Rabbit Anti-Human KCNA3 Polyclonal antibody (DPABH-02569) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Immunogen Kv1.3 fusion , sequence: MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLE PEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFP ETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEE AMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY (N-term-226aa encoded by BC035059)

Isotype IgG

Source/Host Rabbit

Species Reactivity Human, Mouse, Rat

Purification Antigen affinity purification

Conjugate Unconjugated

Applications WB, ELISA

Positive Control A549 cells, mouse thymus tissue

Format Liquid

Size 50 uL; 100 uL

Buffer PBS with 0.1% sodium azide and 50% glycerol pH 7.3.

Preservative 0.1% Sodium Azide

Storage Store at -20°C. Aliquoting is unnecessary for -20°C storage.

BACKGROUND

Introduction Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related - ,

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker- type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on 1.

Keywords KCNA3; potassium channel, voltage gated shaker related subfamily A, member 3; MK3; HGK5; HLK3; PCN3; HPCN3; KV1.3; HUKIII; potassium voltage-gated channel subfamily A member 3; potassium channel 3; type n potassium channel; voltage-gated K(+) channel HuKIII; voltage- gated potassium channel protein Kv1.3; voltage-gated potassium channel subunit Kv1.3; potassium voltage-gated channel, shaker-related subfamily, member 3;

GENE INFORMATION

Entrez Gene ID 3738

UniProt ID P22001

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved