90 stretch marks, and more. 1 lb. (16 oz.) 4 oz. jar. M-P174 $5.90 M-P154 $25.90 $21.90 37

Karanja Oil Olive Hair & Body Oil Can be used to treat Nourish and soften your eczema, psoriasis, skin skin and hair with this ulcers, dandruff, or to 100% virgin olive oil promote wound healing. hair and body condi- 4 oz. M-P217 $11.90 tioner. 4 oz. M-P350 $4.98

Avocado Oil Marula Oil Avocado Oil is a 0DUXODRLOLVH[WUDFWHG versatile oil with from the kernels (nuts) of QXPHURXVEHQH¿WVIURP the Marula tree (Sclero- culinary to cosmetics. carya birrea). Made It is a protein-rich in South Africa. 4 oz. moisturizer that is high M-P187 $49.90 $35.90 in Vitamins A, D, and E, plus potassium and other minerals. 4 oz. M-P259 $5.90

Babassu Oil Maracuja Passion Helps with problems Flower Oil caused by eczema, Passion Flower oil gently makes hair and skin soothes and calms shiny, and soothing stressed skin and is high irritated and sensitive in healing essential fatty skin. acids. 4 oz. M-P299 $9.90 1 oz. M-P114 $11.90 16 oz. M-P299LB 4 oz. M-P115 $33.90 $27.90

4 oz.16 oz. 4 oz. 1 oz. 38 Healing Salts

For The Clearest Skin Now Dead Sea Salts People used to travel across the world to bathe in the healing waters of the Dead 6HD(QULFKHGZLWKEHQH¿FLDOPLQHUDOVDQG vitamins to give you fresh, radiant skin. Famous for its effectiveness in healing acne, eczema, psoriasis, arthritis and muscular pain.

1 lb. M-165 $9.90 10 lb. Bag M-166 $58.00 ($5.80 per lb.)

1 lb. 10 lb. More Dead Sea Healers Less than $4.98 each. $19.90 for set of four! Egyptian Musk Ocean Mist

Tranquility /DYHQGHU)LHOGV

Taking Bathing to a Whole reduce scarring, aging, and stretch New Level marks. Choose your favorite Sink into a nice hot, fragrance! Get the Set of Four therapeutic bath with these Scented Dead Sea Salts and Save! dead sea scented bath salts. Scented with M-153S $19.90 (Only $4.98 each!) essential oils that are made to soothe, revive, and relieve stress. The minerals in Scented Salts also available separately. these salts work to soothe muscle aches and M-153 $7.90 each pains, soften skin, improve tone of skin and

4 oz. 1 lb.

Face Rebeautifying Dead Sea Clay Cold & Flu Vitamin Bath Soak For the ultimate mud mask. The Dead Sea Boost your immune system with the healing has high levels of magnesium, potassium, SRZHURIQDWXUHYLWDPLQVDQGKHUEDOH[WUDFWV sulfate and calcium; works miracles for your 100% natural. skin. 1 lb. (16 oz.). M-P119 $13.90 4 oz. M-P266 $9.90 $7.90 1 lb. M-P266LB $27.90 $19.90 39 Healing Clay Pink Himalayan Bath Salts

Fine Grain M-P133

M-P107 The Purest Bath Crystals for the Purest Cleansing Himalayan salt contains 84 minerals that balance and Aztec Secret Indian Healing GHWR[LI\WKHERG\7KH\DUHPXFKKHDOWKLHUWKDQUHJXODU Clay - 1 Lb salt, as they are more mineral rich and cleansing. When World's most powerful facial. you bathe in the salts these minerals are absorbed Deep pore cleaning with 100% through the skin and can help to improve immunity, natural calcium bentonite clay. reduce stress, improve heart health, relieve headaches Does not contain: Additives, and depression. fragrances, animal products. Ingredients 100% Natural One Pound Coarse Grain Calcium Bentonite (Green) Clay Himalayan Rock Salts • Sun Dried M-P107 $13.90 • No Additives One Pound Fine Grain • No Fragrances Himalayan Rock Salts M-P406 $15.90 M-P133 $13.90

Moroccan Body Mud

M-P107 close up

4 oz.

Morocco’s Best Kept Secret ([SHULHQFHGUDPDWLFVNLQ improvement with Moroccan Mud. This rare mineral clay moisturizes skin while drawing out impurities for an instant skin makeover. It tightens skin, helping to reduce cellulite and Bamboo Charcoal sagging skin. Shades of mud Black Mask vary. Moroccan Mud M-P418 $15.90 4 oz. M-360 $13.90 1 lb. M-361 $33.90 40 Natural Anti-Aging Answers

Sore Muscle Freeze

1 lb. Age-Reversing Mango Face Cream This super moisturizing face cream contains properties of Hyaluronic Acid (HA). M-380 $15.90 $11.90

1 Gal. 1 lb.

Natural Body Butter- Rejuvenate and nourish your skin without feeling greasy. Add fragrances, butters, or Fade Out Cream colors to this base to make it as personal as This fade-out cream is made with all-natural you want it to be ingredients to make dark spots, liver spots, or 1 Pound M-148 $23.90 age spots disappear quickly and easily. 1.05 1 Gallon M-149 $139.90 ÀR] M-P102 $6.98 41 &RƬHH(\H%XWWHU

Coffee Eye Butter )LJKWDZD\SXI¿QHVVDQGGDUNFLUFOHVZLWK this healing coffee eye butter. 1 oz. M-P260 $19.90

Coffee Butter *HWDFRIIHH¿[DOORYHU\RXUERG\ZLWK natural coffee butter. This butter smells like a mocha latte and feels even better on your skin! 4 oz. M-365 $17.90 1 lb. M-366 $49.90

4 oz. 1 lb.

16 oz.

1 gal. Grape Seed Oil Improve Your Skin and Hair with Grape Shea Butter and Aloe Vera Lotion seed Oil! Enriched with aloe for healing and skin Made in South Africa. perfection. 12 oz. M-163 $9.90 $7.90 1 lb. (16 oz.) O-510 $17.90 1 gallon O-510G $99.90 42 Soothing Aloe Vera

Aloe Vera Natural Oil 4 oz. M-235 $7.90 1 lb. M-236 $19.90 Organic Aloe Butter Quickly heal dry skin, irritation and eczema with aloe butter and gel. Bursting with over 75 nutrients, 20 minerals, and 12 vitamins for a skin treat you’ll never 1 lb. forget. 4 oz. M-233 $13.90 4 oz. 1 lb. M-234 $35.90

Purifying Neem Oil

4 oz. M-316 $9.90 1 lb. M-317 $27.90

4 oz. 1 lb. Neem Butter Neem butter is a wonder butter. 4 oz. M-P218 $7.90 $5.90 Healing and Beautifying Just use a little neem oil in your lotion or on your skin to heal any skin ailments you may have. Made in India.

Neem Healing Kit Kit includes: • Neem Butter • Neem Advance Soap • Neem Oil M-P265 $19.90

100% Virgin Coconut Oil 43 For Healthier Skin and a Healthier Body

4 oz. 1 lb. 100% Organic Virgin Coconut Oil 4 oz. jar. M-220 $15.90 1 lb. (16 oz.) M-221 $39.90

4 oz. 1 lb. Organic Extra Virgin Skin-Softening Coconut Organic Coconut Oil RBD Coconut Oil Moisturizing Oil 4 oz. M-P307 $5.90 54 oz. M-224 $59.90 9 oz. M-223 $11.90 1 lb. M-P307LB $15.90 Raw Coconut Oil and Shea Butter

([SHULHQFHVNLQDQGERG\SHUIHFWLRQ Say hello to soft, luminous skin, and complete body health with raw coconut oil and shea butter. 7KLVVRIWFUHDP\RLOPRLVWXUL]HVVNLQZKLOH¿JKWLQJ away wrinkles, blemishes, and chronic eczema. You can also substitute your regular cooking oils with coconut oil for an increased energy level, a natural resistance against viruses, and weight loss. Imported from Philippines. 16 oz. M-P405 16 oz • Remove the dandruff from your hair • Prevents hair loss, help to grow them again • Works great as a face cream • A perfect moisturizer for your body

Raw Coconut Oil and Shea Butter - 16 oz. M-P405 $11.90 Raw Coconut Oil and Shea Butter - 8 oz. M-P404 $7.90 8 oz Healing Butters 44 Sampler Kit Set Includes: • 4 oz. Shea Butter • 4 oz. Cocoa Butter • 4 oz. Mango Butter • 4 oz. Aloe Butter • 4 oz. Olive Butter • 4 oz. Shealoe Butter

Natural Butters Sampler Kit Soften, soothe and enjoy Africa’s greatest skin treatments with this body butter set. Includes the very best selling body butters we have, plus you save on each butter when you get this set! X-026 $59.90 $49.90

Scar Minimizing Powerful Healing SheaMango Butter Shealoe Butter

Healing SheaMango Butter The Healing Power of Shea and Aloe *HWWKHSRZHUIXOEHQH¿WVRIVKHDEXWWHUDQG /RRNLQJIRUWKHFUHDPLHVWIRUPRIOX[XU\" mango butter in one natural blend. Made Try Shealoe butter! This butter is 100% pure with 40% shea butter, 40% mango butter, shea butter and pure aloe butter. The perfect and 20% virgin coconut oil to thoroughly FRPERRI$IULFD¶V¿QHVWSRZHUKHDOHUV moisturize your skin, hair or nails. Shealoe Butter 4 oz. M-372 $9.90 4 oz. M-370 $9.90 16 oz. M-373 $27.90 $25.90 1 lb. M-371 $29.90 $25.80 45 Shea Nut Oil “The Shea nut oil is wonderful, just like For Intensely Soft Skin and Hair your ad says it helps clear up acne-prone skin. People think I have had clear skin all my life!” $39.90 ~ Sara from Richmond, IN A #1 Favorite $15.90 Say goodbye to dull, dry skin with shea nut RLO([WUDFWHGGLUHFWO\IURPWKHQXWVRIWKH shea tree, this oil quickly clears better, it can be used as a deep cleaning conditioner, hot oil treatment, and as a cooking oil. From Mali. 4 oz. M-225 $15.90 1 lb. M-226 $39.90

Shea Healing Secrets

Lip Balms

Shea Butter Face and Body Cream Enriched with vitamin E, this cream will moisturize while healing crow’s feet and stretch marks. 4 oz. M-342 $4.78

Shea Butter Lip Balm 0.15 oz. M-199 $1.98 each or $19.80 per dozen!

Three in One Butter Cream Cocoa Butter Lip Balm 7KLVOX[XULRXVO\ULFKQRXULVKLQJERG\FUHDPLQVWDQWO\ 0.15 oz. M-249 $1.98 each or softens, hydrates, and makes your skin healthy and $19.80 per dozen! vibrant. Cocoa, Shea, and Mango butter reduce signs of aging and smooth and heal dry skin. M-341 $4.78 46 The Best Selling electric oil burners!

Red

Blue Blue Purple

Clear Pink $13.90 each! Pink

Black Brown Green Orange Adjust the light with a dial on the cord. Get the Fragrance Without the Candle! Bring the mystique to your home, with clean and convenient electric light. You can adjust WKHOLJKWLQJIRUDKLQWRIDJORZRUEULJKWOLJKW&KRRVHIURPVL[FRORUV´WDOO0DGHLQ&KLQD Electric Oil Burner O-145 $13.90

Red Clear Green Purple Electric Curved Glass Oil Burner Electric Touch Lamp Oil Burner Choose from brilliant shades of black, red or 6.5” tall. Made in China. O-171 $27.90 clear. 5” tall. Made in China. O-173 $15.90

Orange Black

Blue Yellow Red Black Red

Electric Oil Burner Night Lamp Electric Night Light Oil Burners 5” tall. Made in China. O-142 $11.90 Get a soothing glow with this electric night $OVRDYDLODEOHLQ:KLWH light oil burner. 5”. Made in China. O-143 $19.90 each 47

Only $3.90 for a complete set &RPSOHWH3DFNDJH(YHU\WKLQJ

Electric Touch Lamp Oil Burner: Rose Electric City Lights Oil Burner 5” tall. O-140 $25.90 8” tall. Made in China. O-172 $35.90 $29.90

Replacement Glass Dish for Oil Burners O-101 $4.00 each Replacement Glass Dish for Night Light Oil Burners O-104 $4.00 each Set of Three Light Bulbs O-102 $9.98 Set of Ten Tea Light Candles for Burners O-100 $2.98 Egyptian Glass Bottles 4”-5” tall. Made in Egypt. O-120 $5.90 each 48 Over 850 Oils! Find Your Favorite ƄR]_R]_R]_R]_OE A Baby Powder: Clear ...... O-B83 A*Men: Pure Tonka (M) Type . . . O-A75 Barack Obama (M) ...... O-B47 Abercrombie & Fitch: Fierce (M) Type O-A57 Barack Obama: Renegade (M) NEW . O-B49 Abercrombie & Fitch: Northeast (M) O-A65 Bath & Bodyworks: Beautiful Day (W) O-B44 Addict (W) Type ...... O-A26 Bath & Bodyworks: Forever Midnight . O-B00 African Gold ...... O-A32 Bath & Body Works: Hello Sugar (W) O-B74 African Musk : Clear (M) ...... O-A42 Bath & Bodyworks: Magic In The Air O-B01 African Musk Green (M) ...... O-A10 Bath & Bodyworks: Sexy Dahlia Rush O-B94 Al-Rehab: Golden Sand (M) Type . . O-A72 Bath & Body Works: Velvet Sugar . . O-B04 Al Rehab: Makkah Musk (M) Type . . O-A77 Bath & Body Works: White Citrus (M) O-B84 Allure: Sport Extreme (M) Type . . . O-A60 Bath & Body Works: White Citrus (W) O-B90 Ambar ...... O-A12 Bath & BodyWorks: Winter Candy Apple O-B26 Ambar White Type ...... O-A25 Beautiful (W) Type ...... O-B11 Amber Romance (W) Victoria Secret . O-A40 Be Delicious (W) Type ...... O-B29 Angel (M) Type ...... O-A30 Bentley: Azure (M) Type ...... O-B25 Angel (W) Thierry Mugler Type . . . O-A13 Bentley Intense (M) Type . . . . . O-B97 Angel: Muse (W) Type ...... O-A73 Beyonce (W) Type ...... O-B55 Antonia Flowers (W) Type . . . . . O-A78 Beyonce: Heat Kissed (W) Type . . O-B41 Anucci (M) Type ...... O-A46 Beyonce: Heat Rush (W) Type . . . O-B61 Apple Fantasy ...... O-A17 Beyonce: Heat Seduction (W) Type . O-B92 Aquolina: Sweet Me (W) Type . . . . O-A81 Beyonce: Midnight Heat (W) Type . . O-B75 Aramis: Black (M) Type ...... O-A66 Beyonce: Pulse (W) Type ...... O-B65 Ariana Grande: Ari (W) Type NEW . . O-A82 Beyonce: Rise (W) Type ...... O-B91 Ariana Grande: Sweet Like Candy (W) O-A80 Beyonce: Shimmering Heat (W) Type O-B08 Armani: Acqua di Gio (M) Type . . . O-A18 Beyonce Ultimate Elixir (W) Type . . O-B58 Armani: Acqua Di Gioia (W) Type . . O-A64 Beyonce Wild Orchid (W) Type . . . O-B18 Armani: Black Carat Diamonds (M) . O-A38 Black (M) Kenneth Cole Type . . . . O-B30 Armani: Black Carat Diamonds (W) . O-A39 Black (W) Kenneth Cole Type . . . . O-B28 Armani: Blue (M) Type ...... O-A61 Black Butter ...... O-B69 Armani Code: Summer (W) Type . . O-A50 Black Butter (Clear) ...... O-B02 Armani Code: Ultimate (M) Type . . . O-A56 Black Cherry * ...... O-B24 Armani: Sun Di Gioia (W) Type . . . O-A68 Black Coconut ...... O-B15 Aromatics Elixir (W) Clinique Type . . O-A34 Black Code (M) Type ...... O-B34 Ashanti Precious Jewels (W) Type . . O-A35 Black Ice (M) Type ...... O-B14 Atelier: Grand Neroli (M) Type . . . O-A74 Black Is Black (M) Type ...... O-B88 Auric: Egyptian Goddess (W) NEW . O-A83 Black Love (W) ...... O-B13 Azzaro: Chrome Legend (M) Type . . O-A58 Black Man (M) ...... O-B39 Azzaro: Chrome Pure (M) Type . . . O-A79 Black Musk ...... O-B80 Azzaro: Wanted (M) Type . . . . .O-A76 Black Orchid (W) Type ** ...... O-B99 B Black Soul (M) Type ...... O-B59 Baby Phat Dare Me (W) Type . . . . O-B57 Black Sugar (W) Type ...... O-B98 Baby Phat Goddess (W) Type . . . . O-B20 Black Woman ...... O-B51 Baby Powder: Classic ...... O-B10 Black Woman: Unique (W) . . . . . O-B73 Many of these fragrances are all based on "types" or commercially known fragrances. * ѿR]_R] _R]_R]_OE ** ѿR]_R] _R]_R]_OE 49 *** ѿR]_R]_R]_R]_OE **** ѿR]_R]_R]_R]_OE Bleu De (M) Type ...... O-B79 Chanel: Boy (U) Type ...... O-C49 Blue Nile ** ...... O-B12 Chanel: Chance Eau Tendre (W) Type O-C60 Blue Seduction (M) Type ...... O-B48 Chanel: Chance Eau Vive (W) Type . O-C04 Bobbi Brown: Bath #IV (W) Type . . O-B70 Chanel: Mademoiselle (W) . . O-C97 Bombshell Diamonds (W) V.Secret . O-B77 Chanel: Intense (W) Bond No.9 (W) Type ** ...... O-B81 Type NEW ...... O-C103 Bond No.9 Little Italy (U) Type . . . O-B09 Chanel: Coco Noir (W) Type . . . . O-C69 Bond No.9: New Haarlem (M) Type . O-B93 Chanel: Gabrielle (W) Type . . . . . O-C68 Bond No.9: New York Musk (W) Type O-B89 Chanel N° 5 (W) Type ...... O-C18 Bora Bora (M) Type ...... O-B33 Chanel N°5 L’eau (W) Type . . . . . O-C86 Boss by Hugo Boss (M) Type . . . . O-B35 Chanel N° 19 (W) Type ...... O-C58 Boucheron: Jaipur Saphir (W) Type . O-B95 Chanel: Vive (W) Type ...... O-C25 Brown Sugar ...... O-B07 Cherry ** ...... O-C17 Bump & Grind ...... O-B67 China Musk ...... O-C13 Burberry: Body (W) Type ...... O-B71 China Rain ...... O-C54 Burberry Brit (M) Type ...... O-B56 Chloe: Roses De Chloe (W) Type . . O-C94 Burberry Brit: Red (W) Type . . . . O-B82 Chrome (M) Type ...... O-C19 Burberry: Mr Burberry (M) Type . . . O-B52 Chrome: Intense (M) Type . . . . . O-C27 Burberry: My Burberry Black (W) . . O-B05 CK: Red (W) Type ...... O-C91 Burberry Sport (M) Type ...... O-B60 Clinique: Happy Heart (W) Type . . . O-C01 Burberry Sport (W) Type ...... O-B32 Coach (M) Type ...... O-C02 Burberry: Touch (M) Type . . . . . O-B46 Coach Type (W) ...... O-C44 Butt Naked ...... O-B27 Coach: Floral (W) Type ...... O-C09 Butter Flower ...... O-B50 Coach: The Fragrance (W) Type . . . O-C75 Bvlgari: Aqua (M) Type ...... O-B03 Coach: Leatherware (M) Type . . . O-C32 Bvlgari: Aqua Atlantique (M) Type . . O-B06 Coach : Legacy (W) Type . . . . .O-C65 Bvlgari: Man In Black (M) Type . . . O-B19 Coach: Love Blush (W) Type . . . . O-C92 Bvlgari Soir Type ...... O-B38 Coach: Poppy Flower (W) Type . . . O-C61 Byredo: Bibliothèque (W) Type . . . O-B35 (W) Type ...... O-C78 Byredo: Seven Veils (U) Type NEW . O-B53 Coco-Mango * ...... O-C16 Coconut Milk NEW ...... O-C104 C Coconut Passion: Victoria’s Secret (W) O-C59 Calvin Klein: Endless Euphoria (W) .O-C88 Cool Water (M) Type ...... O-C14 Calvin Klein: Eternity (W) Type . . . O-C26 Cool Water (W) Type * ...... O-C45 Calvin Klein: Obsessed (W) Type . . O-C72 Cool Water Frozen (W) Type . . . . O-C52 Caribbean Salsa : Bath & Bodyworks O-C64 Cotton Candy (W) Type ...... O-C79 Carlos Santana Type (M) ...... O-C42 Creed: Aventus (M) Type ...... O-C28 Carolina Herrera: 212 (M) Type . . . O-C07 Creed: Aventus For Her (W) Type ** . O-C46 Carolina Herrera: 212 (W) Type . . . O-C08 Creed: Himalaya (M) Type . . . . .O-C76 Carolina Herrera: Africa (W) Type . . O-C51 Creed: Imperial (M) Type ...... O-C96 Carolina Herrera: Good Girl (W) Type O-C47 Creed: Millesime 1849 (U) . . . . . O-C20 Cartier: La Panthere (W) Type NEW O-C102 Creed: Original Santal (M) Type . . O-C34 Cartier: Vetiver Bleu (U) Type . . . . O-C31 Creed: Original Vetiver (M) Type . . O-C37 Casmir (W) Type ...... O-C12 Creed: Royal Mayfair (W) Type . . . O-C36 50 Over 850 Oils! Find Your Favorite ƄR]_R]_R]_R]_OE Creed: Royal Oud (U) Type . . . . . O-C87 Dolce & Gabbana: Velvet Love (W) .O-D52 Creed: Royal Princess Oud (W) Type O-C38 Dolce & Gabbana:Velvet Patchouli (W) O-D47 Creed: Silver Mountain Water (M) . . O-C22 Donald Trump (M) Type ...... O-D32 Creed: Sublime Vanille (W) Type ** . . O-C29 Donna Karen: Black Cashmere (W) . O-D40 Creed: Viking (M) Type ...... O-C03 Donna Karen: Cashmere Mist (W) . . O-D36 Creed: White Flowers (W) Type . . . O-C77 Donna Karen: Liquid Cashmere (W) O-D53 Cucumber Melon ...... O-C30 Double Black (M) Type(Polo) . . . . O-D19 Curve (M) Type ...... O-C15 Dragon’s Blood ...... O-D33 Curve (W) Type ...... O-C66 Drakkar Noir (M) Type ...... O-D12 Curve Crush (M) Type ...... O-C56 E Curve Crush (W) Type ...... O-C57 Eat It Raw ...... O-E42 Curve Soul (M) Type ...... O-C40 Ed Hardy Type (M) ...... O-E25 D Ed Hardy Type (W)...... O-E26 Dark Baby Powder ...... O-D25 Ed Hardy: Born Wild (M) Type . . . . O-E34 Diana Ross: Diamond Diana (W) Type NEW Ed Hardy: Born Wild (W) Type . . . O-E35 ...... O-D65 Ed Hardy: Hearts & Daggers (M). . . O-E31 Diesel (M) Type ...... O-D17 Ed Hardy: Hearts & Daggers (W) . . O-E32 Diesel: Bad (M) Type ...... O-D59 Ed Hardy: Love & Luck (M) Type . . O-E40 Diesel: Red Kiss (W) Type . . . . . O-D48 Ed Hardy Love & Luck (W) . . . . . O-E28 Dior: Ambre Nuit (W) Type . . . . . O-D55 Ed Hardy: Love Is... (W) Type . . . . O-E56 Dior: Blooming Bouquet (W) Type . . O-D42 Ed Hardy: Skulls & Roses (M) . . . O-E44 Dior: Homme Intense (M) Type . . . O-D58 Ed Hardy: Skulls & Roses (W) . . . O-E45 Dior: Homme Sport (M) Type . . . . O-D56 Ed Hardy: Villain (W) Type . . . . . O-E39 Dior: J’adore (W) Type ...... O-D45 Egyptian Lavender ...... O-E60 Dior: J’Adore Lumiere (W) Type . . O-D57 Egyptian Musk ...... O-E10 Dior: Miss Dior (W) Type ...... O-D46 Egyptian Musk: Clear ...... O-E54 Dior: Poison Girl (W) Type . . . . . O-D60 Egyptian Musk: Gold NEW . . . . . O-E66 Dior: Sauvage (M) Type ...... O-D49 Elizabeth Arden: Always Red (W) . . O-E61 Dior: Sauvage Eau De Parfum (M) NEW . . Elizabeth Taylor: Gardenia (W) Type .O-E63 Type ...... O-D64 Ellen Tracy (W) Type ...... O-E30 Dior: Sauvage Very Cool (M) Type . . O-D61 Emporio Armani Diamonds (M) Type . O-E27 DKNY My NY (W) Type ...... O-D43 English Laundry: Arrogant (M) Type . O-E64 DKNY: Red Delicious (W) Type . . . O-D62 Envy (M) Type ...... O-E21 Dolce & Gabanna (M) Type . . . . . O-D13 Escada: Agua Del Sol (W) Type . . O-E62 Dolce & Gabanna (W) Type . . . . . O-D26 Escada: Born In Paradise (W) Type . O-E52 Dolce & Gabbana: Blue (M) Type . . O-D50 Escada: Celebrate N.O.W. (W) Type . O-E65 Dolce & Gabbana: Floral Drops (W) . O-D54 Escada: Cherry In The Air (W) Type . O-E49 Dolce & Gabanna: Gentleman (M) . O-D30 Escada: Joyful (W) ...... O-E57 Dolce & Gabbana: Light Blue (M) . . O-D51 Escada: Ocean Lounge (W) Type . . O-E29 Dolce & Gabanna Light Blue (W) . . O-D27 (VFDGD6H[\*UDI¿WL : 7\SH . . . O-E48 D & G Light Blue: Dreaming (W) . . O-D38 Escada: Turquoise Summer (W) Type O-E58 Dolce & Gabanna Rose The One (W) O-D28 Escape (M) Type ...... O-E11 Dolce & Gabanna Sicily (W) Type . . O-D44 Escape (W) Type ...... O-E14 * ѿR]_R] _R]_R]_OE ** ѿR]_R] _R]_R]_OE 51 *** ѿR]_R]_R]_R]_OE **** ѿR]_R]_R]_R]_OE Estee Lauder: Modern Muse (W) . . O-E53 Este Lauder: Pleasures Intense (W) . O-E59 Estee Lauder: Sensuous Nude (W) . O-E41 Estee Lauder: Youth Dew (W) NEW . O-E67 Eternity (M) Type ...... O-E12 Eucalyptus * ...... O-E17 Euphoria (W) Type ...... O-E22 Eva Longoria: Eva (W) Type . . . . O-E33 1 lb. 8 oz. 4 oz. 1 oz. ѿR] F

Fahrenheit (M) Type ...... O-F10 Gucci: Guilty Black (W) Type . . . .O-G35 Fantasy Type (W) . . O-F16 Gucci: Guilty Intense (M) Type . . .O-G37 Fire & Ice (W) Type ...... O-F13 Gucci: Guilty Intense (W) Type . . .O-G38 Flower Bomb (W) Type ...... O-F25 Gucci: Guilty Platinum (M) Type . .O-G52 Forbidden Fruit (W) Type ...... O-F18 Gucci: Guilty Platinum (W) Type . .O-G53 Frankincense ...... O-F12 Guerlain: Insolence (W) Type . . . .O-G44 Frankincense-Patchouli ...... O-F23 Guess: Girl (W) Type ...... O-G39 Frank & Myrrh ...... O-F11 Guess: Night (M) Type ...... O-G46 Frankincense & Myrrh: Spirit and Soul ** . Guy Laroche: Drakkar Essence (M) . O-G62 ...... O-F22 H G H&M: Caribbean Crush (W) Type . . O-H37 Gianfranco Ferré (W) Type . . . . .O-G59 Halle Berry (W) Type ...... O-H25 Giorgio 273 (W) Type ...... O-G10 Halle Berry: Closer (W) Type . . . . O-H31 Giorgio Armani: Profumo (M) Type .O-G51 Halle Berry: Exotic Jasmine (W) Type O-H33 Giorgio Armani: Si (W) Type . . . .O-G40 Halle Berry Pure Orchid (W) Type . . O-H26 Girlfriend (W) Patti Labelle Type . . .O-G20 Happy (W) Type ...... O-H10 Givenchy: Dahlia Divin (W) Type . .O-G42 Hermes: Terre D’Hermes (M) Type . . O-H40 Givenchy: Gentlemen (M) Type . . .O-G64 Hollister: Wave (M) Type ...... O-H39 Givenchy: Gentlemen Only (M) Type O-G41 Hot Water (M) Type ...... O-H28 Givenchy: Gentlemen Only Fraîche (M) O-G60 Hugo Boss; Bottled Tonic (M) Type . O-H41 Givenchy: Hot Couture (W) Type . .O-G55 Hugo Boss Dark Blue (M) Type . . . O-H12 Givenchy: Pi Air (M) Type . . . . .O-G56 Hugo Boss: Element (M) Type . . . O-H43 Glow - J. Lo (W) Type ...... O-G18 Hugo Boss: Iced (M) Type . . . . . O-H42 Gold Sugar (W) Type ...... O-G36 Hummer: Black (M) Type . . . . . O-H35 Goutal: Eau D Hadrien (W) NEW . . .O-G66 Hypnotic Poison (W) Type . . . . . O-H11 Grey Flannel (M) Type ...... O-G12 I Gucci II Type (W) ...... O-G25 I Am Juicy Couture (W) Type . . . . O-I35 Gucci: Bamboo (W) Type . . . . .O-G47 I Am King (M) Sean John Type . . . O-I19 Gucci: Bloom (W) Type ...... O-G58 I Am King Of Miami (M): Sean John . O-I21 Gucci: Envy Me (W) Type . . . . .O-G61 I Am King of the NIght (M) Sean John O-I20 Gucci: Guilty (M) Type ...... O-G33 I Love Juicy Couture (W) Type . . . O-I36 Gucci: Guilty (W) Type ...... O-G28 Iceberg (M) Type NEW ...... O-I38 Gucci: Guilty Absolute (M) Type . .O-G57 Iced Pineapple NEW ...... O-I39 Gucci: Guilty Black (M) Type . . . .O-G34 Intimately Beckham (M) Type . . . . O-I17 52 Over 850 Oils! Find Your Favorite ƄR]_R]_R]_R]_OE Island Hawaii: Michael Kors (W) . . . O-I15 JPG: Gaultier 2 (U) Type NEW . . . . O-J72 Issey Miyake (M) Type ...... O-I10 JPG: Kokorico (M) Type ...... O-J39 Issey Miyake (W) Type ...... O-I24 JPG LeMale (M) Type ...... O-J15 Issey Miyake: A Scent (W) Type . . . O-I22 JPG: Scandal (W) Type ...... O-J70 Issey Miyake: Gold Absolute (M) Type O-I31 JPG Summer (M) Type ...... O-J43 Issey Miyake: Intense (M) Type . . . O-I23 JPG: Ultra Male (M) Type . . . . .O-J61 Issey Miyake L’eau Bleue Type . . . O-I13 Juicy Couture Type ...... O-J16 Issey Miyake: L’eau D’Issey (W) Type O-I34 Juicy Couture Couture (W) Type . . O-J44 Issey Miyake: Noir Ambre (M) Type . . O-I37 Juicy Couture: Malibu (W) Type . . O-J57 Issey Miyake: Nuit D’Issey (M) . . . . O-I32 Juicy Couture: Viva La Juicy (W) . . O-J47 Issey Miyake: Pleats Please (W) Type O-I27 Juicy Couture: Viva La Noir (W) . . O-J52 Issey Miyake: Sports (M) Type . . . O-I26 K Issey Miyake Summer (M) Type . . . O-I30 Kate Spade:Twirl (W) Type . . . . . O-K37 Issey Miyake Summer (W) Type . . . O-I16 Kenneth Cole Type (M) ...... O-K13 J Kenneth Cole: Black Bold (M) Type . O-K36 Jaipur (M) Type ...... O-J64 Kenneth Cole: Blue (M) Type . . . . O-K35 Jamaican Fruit * ...... O-J13 Kenneth Cole: For Him (M) Type . . O-K38 Jamaican Love NEW ...... O-J71 Kenneth Cole: Mankind (M) Type . . O-K34 Jamaican Me Crazy ...... O-J33 Kim Kardashian (W) Type . . . . . O-K20 James Bond 007 (M) Type . . . . . O-J37 Kim Kardashian: Crystal Gardenia (W) O-K39 Japanese Cherry Blossom (W) Type . O-J54 Kim Kardashian: Glam (W) Type . . O-K30 Jasmine * ...... O-J14 Kim Kardashian: Gold (W) Type . . . O-K21 Jasmine: Romance ...... O-J34 Kim Kardashian: Love (W) Type . . O-K25 Jay Z 9 IX (M) Type ...... O-J17 Kim Kardashian: Pure Honey (W) . . O-K32 Jay Z: Gold (M) Type ...... O-J50 Kimora Simmons: Golden Goddess (W) O-K24 Jay Z: Gold Extreme (M) Type . . . . O-J55 Knowing (W) Type ...... O-K10 Jay Z X (M) Rocawear Type . . . . . O-J20 Kush ...... O-K11 J. Lo: Glow After Dark (W) Type . . O-J25 L Miami Glow (W) . . . O-J23 Lacoste: L!ve (M) Type ...... O-L44 Jimmy Choo (W) Type ...... O-J30 Lacoste: Red (M) Type ...... O-L50 Jimmy Choo: Exotic (W) Type . . . O-J48 Lady Gaga: Fame (W) Type . . . . . O-L36 Jimmy Choo: Flash (W) Type . . . O-J45 Lady Million (W): Paco Rabanne (W) Type Jimmy Choo: Ice (M) Type . . . . . O-J69 ...... O-L32 Jimmy Choo: Illicit (W) Type . . . . O-J59 /DJHU¿HOG 0 7\SH ...... O-L13 Jimmy Choo: Illicit Flower (W) Type . O-J68 Lancome: La Vie Est Belle (W) . . . O-L48 Jimmy Choo: Love (W) Type . . . . O-J58 Lancome: Miracle (M) Type . . . .O-L57 Jimmy Choo: Man (M) Type . . . .O-J60 Lancome: Miracle (W) Type . . . .O-L58 Jimmy Choo: Man Intense (M) Type . O-J67 Lancome: Tresor (W) Type . . . . . O-L51 Joop (M) Type ...... O-J10 Laura Biagiotti: Roma (W) Type . . . O-L59 Joop (W) Type ...... O-J46 Lavender * ...... O-L10 Joop! Homme Wild (M) Type . . . . O-J56 Lavender Fields ...... O-L49 Joop: Splash (M) Type ...... O-J31 Lemon ...... O-L47 JPG (W) Type ...... O-J11 Lemongrass ...... O-L11 * ѿR]_R] _R]_R]_OE ** ѿR]_R] _R]_R]_OE 53 *** ѿR]_R]_R]_R]_OE **** ѿR]_R]_R]_R]_OE Lick Me All Over ...... O-L25 Michael Kors: Glam Jasmine (W) .O-M65 Liz Claiborne: Lucky You (M) . . . . O-L53 Michael Kors: Gold (W) Type . . . .O-M50 Louis Vuitton: Apogee (W) Type . . O-L56 Michael Kors: Midnight Shimmer (W) O-M87 Louis Vuitton: Rose Des Vents (W) . O-L60 Michael Kors: Rose Radiant Gold (W) O-M12 Louis Vuitton: Turbulences (W) . . . O-L55 Michael Kors: Sexy Amber (W) Type .O-M60 Love Spell (W) Victoria’s Secret . . . O-L31 Michael Kors: Sexy Blossom (W) . .O- Lovely Sarah Jessica (W) . . . . . O-L17 Michael Kors: Sexy Ruby (W) Type .O-M98 M Michael Kors: Sexy Sunset (W) Type O-M83 Mambo (M) Type ...... O-M13 Michael Kors: Suede (W) Type . . .O-M59 Mambo (W) Type ...... O-M14 Michael Kors: Very Hollywood (W) . .O-M85 Mango * ...... O- Michael Kors: Wonderlust (W) Type .O- Mango Butter ...... O-M69 Michelle Obama (W) Type . . . . .O-M34 Mania - Armani (M) Type ...... O-M19 Michelle Obama: Renaissance (W)* .O-M72 Marc Ecko: Blue (M) Type . . . . .O-M55 Miss Dior: Absolutely Blooming (W) . O- Marc Jacobs (M) Type ...... O-M70 Miu Miu (W) Type ...... O-M80 Marc Jacobs: Bang (M) Type . . . .O-M15 Money (M) Type ...... O-M11 Marc Jacobs: Daisy (W) Type . . . .O- Mont Blanc: Legend (M) Type . . . .O-M58 Marc Jacobs: Daisy Dream (W) Type . O- Moon Sparkle (M) Type ...... O-M26 Marc Jacobs: Daisy Dream Forever (W) . Moon Sparkle (W) Type ...... O-M27 ...... O-M82 Moschino: Fresh Couture (W) Type .O- Marc Jacobs: Daisy Hot Pink (W) . .O- Moschino: Pink Couture (W) Type . .O-M99 Marc Jacobs: Daisy So Fresh (W) .O-M97 Myrrh ...... O-M28 Marc Jacobs: Daisy Sorbet (W) Type O-M94 N Marc Jacobs: Daisy Sunshine (W) . .O-M68 Nag Champa ...... O-N11 Marc Jacobs: Decadence (W) Type .O- Narciso Rodriguez (W) Type NEW . . O-N31 Marc Jacobs: Dot (W) Type . . . .O-M74 Nautica Oceans (M) Type . . . . . O- Marc Jacobs: Honey (W) Type . . .O-M63 Nautica: Voyage Sport (M) Type . . . O-N30 Marc Jacobs: Lola (W) Type . . . .O-M78 Nelly Apple Bottoms (W) Type . . . O-N18 Marc Jacobs: Orange Splash (W) NEW . . Nicki Minaj: Exotic (W) Type . . . . O-N24 ...... O- Nicki Minaj: Gold (W) Type . . . . . O-N23 Mariah Carey Type (W) ...... O-M25 Nicki Minaj: Minajesty (W) Type . . . O-N22 Mariah Carey Forever (W) Type . . .O-M40 Nicki Minaj: Onika (W) Type . . . .O-N25 Mariah Carey: Inseparable (W) Type .O-M51 Nicki Minaj: Pink Friday (W) Type . . O-N20 Mariah Carey Luscious Pink (W) . .O- Nicki Minaj: Pinkprint (W) Type . . . O-N26 Mary J. Blige My Life (W) Type . . .O-M42 Nicki Minaj: Summer (W) Type . . . O-N21 Mary J. Blige: My Life Blossom (W) .O- Nicki Minaj: Trini Girl (W) Type . . . O-N29 Mecca Musk ...... O-M81 Nine West: Love Fury (W) Type . . . O-N28 Michael Jordan (M) ...... O-M23 Nite Queen (W) ...... O-N15 Michael Jordan: Flight (M) Type . . .O-M49 Nubian Musk ...... O- Michael Kors (M) Type ...... O-M75 Michael Kors Type (W) ...... O-M22 O Michael Kors: Extreme Blue (M) . .O-M79 Obama’s Best Type ...... O-O27 Michael Kors: Extreme Night (M) . .O-M95 Obsession Type (M) ...... O-O10 Ocean Breeze ...... O-O26 54 Over 850 Oils! Find Your Favorite ƄR]_R]_R]_R]_OE One Direction: Between US (W) Type O-O25 Platinum (M) Type ...... O-P20 One Million (M) Type ...... O-O23 Playboy: Miami (M) Type . . . . . O-P74 One Million Intense (M) Type . . . .O-O24 Playboy: NY (M) Type ...... O-P70 Opium (W) Type ...... O-O11 Pleasures (W) Type ...... O-P11 Oxygene (W) Type ...... O-O12 Polo Ralph Lauren (M) Type . . . . O-P13 P Polo Black (M) Type ...... O-P29 Paco Rabanne: Aqua Invictus (M) . O-P91 Polo Blue (M) Type ...... O-P30 Paca Rabanne: Invictus (M) Type . . O-P90 Polo Red (M) Type ...... O-P79 Paco Rabanne: Olympea (W) Type . O-P96 Polo: Red Extreme (M) Type . . . . O-P98 Paris Hilton (M) Type ...... O-P39 Polo: Red Intense (M) Type . . . .O-P88 Paris Hilton (W) Type ...... O-P38 Polo: Supreme Cashmere (M) Type . O-P14 Paris Hilton Can Can (W) Type . . . O-P49 Polo: Supreme Leather (M) Type . . O-P89 Paris Hilton: Gold Rush (W) Type . . O-P25 Polo: Supreme Oud (M) Type ** . . . O-P85 Paris Hilton: Rose Rush (W) Type . . O-P18 Polo: Ultra Blue (M) Type NEW . . . O-P34 Paris Hilton: Tease (W) Type . . . . O-P59 Power 50 Cent (M) Type ...... O-P53 Paris Hilton: With Love (W) Type . . O-P82 President Obama: POTUS 1600 (M) . O-P57 Patchouli Classic*** ...... O-P55 Princess: Vera Wang (W) Type . . . O-P46 Patchouli & Myrrh** ...... O-P83 Purple Rain ** ...... O-P60 Patchouli Natural * ...... O-P10 Q Patchouli Sweet ...... O-P52 Queen Latifah (W) Type ...... O-Q10 Patti Labelle (W) Type ...... O-P17 R Paul Sebastian Type (M) ...... O-P22 Rag & Bone: Amber (U) Type . . . . O- Penguin: Rocks (M) Type . . . . .O-P23 Rain Type ...... O-R16 Peppermint ...... O-P24 Ralph Lauren Type (W) ...... O- Perry Ellis 360 (M) Type ...... O-P16 Ralph Lauren: Blue (M) Type . . . . O-R53 Perry Ellis 360 (W) Type ...... O-P15 Ralph Lauren Blue (W) Type . . . . O-R34 Perry Ellis 360 Black (M) Type . . . O-P67 Ralph Lauren: Love (W) Type . . . . O-R52 Perry Ellis 360 Black (W) Type . . . O-P68 Ralph Lauren: Pure Turquoise (W) . O-R41 Perry Ellis 360 Blue (M) Type . . . O-P77 Ralph Lauren: Woman (W) Type . . O-R57 Perry Ellis: 360 Red (M) Type NEW . . O-P32 Rastafarian (M) ...... O-R50 Pharrell Williams: Girl (W) Type . . . O-P81 Rasta Woman (W) Type ** . . . . .O-R47 Philosophy: Amazing Grace (W)NEW O-P28 Red Egyptian Musk ...... O-R32 Philosophy: Celebrate Grace (W) NEW . . : Crush (W) Type ...... O-R54 ...... O-P33 Rihanna: Kiss (W) Type ...... O-R56 Philosophy: Eternal Grace (W) NEW . O-P31 Rihanna: Nude (W) Type ...... O-R42 Pineapple ...... O-P26 Rihanna: Reb’l Fleur (W) Type . . . O-R37 Pink by Victoria’s Secret Type (W) . . O-P21 Rihanna: Rebelle (W) Type . . . . . O-R39 Pink Sugar (W) Type ...... O-P42 Rihanna: Riri (W) Type ...... O- Pink Sugar: Luxury (W) Type . . . . O-P87 Rhianna: Rouge (M) Type . . . . .O-R48 Pink Sugar: Sensual (W) Type. . . . O-P56 Rihanna: Rogue (W) Type . . . . . O-R45 Pink Sugar: Sparkle (W) Type . . . O-P69 Rhianna: Rouge Love (W) Type . . . O-R49 Pink Sugar: Sparks (W) Type . . . O-P64 Rocawear: Evolution (M) Type . . . O-R38 Pitbull Man (M) Type ...... O-P84 Roja Dove: Aoud (U) Type NEW . . . O-R58 * ѿR]_R] _R]_R]_OE ** ѿR]_R] _R]_R]_OE 55 *** ѿR]_R]_R]_R]_OE **** ѿR]_R]_R]_R]_OE Romance (W) Type ...... O- Tom Ford: Soleil Blanc (M) NEW . . O-T58 Rose Red * ...... O-R13 Tom Ford: Velvet Orchid (W) Type . . O-T34 RSVP: Kenneth Cole (M) Type . . . O- Tom Ford: Vert D’encens (W) Type . O-T49 Rush by Gucci Type (W) ...... O- Tommy Bahama: Maritime (M) Type . O-T54 S Tommy Girl (W) Type ...... O-T11 Sandalwood: Arabian ...... O-S75 Tory Burch (W) Type ...... O-T42 Sandalwood: Classic ...... O-S70 Tory Burch: Love Relentlessly (W) . O-T46 Sandalwood Egyptian ...... O-S10 True Religion (M) Type ...... O-T29 Sean John (M) Type ...... O-S73 True Religion (W) Type ...... O-T30 Sean John: 3AM (M) Type . . . . . O-S71 True Religion: Drifter (M) Type . . . O-T47 Sean John: Empress (W) Type . . . O-S48 Truly Pink - Vera Wang (W) Type . . . O-T21 Seduction in Black (M) Type . . . . O-S47 Truth Calvin Klein (M) Type . . . . O-T18 Sex on the Beach (W) Type . . . . . O-S24 Tsar (M) Type ...... O-T55 Sex on the Beach: Sweet ...... O-S50 Tupac (M) Type ...... O-T26 Sexual Sugar (W) Type ...... O-S64 Tuscan Blood Orange (W) Type . . . O-T36 Sexual Sugar Daddy (M) Type . . . O-S65 Twilight Woods Type ...... O-T40 Sexy Little Thing (W) Type . . . . . O-S40 Tyler Perry: Madea (W) Type . . . . O-T56 Signature (W) V. Beckham Type . . . O-S38 U Somali Rose French (W) Type . . . . O-S12 Unforgivable (M) Type ...... O-U10 Strawberry ...... O-S15 Unforgivable (W) Type ...... O-U12 Strawberry Butter ...... O-S36 Unforgivable Black (M) Type . . . . O-U15 Sugar Cookie ...... O-S76 Unforgivable Black (W) Type . . . . O-U20 Sunset Heat (M) Type ...... O-S34 Unforgivable Night (M) Type . . . . O-U19 Super Model (W) Victoria’s Secret . . O-S45 UR Usher (M) Type ...... O-U16 Super Playboy (M) Type ...... O-S58 UR Usher (W) Type ...... O-U17 Swarovski: Miss Aura (W) Type . . . O-S66 Usher (M) Type ...... O-U11 Sweet Temptation (W) Victoria’s Secret Usher (W) Type ...... O-U13 Type ...... O-S39 Usher V.I.P. (M) Type ...... O-U18 T Vanilla ...... O-V11 Thallium (M) Type ...... O-T35 Vera Wang (M) Type ...... O-V19 The One (M) Type - Dolce & Gabbana O-T25 Vera Wang (W) Type ...... O-V18 The One (W) Type - Dolce & Gabbana O-T23 Vera Wang: Be Jeweled (W) Type . . O-V37 Tiffany (W) Type ...... O-T52 Vera Wang: Love Struck Floral Rush (W) Tom Ford (M) Type ** ...... O-T39 Type ...... O-V32 Tom Ford: Cafe Rose (U) Type . . . O-T45 Versace (M) Type ...... O-V13 Tom Ford: Costa Azzurra (U) Type . O-T51 Versace : Blue Jeans (M) Type . . . O-V27 Tom Ford: F* Fabulous (U) Type . . O-T53 Versace Bright Crystal (W) Type . . O-V40 Tom Ford: Noir (M) Type ...... O-T45 Versace: Dreamer (M) Type . . . . O-V43 Tom Ford: Noir (W) Type ** . . . . . O-T37 Versace: Dylan Blue (M) Type . . . . O-V56 Tom Ford: Noir Anthracite (M) Type . O-T50 Versace: Dylan Blue (W) Type . . . O-V64 Tom Ford: Ombre Leather (M) Type . O-T44 Versace: Eros (M) Type ...... O-V51 Tom Ford: Orchid Soleil (W) Type . . O-T43 Versace: Eros Pour Femme (W) Type O-V49 Tom Ford: Oud Minerale (U) NEW . . O-T57 Versace: Man Eau Fraîche (M) Type . O-V62 56 Versace: Oud Noir (M) Type . . . . . O-V46 Yves Saint Laurent: L’Homme (M) . O-Y12 Versace Pour Homme (M) Type . . . O-V44 Yves Saint Laurent: L’Homme Blue (M) Versace: Red Jeans (W) Type . . . . O-V28 NEW ...... O-Y22 Very Sexy (M) Type ...... O-V17 Yves Saint Laurent: L’Homme Electrique (M) Type ...... O-Y19 Very Sexy (W) Type ...... O-V16 Yves Saint Laurent: Manifesto (W) . O-Y13 Very Sexy Now (W) Victoria Secret . O-V29 Yves Saint Laurent: Mon Paris (W) . O-Y17 Very Sexy: Platinum (M) Type . . . O-V59 Yves Saint Laurent: Supreme Bouquet (W) Victoria’s Secret: Angel (W) Type . . O-V30 Type ...... O-Y18 Victoria Secret: Angel Gold (W) . . . O-V35 Yves Saint Laurent: Y (M) Type . . . O-Y20 Victoria’s Secret: Bombshell (W) . . O-V45 Z Victoria’s Secret: Bombshell Nights (W) Type ...... O-V65 Zara: Black (M) Type ...... O-Z11 Victoria’s Secret: Forever Blushing (W) Type ** ...... O-V48 Victoria’s Secret: Intense (W) . . . . O-V58 Victoria’s Secret: Lemon Escape (W) Type ...... O-V41 Victoria’s Secret: Love (W) Type . . O-V63 Victoria’s Secret Love Is Heavenly (W) Type ...... O-V47 Victoria’s Secret: Love Pink (W) . . O-V52 Victoria’s Secret: Paris (W) Type . . O-V60 Victoria Secret: Rose Caramel (W) . O-V57 Victoria’s Secret: Tease Flower (W) . O-V61 Victoria Secret: Yellow Diamond (W) Type NEW ...... O-V68 Viktor & Rolf: Bonbon (W) NEW . . . O-V67 Viktor & Rolf: Spicebomb (M) Type . O-V53 Vince Camuto (M) Type ...... O-V36 Vince Camuto (W) Type ...... O-V39 Vince Camuto: Capri (W) Type . . . O-V54 Vince Camuto: Ciao (W) Type . . . O-V66 Vince Camuto: Eterno (M) Type . . . O-V55 Tommy Bahama: Vintage Black (M) Kenneth Cole Type O-V23 Maritime (M) Type W Wet Kisses Type (W) ...... O-W16 Fragrance For Men White Coconut * ...... O-W24 O-T54 White Diamond Type (W) . . . . . O-W10 White Linen Type (W) ** ...... O-W11 Drawing inspiration from the pleasure and adventure of sailing, Tommy Bahama Maritime White Musk (W) Type ...... O-W21 is a fresh, invigorating fragrance. Bergamot, White Tea & Ginger (W) B&BW ** . O-W22 lavender and clary sage are followed by Y smoothing notes of violet leaf and geranium. Ylang & Myrrh NEW ...... O-Y21 Woods, musk and moss create a scent Ylang Ylang ...... O-Y10 reminiscent of sea air. O-T54 Yves Saint Laurent: Black Opium (W) O-Y14 Essential oil bracelets… 57

Made in Africa

The power of aromatherapy. Enhance your health and feelings. African trade bead bracelets from Ghana are infused with thera- peutic essential oils. Improve your health and moods whenever you wear one. Each bracelet comes with its own essential oil UHFKDUJLQJER[WRDXWRPDWLFDOO\UHHQHUJL]H your bracelet. 8QLTXHEHQH¿WVIRXQGQRZKHUHHOVH

Breathing Bracelet Energy Bracelet 5HOLHYHVFRQJHVWLRQ5HOD[LQJ Increases Energy, Remove Stress, Breathe easier. H-071 $19.90 0HQWDO)RFXV6H[XDOHQGXUDQFH H-066 $19.90 Calming Bracelet Relieve stress, Defeat depression, and Gives Health Bracelet healthy sleep. H-067 $19.90 Strengthens immunity. Promotes overall health. H-068 $19.90 Cold Combat Bracelet Anti-bacterial, Clears sinuses Mental Alertness Bracelet Improves breathing. H-070 $19.90 Mental focus, Alertness, Overall mental health. H-069 $19.90

• Cleanse and deodorize your air • Increase energy • Improve sleep White • Enhance moods

3RUWDEOH(VVHQWLDO2LO$URPD¿HU Himalayan Salt Crystal Lamp (QMR\WKHEHQH¿WVRISXUHHVVHQWLDORLOVE\ 8” tall. Salt lamps or HPS (Himalayan Pink placing a few drops on the absorbing pad. Salt) lamps are essentially large pieces of Safe for travel, performs without heat or water. pure Himalayan Salt with a small bulb inside. Creates a fragrant and healthy environment They offer a nice warm glow when lit and may with the touch of a button. O-180 $27.90 EHEHQH¿FLDOIRULQGRRUDLUTXDOLW\ O-176 $29.90 58 Essential Oils for Skin and Senses These oils are 100% steam-distilled fragrances that take days of impeccable work to create. To enjoy just RQHGURSRIODYHQGHUHVVHQWLDORLO\RXZRXOGKDYHWRVWHDPGLVWLOOODYHQGHUưRZHUKHDGV Ajowan Copaiba Balsam NEW Myrrh 1 oz. O-A631-E $9.90 1 oz. O-C1051-E $13.90 1 oz. O-M771-E $17.90 4 oz. O-A634-E $23.90 4 oz. O-C1054-E $29.90 4 oz. O-M774-E $47.90 Aniseed Eucalyptus Myrtle 1 oz. O-A711-E $9.90 1 oz. O-E201-E $13.90 1 oz. O-M961-E $29.90 4 oz. O-A714-E $23.90 4 oz. O-E204-E $29.90 4 oz. O-M964-E $79.90 Basil Fennel Orange 1 oz. O-B161-E $9.90 1 oz. O-F351-E $15.90 1 oz. O-O181-E $9.90 4 oz. O-B164-E $23.90 4 oz. O-F354-E $35.90 4 oz. O-O184-E $23.90 Bergamot Fir Needle Organic Oregano NEW 1 oz. O-B311-E $19.90 1 oz. O-F341-E $13.90 1 oz. O-O281-E $29.90 4 oz. O-B314-E $53.90 4 oz. O-F344-E $29.90 4 oz. O-O284-E $79.90 Black Pepper NEW Frankincense Palmarosa NEW 1 oz. O-B361-E $23.90 1 oz. O-F331-E $17.90 1 oz. O-P351-E $17.90 4 oz. O-B364-E $63.90 4 oz. O-F334-E $47.90 4 oz. O-P354-E $47.90 Blood Orange Geranium Patchouli - Dark 1 oz. O-B221-E $9.90 1 oz. O-G501-E $17.90 1 oz. O-P511-E $17.90 4 oz. O-B224-E $23.90 4 oz. O-G504-E $47.90 4 oz. O-P514-E $47.90 Calamus Root Ginger Grass Patchouli (Light) 1 oz. O-C051-E $23.90 1 oz. O-G451-E $13.90 1 oz. O-P971-E $17.90 4 oz. O-C054-E $63.90 4 oz. O-G454-E $29.90 4 oz. O-P974-E $47.90 Camphor Ginger Root Peppermint 1 oz. O-C231-E $9.90 1 oz. O-G631-E $23.90 1 oz. O-P401-E $13.90 4 oz. O-C234-E $23.90 4 oz. O-G634-E $63.90 4 oz. O-P404-E $29.90 Caraway NEW Grapefruit (White) Peppermint: Supreme 1 oz. O-C1001-E $19.90 1 oz. O-G541-E $23.90 1 oz. O-P991-E $13.90 4 oz. O-C1004-E $53.90 4 oz. O-G544-E $63.90 4 oz. O-P994-E $29.90 Carrot Seed Jamarosa Root Pine 1 oz. O-C351-E $19.90 1 oz. O-J621-E $13.90 1 oz. O-P951-E $15.90 4 oz. O-C354-E $53.90 4 oz. O-J624-E $29.90 4 oz. O-P954-E $35.90 Cassia Juniper Berry Pink Grapefruit 1 oz. O-C061-E $13.90 1 oz. O-J631-E $23.90 1 oz. O-P501-E $19.90 4 oz. O-C064-E $29.90 4 oz. O-J634-E $63.90 4 oz. O-P504-E $53.90 Cedarwood Lavandin NEW Rosemary 1 oz. O-C501-E $13.90 1 oz. O-L621-E $15.90 1 oz. O-R361-E $19.90 4 oz. O-C504-E $29.90 4 oz. O-L624-E $35.90 4 oz. O-R364-E $53.90 Celery Lavender Sage 1 oz. O-C841-E $17.90 1 oz. O-L181-E $15.90 1 oz. O-S741-E $19.90 4 oz. O-C844-E $47.90 4 oz. O-L184-E $35.90 4 oz. O-S744-E $53.90 Chamomile Lemon Spearmint ½ oz. O-C855-E $59.90 1 oz. O-L461-E $13.90 1 oz. O-S691-E $9.90 Cinnamon Leaf 4 oz. O-L464-E $29.90 4 oz. O-S694-E $23.90 1 oz. O-C391-E $13.90 Lemon Tea Tree Tangerine 4 oz. O-C394-E $29.90 1 oz. O-L611-E $27.90 1 oz. O-T411-E $13.90 Citronella 4 oz. O-L614-E $69.90 4 oz. O-T414-E $29.90 1 oz. O-C811-E $9.90 Lemongrass Tea Tree 4 oz. O-C814-E $23.90 1 oz. O-L191-E $13.90 4 oz. M-263 $39.90 Clary Sage 4 oz. O-L194-E $29.90 16 oz. M-263LB $99.90 1 oz. O-C001-E $29.90 Lime Thyme 4 oz. O-C004-E $75.90 1 oz. O-L281-E $15.90 1 oz. O-T331-E $23.90 Clementine 4 oz. O-L284-E $35.90 4 oz. O-T334-E $71.90 1 oz. O-C991-E $9.90 Litsea Cubeba Tumeric NEW 4 oz. O-C994-E $23.90 1 oz. O-L541-E $13.90 1 oz. O-T591-E $13.90 Clove 4 oz. O-L544-E $29.90 4 oz. O-T594-E $29.90 1 oz. O-C671-E $13.90 Mandarin Wintergreen 4 oz. O-C674-E $29.90 1 oz. O-M761-E $17.90 1 oz. O-W281-E $19.90 Coffee NEW 4 oz. O-M764-E $47.90 4 oz. O-W284-E $53.90 1 oz. O-C1011-E $35.90 Marjoram Ylang Ylang 4 oz. O-C1014-E $99.90 1 oz. O-M861-E $27.90 1 oz. O-Y161-E $29.90 4 oz. O-M864-E $69.90 4 oz. O-Y164-E $79.90 New possibilities 59 with essential oils

Lemongrass Deep Eczema/Psoriasis Moisturizing Healing & Cream – 4 oz. Soothing Butter M-E008 $9.90 – 4 oz. M-E007 $11.90 M-E012 M-E011 M-E017 &RQ¿GHQFH6SUD\ Diet Control Spray 2 oz. M-E010 $9.90 2 oz. M-E015 $9.90 Anti-aging & More Happiness Spray Mood Booster M-E011 $9.90 Spray 2 oz. M-E016 $9.90 Mosquito Repellent Spray Sweet Dreams 2 oz. M-E012 $9.90 Spray - 2 oz. 2 oz. M-E017 $9.90 Stress Relief Spray 2 oz. M-E004 $9.90 Sore Muscle Freeze 9 oz. M-E018 $19.90 Mental Clarity Spray Lavender Mandarin 2 oz. M-E005 $9.90 Age Defense Anti-Wrinkle Cream Moisturizer 1.5 oz. M-E002 Aphrodisiac Spray 1.5 oz. M-E001 $15.90 $11.90 2 oz. M-E006 $9.90 $15.90 $11.90

Essential Oil Blends - 1 oz. Mental Clarity Sensuality For Him H-043-1 $9.90 H-047-1 $9.90 Breathe Easy Cold Combat H-044-1 $9.90 H-048-1 $9.90 Immune Booster Breathe Clearly H-045-1 $9.90 H-049-1 $9.90 Stress Relief Cold Season H-050-1 $9.90 Jamaican Black Argan Oil Hair H-040-1 $9.90 Castor Oil Shimmer Serum Sleep Soundly Headache Away & Shine Hair Serum 2 oz. M-E013 $11.90 H-041-1 $9.90 H-051-1 $9.90 2 oz. M-E009 $13.90 Arthritis & Joint Oil Pick-Me-Up Energy 2 oz. M-E014 $11.90 H-042-1 $9.90 Sensuality For Her H-046-1 $9.90 60 Body Mists

• Baby Powder • Kush • Barack Obama • Lavender • Black Man • Michelle Obama Set of 12 of 4 oz. Body Mists • Black Woman • Pink Sugar Surround your senses with the light, sweet • Cool Water • Pleasures fragrances of body mists. M-270 $39.00 • Egyptian Musk • Jamaican Fruit

New essential oil set

Set Of 10 Essential Oils In Hard Case Get a Set of 10 Essential Oils in a hard zippered case. Easy and FRQYHQLHQW(DFKERWWOHLVѿR] with Euro dropper and cap. Case LV´[´O-SE10Ess $45.00

Essential oils in set: • Frankincense • Eucalyptus • Lavender • Lemon • Lemongrass • Myrrh • Patchouli • Peppermint • Rosemary • Tea Tree

Case may be black or purple Incense 61

For your moods, feelings, Incense helps you to feel good, connect with yourself; practice more VHOIFDUHDQGFRPSDVVLRQDQGH[SHULHQFHPRUHRIZKDWOLIHKDVWRRIIHU,QFHQVHKHOSV\RX UHPHPEHUWKHSDVW

Set of 12 Incense Set of Six Classic Bundles Incense Bundles Have the scent for any M-890 $19.90 occasion and save money Set of Six Favorite with 12 complete bundles Incense Bundles of 11 inches incense sticks! M-880 $19.90 M-900 $39.78 Exotic Incense Bundles (DFKEXQGOHLVDSSUR[LPDWHO\VWLFNV0DGHLQWKH86$$3.98 each bundle. Best Sellers • Jasmine M-865 • Egyptian Vanilla M-894 • Frank & Myrrh M-873 • Rain M-866 • Jamaican Fruit M-884 • Egyptian Musk M-893 • Eat It Raw M-851 • Lavender M-874 • Frankincense M-883 • Lick Me All Over M-852 • Patchouli M-885 • Kush M-895 • Mango Butter M-853 • Patti LaBelle M-875 • Barack Obama M-881 • Pink Sugar M-854 • Sandalwood M-886 • Rastafarian M-882 • Rose M-855 • 6H[RQWKH%HDFK0 • Strawberry M-856 • White Diamonds M-876 • Black Coconut M-861 • African Musk M-891 • Blue Nile M-862 • Baby Powder M-871 • Coco Mango M-863 • Cherry M-892 • Honey Vanilla M-864 • China Musk M-872

Nag Champa Incense Set Of 12 Curved Wood Incense Burners VOHHYHVSHUER[VWLFNVSHUVOHHYH Incense not included. M-924 $13.90 sticks total. Made in India. M-932 $27.90/box 62 Pure Raw Shea Butter Quell Dryness and Aging with Intense Moisture

Shea Butter Protects Your Skin Now And Keeps You Youthful Later

12 oz. Pre-Packed Raw 28 oz. Shea Butter 7 oz.

White

Yellow

Packed and Labeled Bulk Shea Butter 7 oz. M-185 $9.90 $7.90 This shea butter is sold by volume instead of by weight. 12 oz. M-186 $15.90 $13.90 This shea butter has been melted and poured into the 28 oz. M-187 $27.90 $23.90 containers. Specify your color choice when you order.

Shea Butter Kit Kit includes: • Shea Butter Soap • Creamy Shea Butter • Shea Butter 4 oz. • Pure Filtered Shea Butter • Amonche Shea Butter Cream The most powerful skin healer on earth. The fastest selling shea butter products. M-P249 $31.58 $27.58 25% savings! Purchase separately for $39.58. Fragrances: Yellow 63 • Unscented #1 (White or Yellow) • Fruit • Floral

#2 White Shea Butter By the Pound Save $8. per lb. when you order shea butter in bulk in bags. The color of shea butter varies depending on how long it is boiled, but both white and yellow are basically the same in effectiveness. 1 lb. bag M-183 $15.90 $9.90 White 25 lbs. M-176 $219.50 $179.90 Shea Butter Yellow 25 lbs. M-177 $219.50 $179.90 4 oz. Jar M-182 $7.90 $5.90 each

Whipped Shea Butter! Yellow Yellow Yellow

Shelf life of 18-24 months.

White

5 oz. 9 oz. 20 oz. White White M-216 $11.90 M-217 $19.90 M-218 $35.90 (8 oz. container) (16 oz. container) (32 oz. container) Creamy Shea Butter! Yellow Yellow For the easiest way Yellow to sell! Simply unpack WKHER[DQGSXWRQ the shelves. This shea butter has been melted and poured into the containers. Specify white or yellow when you place your order.

White White White 7 oz. 14 oz. 25 oz. Yellow M-178 $9.90 M-179 $15.90 M-219 $27.90 White M-172 $9.90 M-173 $15.90 M-174 $27.90 Best Sellers #1 Most Popular Choose any size

Dudu-Osun Black Soap Pure African Shea Butter Hand-Crafted Natural Black 5.25 oz. M-S501 $3.98 Yellow or white. 7 oz. Soap M-185 $9.90 $7.90 M-S520 Price based on size Over 800 fragrance oils! Pages 50-57 30 New Oils! O-A82 Ariana Grande: Ari (W) Type O-A83 Auric: Egyptian Goddess (W) Type O-B49 Barack Obama: Renegade (M) Type O-B53 Byredo: Seven Veils (U) Type O-C102 Cartier: La Panthere (W) Type O-C103 Chanel: Coco Mademoiselle Intense (W) Type O-C104 Coconut Milk O-D65 Diana Ross: Diamond Diana (W) Type O-D64 Dior: Sauvage Eau De Parfum (M) O-E66 Egyptian Musk: Gold O-E67 Estee Lauder: Youth Dew (W) Type O-G66 Goutal: Eau D Hadrien (W) Type O-I38 Iceberg (M) Type O-I39 Iced Pineapple O-J71 Jamaican Love O-J72 JPG: Gaultier 2 (U) Type O-M18 Marc Jacobs: Orange Splash (W) Type O-N31 Narciso Rodriguez (W) Type O-P32 Perry Ellis: 360 Red (M) Type O-P28 Philosophy: Amazing Grace (W) O-P33 Philosophy: Celebrate Grace (W) Type O-P31 Philosophy: Eternal Grace (W) Type O-P34 Polo: Ultra Blue (M) Type O-R58 Roja Dove: Aoud (U) Type O-T57 Tom Ford: Oud Minerale (U) Type O-T58 Tom Ford: Soleil Blanc (M) Type O-V68 Victoria Secret: Yellow Diamond (W) Type O-V67 Viktor & Rolf: Bonbon (W) Type O-Y21 Ylang & Myrrh O-Y22 YSL: L’Homme Blue (M) Type