SU5416 Does Not Attenuate Early RV Angiogenesis in the Murine Chronic Hypoxia PH Model Grace L
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Type of the Paper (Article
Table S1. Gene expression of pro-angiogenic factors in tumor lymph nodes of Ibtk+/+Eµ-myc and Ibtk+/-Eµ-myc mice. Fold p- Symbol Gene change value 0,007 Akt1 Thymoma viral proto-oncogene 1 1,8967 061 0,929 Ang Angiogenin, ribonuclease, RNase A family, 5 1,1159 481 0,000 Angpt1 Angiopoietin 1 4,3916 117 0,461 Angpt2 Angiopoietin 2 0,7478 625 0,258 Anpep Alanyl (membrane) aminopeptidase 1,1015 737 0,000 Bai1 Brain-specific angiogenesis inhibitor 1 4,0927 202 0,001 Ccl11 Chemokine (C-C motif) ligand 11 3,1381 149 0,000 Ccl2 Chemokine (C-C motif) ligand 2 2,8407 298 0,000 Cdh5 Cadherin 5 2,5849 744 0,000 Col18a1 Collagen, type XVIII, alpha 1 3,8568 388 0,003 Col4a3 Collagen, type IV, alpha 3 2,9031 327 0,000 Csf3 Colony stimulating factor 3 (granulocyte) 4,3332 258 0,693 Ctgf Connective tissue growth factor 1,0195 88 0,000 Cxcl1 Chemokine (C-X-C motif) ligand 1 2,67 21 0,067 Cxcl2 Chemokine (C-X-C motif) ligand 2 0,7507 631 0,000 Cxcl5 Chemokine (C-X-C motif) ligand 5 3,921 328 0,000 Edn1 Endothelin 1 3,9931 042 0,001 Efna1 Ephrin A1 1,6449 601 0,002 Efnb2 Ephrin B2 2,8858 042 0,000 Egf Epidermal growth factor 1,726 51 0,000 Eng Endoglin 0,2309 467 0,000 Epas1 Endothelial PAS domain protein 1 2,8421 764 0,000 Ephb4 Eph receptor B4 3,6334 035 V-erb-b2 erythroblastic leukemia viral oncogene homolog 2, 0,000 Erbb2 3,9377 neuro/glioblastoma derived oncogene homolog (avian) 024 0,000 F2 Coagulation factor II 3,8295 239 1 0,000 F3 Coagulation factor III 4,4195 293 0,002 Fgf1 Fibroblast growth factor 1 2,8198 748 0,000 Fgf2 Fibroblast growth factor -
Eph Receptor B4 (EPHB4) Rabbit Polyclonal Antibody Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AP14301PU-N Eph receptor B4 (EPHB4) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: IHC, WB Recommended Dilution: ELISA: 1/1,000. Western blotting: 1/50 - 1/100. Immunohistochemistry: 1/10 - 1/50. Reactivity: Human Host: Rabbit Isotype: Ig Clonality: Polyclonal Immunogen: This antibody is generated from rabbits immunized with human recombinant EphB4 protein. Specificity: This antibody reacts to EphB4. Formulation: PBS with 0.09% (W/V) sodium azide State: Purified State: Liquid purified Ig Concentration: lot specific Purification: Prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by dialysis against PBS Conjugation: Unconjugated Storage: Store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. Stability: Shelf life: one year from despatch. Gene Name: EPH receptor B4 Database Link: Entrez Gene 2050 Human P54760 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 Eph receptor B4 (EPHB4) Rabbit Polyclonal Antibody – AP14301PU-N Background: Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. -
Supplementary Table 1. in Vitro Side Effect Profiling Study for LDN/OSU-0212320. Neurotransmitter Related Steroids
Supplementary Table 1. In vitro side effect profiling study for LDN/OSU-0212320. Percent Inhibition Receptor 10 µM Neurotransmitter Related Adenosine, Non-selective 7.29% Adrenergic, Alpha 1, Non-selective 24.98% Adrenergic, Alpha 2, Non-selective 27.18% Adrenergic, Beta, Non-selective -20.94% Dopamine Transporter 8.69% Dopamine, D1 (h) 8.48% Dopamine, D2s (h) 4.06% GABA A, Agonist Site -16.15% GABA A, BDZ, alpha 1 site 12.73% GABA-B 13.60% Glutamate, AMPA Site (Ionotropic) 12.06% Glutamate, Kainate Site (Ionotropic) -1.03% Glutamate, NMDA Agonist Site (Ionotropic) 0.12% Glutamate, NMDA, Glycine (Stry-insens Site) 9.84% (Ionotropic) Glycine, Strychnine-sensitive 0.99% Histamine, H1 -5.54% Histamine, H2 16.54% Histamine, H3 4.80% Melatonin, Non-selective -5.54% Muscarinic, M1 (hr) -1.88% Muscarinic, M2 (h) 0.82% Muscarinic, Non-selective, Central 29.04% Muscarinic, Non-selective, Peripheral 0.29% Nicotinic, Neuronal (-BnTx insensitive) 7.85% Norepinephrine Transporter 2.87% Opioid, Non-selective -0.09% Opioid, Orphanin, ORL1 (h) 11.55% Serotonin Transporter -3.02% Serotonin, Non-selective 26.33% Sigma, Non-Selective 10.19% Steroids Estrogen 11.16% 1 Percent Inhibition Receptor 10 µM Testosterone (cytosolic) (h) 12.50% Ion Channels Calcium Channel, Type L (Dihydropyridine Site) 43.18% Calcium Channel, Type N 4.15% Potassium Channel, ATP-Sensitive -4.05% Potassium Channel, Ca2+ Act., VI 17.80% Potassium Channel, I(Kr) (hERG) (h) -6.44% Sodium, Site 2 -0.39% Second Messengers Nitric Oxide, NOS (Neuronal-Binding) -17.09% Prostaglandins Leukotriene, -
Eph Receptor B4 (EPHB4) (NM 004444) Human Mass Spec Standard Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH308559 Eph receptor B4 (EPHB4) (NM_004444) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: EPHB4 MS Standard C13 and N15-labeled recombinant protein (NP_004435) Species: Human Expression Host: HEK293 Expression cDNA Clone RC208559 or AA Sequence: Predicted MW: 108.27 kDa Protein Sequence: >RC208559 representing NM_004444 Red=Cloning site Green=Tags(s) MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQA HWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDT VAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPET VPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLS GEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESG GREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN RAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAV LCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVC RGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGA LDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSS DPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGT -
Original Article a RTK-Based Functional Rnai Screen Reveals Determinants of PTX-3 Expression
Int J Clin Exp Pathol 2013;6(4):660-668 www.ijcep.com /ISSN:1936-2625/IJCEP1301062 Original Article A RTK-based functional RNAi screen reveals determinants of PTX-3 expression Hua Liu*, Xin-Kai Qu*, Fang Yuan, Min Zhang, Wei-Yi Fang Department of Cardiology, Shanghai Chest Hospital affiliated to Shanghai JiaoTong University, Shanghai, China. *These authors contributed equally to this work. Received January 30, 2013; Accepted February 15, 2013; Epub March 15, 2013; Published April 1, 2013 Abstract: Aim: The aim of the present study was to explore the role of receptor tyrosine kinases (RTKs) in the regu- lation of expression of PTX-3, a protector in atherosclerosis. Methods: Human monocytic U937 cells were infected with a shRNA lentiviral vector library targeting human RTKs upon LPS stimuli and PTX-3 expression was determined by ELISA analysis. The involvement of downstream signaling in the regulation of PTX-3 expression was analyzed by both Western blotting and ELISA assay. Results: We found that knocking down of ERBB2/3, EPHA7, FGFR3 and RET impaired PTX-3 expression without effects on cell growth or viability. Moreover, inhibition of AKT, the downstream effector of ERBB2/3, also reduced PTX-3 expression. Furthermore, we showed that FGFR3 inhibition by anti-cancer drugs attenuated p38 activity, in turn induced a reduction of PTX-3 expression. Conclusion: Altogether, our study demonstrates the role of RTKs in the regulation of PTX-3 expression and uncovers a potential cardiotoxicity effect of RTK inhibitor treatments in cancer patients who have symptoms of atherosclerosis or are at the risk of athero- sclerosis. -
Kinome Expression Profiling to Target New Therapeutic Avenues in Multiple Myeloma
Plasma Cell DIsorders SUPPLEMENTARY APPENDIX Kinome expression profiling to target new therapeutic avenues in multiple myeloma Hugues de Boussac, 1 Angélique Bruyer, 1 Michel Jourdan, 1 Anke Maes, 2 Nicolas Robert, 3 Claire Gourzones, 1 Laure Vincent, 4 Anja Seckinger, 5,6 Guillaume Cartron, 4,7,8 Dirk Hose, 5,6 Elke De Bruyne, 2 Alboukadel Kassambara, 1 Philippe Pasero 1 and Jérôme Moreaux 1,3,8 1IGH, CNRS, Université de Montpellier, Montpellier, France; 2Department of Hematology and Immunology, Myeloma Center Brussels, Vrije Universiteit Brussel, Brussels, Belgium; 3CHU Montpellier, Laboratory for Monitoring Innovative Therapies, Department of Biologi - cal Hematology, Montpellier, France; 4CHU Montpellier, Department of Clinical Hematology, Montpellier, France; 5Medizinische Klinik und Poliklinik V, Universitätsklinikum Heidelberg, Heidelberg, Germany; 6Nationales Centrum für Tumorerkrankungen, Heidelberg , Ger - many; 7Université de Montpellier, UMR CNRS 5235, Montpellier, France and 8 Université de Montpellier, UFR de Médecine, Montpel - lier, France ©2020 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol. 2018.208306 Received: October 5, 2018. Accepted: July 5, 2019. Pre-published: July 9, 2019. Correspondence: JEROME MOREAUX - [email protected] Supplementary experiment procedures Kinome Index A list of 661 genes of kinases or kinases related have been extracted from literature9, and challenged in the HM cohort for OS prognostic values The prognostic value of each of the genes was computed using maximally selected rank test from R package MaxStat. After Benjamini Hochberg multiple testing correction a list of 104 significant prognostic genes has been extracted. This second list has then been challenged for similar prognosis value in the UAMS-TT2 validation cohort. -
An Advanced Refractory Breast Cancer Patient with Human Epidermal Growth Factor Receptor 2 Discordance: a Case Report
7 Case Report Page 1 of 7 An advanced refractory breast cancer patient with human epidermal growth factor receptor 2 discordance: a case report Yijia Hua1#, Chunxiao Sun1#, Fan Yang1#, Yiqi Yang1, Shengnan Bao1, Xueqi Yan1, Tianyu Zeng1, Wei Li1, Yongmei Yin1,2 1Department of Oncology, The First Affiliated Hospital of Nanjing Medical University, Nanjing, China; 2Jiangsu Key Lab of Cancer Biomarkers, Prevention and Treatment, Collaborative Innovation Center for Personalized Cancer Medicine, Nanjing Medical University, Nanjing, China #These authors equally contributed to this work. Correspondence to: Yongmei Yin; Wei Li. The First Affiliated Hospital of Nanjing Medical University, 300 Guangzhou Road, Nanjing 210029, China. Email: [email protected]; [email protected]. Abstract: Breast cancer is heterogeneous at the molecular level, and receptor discordance has frequently been observed in breast cancer patients during treatment. Patients with human epidermal growth factor receptor 2 (HER2) discordance are reported to have poor survival, but guidelines for the treatment of these patients are still being explored. In this case report, we will share our experience in treating a hormone receptor-positive breast cancer patient with HER2 discordance. This patient was first diagnosed as Luminal B-like HER2+, and had previously undergone several lines of anti-HER2 therapy with limited effectiveness. Pathological reassessment of the patient’s later metastasis showed Luminal B-like HER2–. Next-generation sequencing (NGS) testing was performed on the patient’s surgical samples, and she was prescribed a therapy consisting of palbociclib and exemestane in December, 2018. This patient was subsequently followed up and her progression-free survival (PFS) has reached 16 months. -
High Throughput Kinase Discovery, Inhibitor Screening and Specificity Analysis Using Multi-Array Technology
High Throughput Kinase Discovery, Inhibitor Screening and Specificity Analysis using Multi-Array Technology Nisar Pampori, Pankaj Oberoi, Ryan Swenerton, Ilia Davydov, Stefanie Nelson, Hans A. Biebuyck, John H. Kenten, and Jacob N. Wohlstadter TM TM A division of Meso Scale DiagnosticsTM, LLC. High Throughput Kinase Discovery, Inhibitor Screening and Specificity Analysis using Multi-Array Technology Abstract We developed a high-throughput system for biological discovery and compound screening. A systematic and deterministic approach allowed us to categorize and quantify functional aspects of our library of 22,000 mammalian proteins (based on Unigene) coded by 50,000 individual full- length cDNA clones. Our methodology combined MSD's proprietary Multi-ArrayTM detection technology with high-throughput cell-free production, labeling, immobilization and purification of proteins. Here we report on several approaches we used to identify and characterize proteins with tyrosine kinase activity. First, we screened a set of 20,000 clones (14,000 unique Unigenes) for proteins with tyrosine kinase activity using a screening assay that simultaneously measured auto- phosphorylation and phosphorylation of a consensus tyrosine kinase substrate. The screen recovered known tyrosine kinases, previously unidentified kinases and, under low stringency conditions, proteins that recruited kinases. Second, we selected a redacted set of clones on the basis of homology to known kinases and demonstrated that we could identify ~ 70% of the expected tyrosine kinases in this redacted set. Third, we used MSD Multi-Array technology to test, in parallel, the specificity of 21 of these well-characterized kinases for a panel of known kinase inhibitors. Finally, we carried out a focused screen of 2,000 compounds for inhibitors of two of the identified kinases. -
EPHB4 Kinase–Inactivating Mutations Cause Autosomal Dominant Lymphatic-Related Hydrops Fetalis
EPHB4 kinase–inactivating mutations cause autosomal dominant lymphatic-related hydrops fetalis Silvia Martin-Almedina, … , Taija Makinen, Pia Ostergaard J Clin Invest. 2016;126(8):3080-3088. https://doi.org/10.1172/JCI85794. Research Article Genetics Hydrops fetalis describes fluid accumulation in at least 2 fetal compartments, including abdominal cavities, pleura, and pericardium, or in body tissue. The majority of hydrops fetalis cases are nonimmune conditions that present with generalized edema of the fetus, and approximately 15% of these nonimmune cases result from a lymphatic abnormality. Here, we have identified an autosomal dominant, inherited form of lymphatic-related (nonimmune) hydrops fetalis (LRHF). Independent exome sequencing projects on 2 families with a history of in utero and neonatal deaths associated with nonimmune hydrops fetalis uncovered 2 heterozygous missense variants in the gene encoding Eph receptor B4 (EPHB4). Biochemical analysis determined that the mutant EPHB4 proteins are devoid of tyrosine kinase activity, indicating that loss of EPHB4 signaling contributes to LRHF pathogenesis. Further, inactivation of Ephb4 in lymphatic endothelial cells of developing mouse embryos led to defective lymphovenous valve formation and consequent subcutaneous edema. Together, these findings identify EPHB4 as a critical regulator of early lymphatic vascular development and demonstrate that mutations in the gene can cause an autosomal dominant form of LRHF that is associated with a high mortality rate. Find the latest version: https://jci.me/85794/pdf RESEARCH ARTICLE The Journal of Clinical Investigation EPHB4 kinase–inactivating mutations cause autosomal dominant lymphatic-related hydrops fetalis Silvia Martin-Almedina,1 Ines Martinez-Corral,2 Rita Holdhus,3 Andres Vicente,4 Elisavet Fotiou,1 Shin Lin,5,6 Kjell Petersen,7 Michael A. -
Tyrosine Phosphoproteomics of Patient-Derived Xenografts Reveals Ephrin Type-B Receptor 4 Tyrosine Kinase As a Therapeutic Target in Pancreatic Cancer
cancers Article Tyrosine Phosphoproteomics of Patient-Derived Xenografts Reveals Ephrin Type-B Receptor 4 Tyrosine Kinase as a Therapeutic Target in Pancreatic Cancer Santosh Renuse 1,2 , Vijay S. Madamsetty 3 , Dong-Gi Mun 1, Anil K. Madugundu 1,4,5, Smrita Singh 1,4,5 , Savita Udainiya 1,6, Kiran K. Mangalaparthi 1,4,7, Min-Sik Kim 8,9, Ren Liu 10, S. Ram Kumar 11, Valery Krasnoperov 12, Mark Truty 13, Rondell P. Graham 1, Parkash S. Gill 10, Debabrata Mukhopadhyay 3,* and Akhilesh Pandey 1,2,5,6,* 1 Department of Laboratory Medicine and Pathology, Mayo Clinic, Rochester, MN 55905, USA; [email protected] (S.R.); [email protected] (D.-G.M.); [email protected] (A.K.M.); [email protected] (S.S.); [email protected] (S.U.); [email protected] (K.K.M.); [email protected] (R.P.G.) 2 Center for Individualized Medicine, Mayo Clinic, Rochester, MN 55905, USA 3 Department of Biochemistry and Molecular Biology, Mayo Clinic College of Medicine and Science, Jacksonville, FL 32224, USA; [email protected] 4 Institute of Bioinformatics, International Technology Park, Bangalore 560066, Karnataka, India 5 Manipal Academy of Higher Education (MAHE), Manipal 576104, Karnataka, India Citation: Renuse, S.; Madamsetty, 6 Center for Molecular Medicine, NIMHANS, Bangalore 560027, Karnataka, India 7 V.S.; Mun, D.-G.; Madugundu, A.K.; Amrita School of Biotechnology, Amrita Vishwa Vidyapeetham University, Kollam 69025, Kerala, India 8 Singh, S.; Udainiya, S.; McKusick-Nathans Institute of Genetic Medicine, Johns Hopkins University School of Medicine, Mangalaparthi, K.K.; Kim, M.-S.; Liu, Baltimore, MD 21205, USA; [email protected] 9 Department of Biological Chemistry, Johns Hopkins University School of Medicine, R.; Kumar, S.R.; et al. -
Probe Set ID Gene Symbol Gene Name Refseq Transcript ID Chrom . Loc. 1007 S at DDR1 Discoidin Domain Receptor Family, Member
Supplementary Table 2 : List of the 435 kinases well characterized on the Affymetrix's GeneChip U133 Plus 2.0 from the kinome list of Manning et al. Probe Set ID Gene Symbol Gene Name RefSeq Transcript ID Chrom . Loc. 1007_s_at DDR1 discoidin domain receptor family, member 1 NM_001954 6p21.3 1552395_at TSSK3 testis-specific serine kinase 3 NM_052841 1p35-p34 1552504_a_at BRSK1 BR serine/threonine kinase 1 NM_032430 19q13.4 1552519_at ACVR1C activin A receptor, type IC NM_145259 2q24.1 1552578_a_at MYO3B myosin IIIB NM_138995 2q31.1-q31.2 1553114_a_at PTK6 PTK6 protein tyrosine kinase 6 NM_005975 20q13.3 1554112_a_at ULK2 unc-51-like kinase 2 (C. elegans) NM_014683 17p11.2 1555310_a_at PAK6 p21(CDKN1A)-activated kinase 6 NM_020168 15q14 1555935_s_at HUNK hormonally upregulated Neu-associated kinase NM_014586 21q22.1 1556043_a_at TTN Titin NM_003319 2q31 1556340_at MAPK12 Mitogen-activated protein kinase 12 NM_002969 22q13.33 1557073_s_at TTBK2 Tau tubulin kinase 2 NM_173500 15q15.2 1557103_a_at LMTK3 lemur tyrosine kinase 3 XM_055866 19q13.32 1557170_at NEK8 NIMA (never in mitosis gene a)- related kinase 8 NM_178170 17q11.1 1557316_at STK24 Serine/threonine kinase 24 (STE20 homolog, yeast) NM_001032296 13q31.2-q32.3 1557675_at RAF1 V-raf-1 murine leukemia viral oncogene homolog 1 NM_002880 3p25 1558556_at CAMK1 Calcium/calmodulin-dependent protein kinase I NM_003656 3p25.3 1559394_a_at ROR1 Receptor tyrosine kinase-like orphan receptor 1 NM_005012 1p32-p31 1561190_at CDKL3 cyclin-dependent kinase-like 3 NM_016508 5q31 1562031_at JAK2 Janus -
Comparative Analysis of Human and Bovine Protein Kinases Reveals Unique Relationship and Functional Diversity
Genetics and Molecular Biology, 34, 4, 587-591 (2011) Copyright © 2011, Sociedade Brasileira de Genética. Printed in Brazil www.sbg.org.br Short Communication Comparative analysis of human and bovine protein kinases reveals unique relationship and functional diversity Nuzhat N. Kabir1 and Julhash U. Kazi1,2* 1Laboratory of Computational Biochemistry, KN Biomedical Research Institute, Bagura Road, Barisal, Bangladesh. 2Quality Control Section, Opsonin Pharma Limited, Bagura Road, Barisal, Bangladesh. Abstract Reversible protein phosphorylation by protein kinases and phosphatases is a common event in various cellular pro- cesses. The eukaryotic protein kinase superfamily, which is one of the largest superfamilies of eukaryotic proteins, plays several roles in cell signaling and diseases. We identified 482 eukaryotic protein kinases and 39 atypical pro- tein kinases in the bovine genome, by searching publicly accessible genetic-sequence databases. Bovines have 512 putative protein kinases, each orthologous to a human kinase. Whereas orthologous kinase pairs are, on an aver- age, 90.6% identical, orthologous kinase catalytic domain pairs are, on an average, 95.9% identical at the amino acid level. This bioinformatic study of bovine protein kinases provides a suitable framework for further characterization of their functional and structural properties. Key words: ePK, kinome, aPK, bovine. Received: September 25, 2010; Accepted: June 1, 2011. The protein kinase family is one of the largest fami- The sequencing of several vertebrate genomes has lies of proteins. Protein kinases play important roles in been completed. Initial estimates of the number of protein many intracellular or intercellular signaling pathways, re- kinases in the human genome place this at around 1000 sulting in cell proliferation, gene expression, metabolism, (Hunter, 1987), with later studies identifying 518 putative motility, membrane transport, apoptosis and differentia- protein kinases (Manning et al., 2002b).