DOCSLIB.ORG

Design and Recombination Expression of a Novel Plectasin-Derived Peptide MP1106 and Its Properties Against Staphylococcus Aureus

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Design and Recombination Expression of a Novel Plectasin-Derived Peptide MP1106 and Its Properties Against Staphylococcus Aureus Appl Microbiol Biotechnol DOI 10.1007/s00253-014-6077-9 BIOTECHNOLOGICALLY RELEVANT ENZYMES AND PROTEINS Design and recombination expression of a novel plectasin-derived peptide MP1106 and its properties against Staphylococcus aureus Xintao Cao & Yong Zhang & Ruoyu Mao & Da Teng & Xiumin Wang & Jianhua Wang Received: 4 August 2014 /Revised: 5 September 2014 /Accepted: 7 September 2014 # Springer-Verlag Berlin Heidelberg 2014 Abstract A novel antimicrobial peptide MP1106 was de- hemolytic activity of only 1.16 % at a concentration of signed based on the parental peptide plectasin with four mu- 512 μg/ml and remained stable in human serum at 37 °C for tational sites and a high level of expression in Pichia pastoris 24 h. Furthermore, the activity of rMP1106 was minorly X-33 via the pPICZαA plasmid was achieved. The concen- affected by 10 mM dithiothreitol and 20 % dimethylsulfoxide. tration of total secreted protein in the fermented supernatant Our results indicate that MP1106 can be produced on a large was 2.134 g/l (29 °C), and the concentration of recombinant scale and has potential as a therapeutic drug against S. aureus. MP1106 (rMP1106) reached 1,808 mg/l after a 120-h induc- tion in a 5-l fermentor. The rMP1106 was purified using a Keywords MP1106 . Antimicrobial peptide . Pichia cation-exchange column, and the yield was 831 mg/l with pastoris . Stability . Staphylococcus aureus 94.68 % purity. The sample exhibited a narrow spectrum against some Gram-positive bacteria and strong antimicrobial activity against Staphylococcus aureus at low minimal inhib- Introduction itory concentrations (MICs) of 0.014, 1.8, 0.45, and 0.91 μM to S. aureus strains ATCC 25923, 29213, 6538, and 43300, The overuse of antibiotics has led to the emergence of respectively. Meanwhile, rMP1106 showed potent activity antibiotic-resistant pathogenic bacteria that has become a huge (0.03–1.8 μM) against 20 clinical isolates of methicillin- threat to public health. Many types of Staphylococcus aureus resistant S. aureus (MRSA). In addition, rMP1106 exhibited cause cutaneous and soft tissue infections (Miller and Cho a broad range of thermostability from 20 to 100 °C. The higher 2011). However, treating these infections is difficult because antimicrobial activity of rMP1106 was maintained in neutral of the emergence of multidrug-resistant strains (Lowy 1998). and alkaline environments (pH 6, 8, and 10), and its activity Methicillin was introduced into clinical use in 1960, and the was slightly reduced in acidic environments (pH 2 and 4). The first observations of methicillin-resistant S. aureus (MRSA) rMP1106 was resistant to the digestion of pepsin, snailase, and were reported in 1961 (Woodford and Livermore 2009). In proteinase K and was sensitive to trypsin. It exhibited recent years, infections caused by MRSA were detected in hospitals (hospital-acquired MRSA (HA-MRSA)), communi- Xintao Cao, Yong Zhang, and Ruoyu Mao contributed equally to this ties (community-acquired MRSA (CA-MRSA)), and live- paper. stock (livestock-acquired MRSA (LA-MRSA)) in a range of X. Cao : Y. Zhang : R. Mao : D. Teng : X. Wang : J. Wang animal species (Chambers and Deleo 2009;Kocketal.2011). Key Laboratory of Feed Biotechnology, Ministry of Agriculture, In addition, the CC398 strain of LA-MRSA, originally found Beijing 100081, China in pigs and cattle, was surprisingly detected in humans in 2003 : : : : : * (Graveland et al. 2011; van Cleef et al. 2011). Moreover, X. Cao Y. Zhang R. Mao D. Teng X. Wang J. Wang ( ) β Gene Engineering Laboratory, Feed Research Institute, Chinese MRSA strains are resistant to all members of the -lactam Academy of Agricultural Sciences, 12 Zhongguancun Nandajie St., class of antibiotics, including all penicillins, cephalosporins, Haidian District, Beijing 100081, People’sRepublicofChina and carbapenems, because they can produce penicillin- e-mail: [email protected] binding proteins (PBPs), known as PBP2 or PBP2a, that have β J. Wang low affinity to most -lactams and therefore confer resistance e-mail: [email protected] (Stefani et al. 2012; Woodford and Livermore 2009). Appl Microbiol Biotechnol Therefore, an urgent need exists for discovering and develop- Peptide design ing new antimicrobial drugs to control widespread MRSA. Antimicrobial peptides (AMPs) are potent pharmaceuticals The main structure of plectasin (α-helix from residues known for their rapid and broad-spectrum antimicrobial prop- 12–20 and β-sheets in residues 27–31 and 36–40) was erties, particularly those against antibiotic-resistant bacteria not changed to maintain or improve its expression level (Brogden and Brogden 2011). Plectasin, the first fungal in P. pastoris. Additionally, the amino acids containing a defensin with therapeutic potential that was especially targeted positive net charge and hydrophobic groups were intro- against Gram-positive bacteria, was identified from the sapro- duced to increase the antimicrobial activity of plectasin. phytic ascomycete Pseudoplectania nigrella (Mygind et al. As a result, S, K, and H residues containing hydroxyls 2005). This compound kills the pathogens by directly binding and a positive net charge were used to replace the polar Lipid II, the essential precursor of the cell wall (Schneider amino acid residues of D and Q at positions 9, 11, and et al. 2010). Additionally, plectasin showed no cytotoxicity to 14. Additionally, I, which contains a larger hydrophobic eukaryotic cells, a low induction of interleukin-8 (IL-8) pro- side chain, was used to replace the V residue in position duction (Hara et al. 2008), and no specific antibody responses 36. The amino acid sequences and properties of the in mice (Brinch et al. 2009). It also can be easily produced by parent peptides and designed peptide were calculated by prokaryotic and eukaryotic expression systems (Mygind et al. bioinformatics programs, including Antimicrobial Peptide 2005;Rothanetal.2013;Yangetal.2011; Zhang et al. 2011). Calculator and Predictor (http://aps.unmc.edu/AP/ The minimal inhibitory concentrations (MICs) of plectasin prediction/prediction_main.php), ProtParam (ExPASy against Streptococcus pneumonia and Staphylococcus Proteomics Server: http://www.expasy.org/tools/ epidermidis were 0.063–8and4–32 μg/ml, respectively. protparam.html), and Pepstats (EMBOSS biology However, the MICs of plectasin to S. aureus were 4– software: http://www.ebi.ac.uk/Tools/emboss/pepinfo/). 128 μg/ml (Hara et al. 2008;Mygindetal.2005), suggesting The mean hydrophobicity and relative hydrophobic plectasin activity needed to be increased to be effective against moment were calculated online using CCS scale (http:// S. aureus. www.bbcm.univ.trieste.it/wtossi/HydroCalc/HydroMCalc. The development of AMPs is still hampered by their tox- html). All of the parameters are summarized in Table 1. icity to mammalian cells and the lack of a cost-effective means The spatial structure of MP1106 was calculated by of commercial-scale production (Brogden 2005; Findlay et al. SWISS-Model (http://swissmodel.expasy.org/workspace// 2010; Brogden and Brogden 2011). A variety of approaches index.php?func=modelling_simple1&userid= have been employed to improve antimicrobial activity and USERID&token=TOKEN). reduce undesirable cytotoxic effects through optimization of natural AMP sequences (Chen et al. 2005; Jiang et al. 2011; Construction of the expression vector pPICZαA-MP1106 Lee et al. 2014). In this study, a variant of plectasin named MP1106 was designed and expressed in Pichia pastoris A 120-bp codon-optimized gene sequence of MP1106 was (named rMP1106). Additionally, the bactericidal activity, he- designed using the Reverse Translate Tool (www.bio- molytic activity, and stability of purified rMP1106 were informatics.org/sms2/rev_trans.html) based on the evaluated. preferential codon usage of P. pastoris (www.kazusa.or.jp/ codon/) (Yang et al. 2011). The DNA fragment contained the XhoI restriction site, a P. pastoris Kex2 protease Materials and methods cleavage site, the codon-optimized MP1106 open reading frame (ORF), two stop codons, and the XbaI restriction site Strains, plasmids, and reagents and was synthesized by Sangon Biotech (Shanghai, China). The DNA fragment and pPICZαA vectors were digested with Escherichia coli DH5α (Invitrogen, Beijing, China), XhoI and XbaI, gel-purified, and ligated together with T4 P. pastoris X-33 (Invitrogen, Beijing, China), and pPICZαA DNA ligase. The recombinant plasmid pPICZαA-MP1106 vectors (Invitrogen, Beijing, China) were used for cloning and was transformed into E. coli DH5α, and positive cells were expression. All of the strains used in antimicrobial assays and selected on zeocin-containing LB plates (25 μg/ml) and were their sources are summarized in Table 2. Vancomycin and screened by colony PCR with the following two pairs of ampicillin were purchased from the China Institute of Veter- primers: inary Drug Control. DNA restriction enzymes and T4 DNA ligase were purchased from New England Biolabs (NEB, Primer 5′ AOX1: 5′-GACTGGTTCCAATTGACAAGC-3′ Beijing, China). The kits for plasmid extraction and DNA Primer 3′ AOX1: 5′-GCAAATGGCATTCTGACATCC-3′ purification were purchased from Tiangen (China). All other F1: 5′-CCGCTCGAGAAGAGAGGTTT-3′ chemical reagents used were of analytical grade. R1: 5′-GCTCTAGATTATTAGTAACAC-3′ Appl Microbiol Biotechnol Table 1 Sequences and key physicochemical parameters of Plectasin and MP1106 Peptides Sequence Mw pI GRAVYb μHrelc Charge Plectasin GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY 4,401.99 7.77 −0.695 0.82 +2.0 MP1106 GFGCNGPWSEKDMHCHNHCKSIKGYKGGYCAKGGFICKCYa
Load more

Recommended publications
  • The Heme Sensing Response Regulator Hssr in Staphylococcus Aureus
    Thomsen et al. BMC Microbiology 2010, 10:307 http://www.biomedcentral.com/1471-2180/10/307 RESEARCH ARTICLE Open Access The heme sensing response regulator HssR in Staphylococcus aureus but not the homologous RR23 in Listeria monocytogenes modulates susceptibility to the antimicrobial peptide plectasin Line E Thomsen1*, Caroline T Gottlieb2,5, Sanne Gottschalk1, Tim T Wodskou3, Hans-Henrik Kristensen4, Lone Gram2, Hanne Ingmer1 Abstract Background: Host defence peptides (HDPs), also known as antimicrobial peptides (AMPs), have emerged as potential new therapeutics and their antimicrobial spectrum covers a wide range of target organisms. However, the mode of action and the genetics behind the bacterial response to HDPs is incompletely understood and such knowledge is required to evaluate their potential as antimicrobial therapeutics. Plectasin is a recently discovered HDP active against Gram-positive bacteria with the human pathogen, Staphylococcus aureus (S. aureus) being highly susceptible and the food borne pathogen, Listeria monocytogenes (L. monocytogenes) being less sensitive. In the present study we aimed to use transposon mutagenesis to determine the genetic basis for S. aureus and L. monocytogenes susceptibility to plectasin. Results: In order to identify genes that provide susceptibility to plectasin we constructed bacterial transposon mutant libraries of S. aureus NCTC8325-4 and L. monocytogenes 4446 and screened for increased resistance to the peptide. No resistant mutants arose when L. monocytogenes was screened on plates containing 5 and 10 fold Minimal Inhibitory Concentration (MIC) of plectasin. However, in S. aureus, four mutants with insertion in the heme response regulator (hssR) were 2-4 fold more resistant to plectasin as compared to the wild type.
    [Show full text]
  • (Amps) and Their Delivery Strategies for Wound Infections
    Preprints (www.preprints.org) | NOT PEER-REVIEWED | Posted: 17 July 2020 doi:10.20944/preprints202007.0375.v1 Peer-reviewed version available at Pharmaceutics 2020, 12, 840; doi:10.3390/pharmaceutics12090840 1 Review 2 An Update on Antimicrobial Peptides (AMPs) and 3 Their Delivery Strategies for Wound Infections 4 Viorica Patrulea 1,2,*, Gerrit Borchard 1,2 and Olivier Jordan 1,2,* 5 1 University of Geneva, Institute of Pharmaceutical Sciences of Western Switzerland, 1 Rue Michel Servet, 6 1211 Geneva, Switzerland 7 2 University of Geneva, Section of Pharmaceutical Sciences, 1 Rue Michel Servet, 1211 Geneva, Switzerland 8 * Correspondence: [email protected]; Tel.: +41-22379-3323 (V.P.); [email protected]; Tel.: +41- 9 22379-6586 (O.J.) 10 11 Abstract: Bacterial infections occur when wound healing fails to reach the final stage of healing, 12 usually hindered by the presence of different pathogens. Different topical antimicrobial agents are 13 used to inhibit bacterial growth due to antibiotic failure in reaching the infected site accompanied 14 very often by an increased drug resistance and other side effects. In this review, we focus on 15 antimicrobial peptides (AMPs), especially those with a high potential of efficacy against multidrug- 16 resistant and biofilm-forming bacteria and fungi present in wound infections. Currently, different 17 AMPs undergo preclinical and clinical phase to combat infection-related diseases. AMP dendrimers 18 (AMPDs) have been mentioned as potent microbial agents. Various AMP delivery strategies, such as 19 polymers, scaffolds, films and wound dressings, organic and inorganic nanoparticles, to combat 20 infection and modulate the healing rate have been discussed as well.
    [Show full text]
  • Synergistic Interactions Between Antimicrobial Peptides Derived From
    Journal name: International Journal of Nanomedicine Article Designation: Original Research Year: 2017 Volume: 12 International Journal of Nanomedicine Dovepress Running head verso: Umerska et al Running head recto: Synergistic interactions between antimicrobial peptides open access to scientific and medical research DOI: http://dx.doi.org/10.2147/IJN.S139625 Open Access Full Text Article ORIGINAL RESEARCH Synergistic interactions between antimicrobial peptides derived from plectasin and lipid nanocapsules containing monolaurin as a cosurfactant against Staphylococcus aureus Anita Umerska1 Abstract: Development of effective antibacterial agents for the treatment of infections Viviane Cassisa2 caused by Gram-positive bacteria resistant to existing antibiotics, such as methicillin-resistant Guillaume Bastiat1 Staphylococcus aureus (MRSA), is an area of intensive research. In this work, the antibacterial Nada Matougui1 efficacy of two antimicrobial peptides derived from plectasin, AP114 and AP138, used alone and Hassan Nehme1 in combination with monolaurin-lipid nanocapsules (ML-LNCs) was evaluated. Several inter- Florence Manero3 esting findings emerged from the present study. First, ML-LNCs and both plectasin derivatives showed potent activity against all 14 tested strains of S. aureus, independent of their resistance Matthieu Eveillard4 phenotype. Both peptides displayed a considerable adsorption (33%–62%) onto ML-LNCs Patrick Saulnier1 without having an important impact on the particle properties such as size. The combinations 1MINT, UNIV Angers, INSERM 1066, of peptide with ML-LNC displayed synergistic effect against S. aureus, as confirmed by two CNRS 6021, Université Bretagne Loire, Angers, Cedex, France; methods: checkerboard and time-kill assays. This synergistic interaction enables a dose reduc- 2Laboratoire de bactériologie, CHU tion and consequently decreases the risk of toxicity and has the potential of minimizing the 3 Angers, France; SCIAM (Service development of resistance.
    [Show full text]
  • Nanomedicines for the Delivery of Antimicrobial Peptides (Amps)
    nanomaterials Review Nanomedicines for the Delivery of Antimicrobial Peptides (AMPs) Maria C. Teixeira 1 , Claudia Carbone 1,2 , Maria C. Sousa 3,4, Marta Espina 5,6 , Maria L. Garcia 5,6, Elena Sanchez-Lopez 5,6,7,* and Eliana B. Souto 1,8,* 1 Laboratory of Pharmaceutical Development and Technology, Faculty of Pharmacy, University of Coimbra, Pólo das Ciências da Saúde, Azinhaga de Santa Comba, 3000-548 Coimbra, Portugal; [email protected] (M.C.T.); [email protected] (C.C.) 2 Laboratory of Drug Delivery Technology, Department of Drug Sciences, University of Catania, 95131 Catania, Italy 3 Laboratory of Microbiology, Faculty of Pharmacy, University of Coimbra, Pólo das Ciências da Saúde, Azinhaga de Santa Comba, 3000-548 Coimbra, Portugal; [email protected] 4 CNC—Center for Neuroscience and Cell Biology, University of Coimbra, 3000-548 Coimbra, Portugal 5 Department of Pharmacy, Pharmaceutical Technology and Physical Chemistry, Faculty of Pharmacy, University of Barcelona, 08028 Barcelona, Spain; [email protected] (M.E.); [email protected] (M.L.G.) 6 Institute of Nanoscience and Nanotechnology (IN2UB), University of Barcelona, 08028 Barcelona, Spain 7 Centro de Investigación Biomédica en Red de Enfermedades Neurodegenerativas (CIBERNED), University of Barcelona, 08028 Barcelona, Spain 8 CEB—Centre of Biological Engineering, University of Minho, Campus de Gualtar, 4710-057 Braga, Portugal * Correspondence: [email protected] (E.S.L.); ebsouto@ff.uc.pt or [email protected] (E.B.S.); Tel.: +34-93-93-402-45-52 (E.S.L.); +351-239-488-400 (E.B.S.) Received: 9 March 2020; Accepted: 13 March 2020; Published: 20 March 2020 Abstract: Microbial infections are still among the major public health concerns since several yeasts and fungi, and other pathogenic microorganisms, are responsible for continuous growth of infections and drug resistance against bacteria.
    [Show full text]
  • Antimicrobial Peptides
    BIOTECHNOLOGY Antimicrobial peptides The unique characteristics of antimicrobial peptides (AMPs) – together with an improved understanding of their universal nature – has prompted renewed interest in the development of this group of antimicrobial agents. Hans-Henrik Kristensen and Debbie Yaver, Novozymes A/S ntimicrobial peptides (AMPs) are a recently of the molecular ‘target’ – the antimicrobial effect is Adiscovered group of antimicrobial agents. essentially receptor-independent. ey are simple peptides, but are widely distrib- Novozymes A/S has a strong heritage in the dis- uted in animals and plants, and show activity covery and development of peptidic compounds, against a broad range of pathogens. ey have a using technologies that share common ground number of characteristics that make them interest- with companies in the biotechnology and phar- ing candidates for pharmaceutical development; maceutical fields – such as genetic manipulation, notably, they are fast-acting, microbicidal (rather recombinant expression, high throughput screen- than microbiostatic) and are associated with little ing and protein design. Although Novozymes observed resistance development – a key property traditionally has used these technologies in its in an age of multi-resistant bacteria, as represented core businesses – industrial enzyme production by MRSA. – the company is now looking to apply these Most AMPs are cationic and amphipathic – fea- competencies to biopharmaceutical discovery and tures that promote interaction with the negatively development. One lead area is anti-infectives, charged bacterial and fungal membranes. ey with particular progress being made in the devel- work primarily by compromising the membrane of opment of AMPs. the target organism. When analysed at the molecu- At Novozymes, our focus has been on both the AMPs are gene- lar level, several different mechanisms of membrane development of a solid technology platform around encoded; this disruption have been shown to exist.
    [Show full text]
  • Streptococcus Suis
    Jiao et al. AMB Expr (2017) 7:44 DOI 10.1186/s13568-017-0347-8 ORIGINAL ARTICLE Open Access In vitro and in vivo antibacterial effect of NZ2114 against Streptococcus suis type 2 infection in mice peritonitis models Jian Jiao1,2,3†, Ruoyu Mao1,2†, Da Teng1,2, Xiumin Wang1,2, Ya Hao1,2, Na Yang1,2, Xiao Wang1,2, Xingjun Feng3 and Jianhua Wang1,2* Abstract NZ2114 is a promising candidate for therapeutic application owing to potent activity to gram-positive bacterium such as Streptococcus pneumoniae and Staphylococcus aureus. This work is the first report to describe the in vitro and in vivo antibacterial characteristics of NZ2114 against Streptococcus suis. It exhibited strong antimicrobial activity against S. suis type 2 strains CVCC 606, CVCC 3309, and CVCC 3928 at a low minimal inhibitory concentration (MIC) of 0.03–0.06 μM. The NZ2114 killed over 99.9% of tested S. suis CVCC 606 in Mueller–Hinton medium within 4 h when treated with 4 MIC. It caused only less than 0.25% hemolytic activity in the concentration of 256 μg/ml. Additionally, NZ2114 exhibited× potent in vivo activity to S. suis. All mice were survival when the dosage was low to 0.2 mg/kg. Over 99% of S. suis cells were killed within 4 h in blood, lung, liver and spleen with dosage of 10, 20, and 40 mg/kg in mice peritonitis models and no pathogen were detected after 24 h of treatment. Further, no pathological phenomenon in lung and low level of inflammatory cytokines in blood were detected.
    [Show full text]
  • A Review on Antimicrobial Activity of Mushroom
    CORE Metadata, citation and similar papers at core.ac.uk Provided by Biblioteca Digital do IPB A review on antimicrobial activity of mushroom (Basidiomycetes) extracts and isolated compounds MARIA JOSÉ ALVES1,2,3,4, ISABEL C.F.R. FERREIRA3,*, JOANA DIAS4, VÂNIA TEIXEIRA4 , ANABELA MARTINS3, MANUELA PINTADO1,* 1CBQF-Escola Superior de Biotecnologia, Universidade Católica Portuguesa Porto, Rua Dr. António Bernardino de Almeida, 4200-072 Porto, Portugal. 2Centro Hospitalar de Trás-os-Montes e Alto Douro- Unidade de Chaves, Av. Dr. Francisco Sá Carneiro, 5400-249 Chaves, Portugal. 3CIMO-Escola Superior Agrária, Instituto Politécnico de Bragança, Campus de Santa Apolónia, Apartado 1172, 5301-855 Bragança, Portugal. 4Escola Superior de Saúde, Instituto Politécnico de Bragança, Av. D. Afonso V, 5300- 121 Bragança, Portugal. * Authors to whom correspondence should be addressed (e-mail: [email protected], telephone +351-273-303219, fax +351-273-325405; e-mail: [email protected], telephone +351-22-5580097, fax +351-22-5090351). 1 Abstract Despite the huge diversity of antibacterial compounds, bacterial resistance to first choice antibiotics has been drastically increasing. Moreover, the association between multi-resistant microorganisms and nosocomial infections highlight the problem, and the urgent need for solutions. Natural resources have been exploited in the last years and among them mushrooms could be an alternative as source of new antimicrobials. In this review we present an overview about the antimicrobial properties of mushroom extracts, highlight some of the active compounds identified including low and high molecular weight (LMW and HMW, respectively) compounds. LMW compounds are mainly secondary metabolites, such as sesquiterpenes and other terpenes, steroids, anthraquinones, benzoic acid derivatives, and quinolines, but also primary metabolites such as oxalic acid.
    [Show full text]
  • Plectasin, a Fungal Defensin, Targets the Bacterial Cell Wall Precursor
    REPORTS at an accelerating rate (as shown by the RLI) for dicators is essential to track and improve the ef- 23. M. A. McGeoch et al., Divers. Distrib. 16, 95 (2010). (ii) mammals, birds, and amphibian species used fectiveness of these responses. 24. SCBD, The Convention on Biological Diversity Plant Conservation Reports (SCBD, Montreal, 2009). for food and medicine (with 23 to 36% of such 25. B. Collen, M. Ram, T. Zamin, L. McRae, Trop. Conserv. Sci. species threatened with extinction) and (iii) birds References and Notes 1, 75 (2008). that are internationally traded (principally for the 1. Secretariat of the Convention on Biological Diversity, 26. A. Balmford, P. Crane, A. Dobson, R. E. Green, pet trade; 8% threatened). Trends are not yet Handbook of the Convention on Biological Diversity G. M. Mace, Philos. Trans. R. Soc. London Ser. B 360, available for plants and other important utilized (Earthscan, London, 2003). 221 (2005). 2. United Nations, Millennium Development Goals 27. P. F. Donald et al., Science 317, 810 (2007). animal groups. Three other indicators, which lack Indicators (http://unstats.un.org/unsd/mdg/Host.aspx? 28. S. H. M. Butchart, A. J. Stattersfield, N. J. Collar, Oryx 40, trend data, show (iv) 21% of domesticated an- Content=Indicators/OfficialList.htm, 2008). 266 (2006). imal breeds are at risk of extinction (and 9% are 3. Convention on Biological Diversity, Framework for 29. We are grateful for comments, data, or help from already extinct); (v) languages spoken by fewer monitoring implementation of the achievement of the R. Akçakaya, L. Alvarez-Filip, A.
    [Show full text]
  • Oxidative Stress and the Presence of Bacteria Increase Gene Expression of the Antimicrobial Peptide Aclasin, a Fungal CS&Agr
    Oxidative stress and the presence of bacteria increase gene expression of the antimicrobial peptide aclasin, a fungal CSaβ defensin in Aspergillus clavatus Gabriela Contreras, Nessa Wang, Holger Schäfer and Michael Wink Institute of Pharmacy and Molecular Biotechnology, Heidelberg University, Heidelberg, Baden-Württemberg, Germany ABSTRACT Background: Antimicrobial peptides (AMPs) represent a broad class of naturally occurring antimicrobial compounds. Plants, invertebrates and fungi produce various AMPs as, for example, defensins. Most of these defensins are characterised by the presence of a cysteine-stabilised a-helical and β-sheet (CSaβ) motif. The changes in gene expression of a fungal CSaβ defensin by stress conditions were investigated in Aspergillus clavatus. A. clavatus produces the CSaβ defensin Aclasin, which is encoded by the aclasin gene. Methods: Aclasin expression was evaluated in submerged mycelium cultures under heat shock, osmotic stress, oxidative stress and the presence of bacteria by quantitative real-time PCR. Results: Aclasin expression increased two fold under oxidative stress conditions and in the presence of viable and heat-killed Bacillus megaterium. Under heat shock and osmotic stress, aclasin expression decreased. Discussion: The results suggest that oxidative stress and the presence of bacteria might regulate fungal defensin expression. Moreover, fungi might recognise microorganisms as plants and animals do. Submitted 11 October 2018 Accepted 15 December 2018 Subjects Microbiology, Molecular Biology, Mycology Published 25 February 2019 Keywords Antimicrobial peptides, Defensins, Gene expression, Oxidative stress Corresponding author Michael Wink, INTRODUCTION [email protected] Antimicrobial peptides (AMPs) are a diverse group of naturally occurring molecules Academic editor Blanca Landa that are produced by a wide range of organisms, both prokaryotes and eukaryotes.
    [Show full text]
  • A Lead to Fight ESKAPEE Pathogenic Bacteria? Violette Hamers, Clément Huguet, Mélanie Bourjot, Aurelie Urbain
    Antibacterial Compounds from Mushrooms: A Lead to Fight ESKAPEE Pathogenic Bacteria? Violette Hamers, Clément Huguet, Mélanie Bourjot, Aurelie Urbain To cite this version: Violette Hamers, Clément Huguet, Mélanie Bourjot, Aurelie Urbain. Antibacterial Compounds from Mushrooms: A Lead to Fight ESKAPEE Pathogenic Bacteria?. Planta Medica, Georg Thieme Verlag, 2020, 10.1055/a-1266-6980. hal-03004189 HAL Id: hal-03004189 https://hal.archives-ouvertes.fr/hal-03004189 Submitted on 13 Nov 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Complimentary and personal copy for Violette Hamers, Clément Huguet, Mélanie Bourjot, Aurélie Urbain www.thieme.com Antibacterial Compounds from Mushrooms: A Lead to Fight ESKAPEE Pathogenic Bacteria? DOI 10.1055/a-1266-6980 Planta Med This electronic reprint is provided for non- commercial and personal use only: this reprint may be forwarded to individual colleagues or may be used on the authorʼs homepage. This reprint is not provided for distribution in repositories, including social and scientific networks and platforms.
    [Show full text]
  • A Review on Antimicrobial Activity of Mushroom (Basidiomycetes) Extracts and Isolated Compounds
    Reviews 1707 A Review on Antimicrobial Activity of Mushroom (Basidiomycetes) Extracts and Isolated Compounds Authors Maria José Alves1, 2,3, 4, Isabel C. F. R. Ferreira3, Joana Dias4, Vânia Teixeira4, Anabela Martins3, Manuela Pintado1 Affiliations 1 CBQF-Escola Superior de Biotecnologia, Universidade Católica Portuguesa Porto, Porto, Portugal 2 Centro Hospitalar de Trás-os-Montes e Alto Douro-Unidade de Chaves, Chaves, Portugal 3 CIMO-Escola Superior Agrária, Instituto Politécnico de Bragança, Campus de Santa Apolónia, Bragança, Portugal 4 Escola Superior de Saúde, Instituto Politécnico de Bragança, Bragança, Portugal Key words Abstract crobial activity against gram-positive bacteria, l" mushrooms ! while 2-aminoquinoline, isolated from Leucopax- l" Basidiomycetes Despite the huge diversity of antibacterial com- illus albissimus, presents the highest antimicrobial l" antimicrobials pounds, bacterial resistance to first-choice anti- activity against gram-negative bacteria. l" gram‑positive bacteria biotics has been drastically increasing. Moreover, l" gram‑negative bacteria the association between multiresistant microor- ganisms and nosocomial infections highlight the Abbreviations problem, and the urgent need for solutions. Natu- ! ral resources have been exploited in the last years CSAP: Cordyceps sinensis antibacterial pro- and among them, mushrooms could be an alter- tein native source of new antimicrobials. In this re- CFU: colony forming unities view, we present an overview of the antimicrobial ERSP: erythromycin-resistant Streptococcus
    [Show full text]
  • Cysteine-Stabilized Αβ Defensins
    Peptides 72 (2015) 64–72 Contents lists available at ScienceDirect Peptides j ournal homepage: www.elsevier.com/locate/peptides ␣␤ Cysteine-stabilized defensins: From a common fold to antibacterial activity a a,b,∗ Renata de Oliveira Dias , Octavio Luiz Franco a S-Inova, Programa de Pós Graduac¸ ão em Biotecnologia, Universidade Católica Dom Bosco, 79117-900 Campo Grande, MS, Brazil b Centro de Análises Proteômicas e Bioquímicas, Programa de Pós-Graduac¸ ão em Ciências Genômicas e Biotecnologia, Universidade Católica de Brasília, 70719-100 Brasília, DF, Brazil a r t i c l e i n f o a b s t r a c t Article history: Antimicrobial peptides (AMPs) seem to be promising alternatives to common antibiotics, which are facing Received 5 March 2015 increasing bacterial resistance. Among them are the cysteine-stabilized ␣␤ defensins. These peptides are Received in revised form 15 April 2015 small, with a length ranging from 34 to 54 amino acid residues, cysteine-rich and extremely stable, Accepted 15 April 2015 normally composed of an ␣-helix and three ␤-strands stabilized by three or four disulfide bonds and Available online 27 April 2015 commonly found in several organisms. Moreover, animal and plant CS␣␤ defensins present different specificities, the first being mainly active against bacteria and the second against fungi. The role of the Keywords: ␣␤ CS -motif remains unknown, but a common antibacterial mechanism of action, based on the inhibition Defensin of the cell-wall formation, has already been observed in some fungal and invertebrate defensins. In this Antimicrobial peptide ␣␤ Antibacterial context, the present work aims to group the data about CS defensins, highlighting their evolution, Plant conservation, structural characteristics, antibacterial activity and biotechnological perspectives.
    [Show full text]