The Glutamate Receptor Ion Channels

Total Page:16

File Type:pdf, Size:1020Kb

The Glutamate Receptor Ion Channels 0031-6997/99/5101-0007$03.00/0 PHARMACOLOGICAL REVIEWS Vol. 51, No. 1 Copyright © 1999 by The American Society for Pharmacology and Experimental Therapeutics Printed in U.S.A. The Glutamate Receptor Ion Channels RAYMOND DINGLEDINE,1 KARIN BORGES, DEREK BOWIE, AND STEPHEN F. TRAYNELIS Department of Pharmacology, Emory University School of Medicine, Atlanta, Georgia This paper is available online at http://www.pharmrev.org I. Introduction ............................................................................. 8 II. Gene families ............................................................................ 9 III. Receptor structure ...................................................................... 10 A. Transmembrane topology ............................................................. 10 B. Subunit stoichiometry ................................................................ 10 C. Ligand-binding sites located in a hinged clamshell-like gorge............................. 13 IV. RNA modifications that promote molecular diversity ....................................... 15 A. Alternative splicing .................................................................. 15 B. Editing of AMPA and kainate receptors ................................................ 17 V. Post-translational modifications .......................................................... 18 A. Phosphorylation of AMPA and kainate receptors ........................................ 18 B. Serine/threonine phosphorylation of NMDA receptors ................................... 19 C. Tyrosine phosphorylation of NMDA receptors........................................... 20 D. Glycosylation, proteolysis, and covalently bound lipids................................... 21 VI. Receptor activation and desensitization ................................................... 22 A. Agonists ............................................................................ 22 B. Competitive antagonists: new developments ............................................ 23 C. Noncompetitive antagonists........................................................... 23 D. Uncompetitive blockers............................................................... 24 E. Antagonists with unknown mechanism ................................................ 25 F. Glutamate receptor kinetics........................................................... 25 G. Molecular determinants of AMPA receptor deactivation and desensitization ............... 27 H. Molecular determinants of kainate receptor deactivation and desensitization .............. 28 I. Molecular determinants of NMDA receptor deactivation and desensitization ............... 28 VII. Endogenous allosteric modulators......................................................... 30 A. Extracellular zinc .................................................................... 30 B. Reduction and oxidation of extracellular cysteine residues ............................... 31 C. Extracellular protons................................................................. 32 D. Extracellular polyamines ............................................................. 33 VIII. Molecular determinants of ion permeation ................................................. 34 A. Pore diameter ....................................................................... 34 B. Unitary sublevel conductances ........................................................ 35 C. Ionic selectivity ...................................................................... 38 IX. Molecular determinants of channel block .................................................. 39 A. External Mg21 block of NMDA receptors ............................................... 39 B. Internal Mg21 block of NMDA receptors ............................................... 41 C. Internal polyamine block of AMPA and kainate receptors ................................ 41 X. Molecular composition of the pore ........................................................ 43 A. Outer vestibules ..................................................................... 43 B. Narrow constriction and selectivity filter ............................................... 43 XI. Association of glutamate receptors with intracellular proteins ............................... 43 A. AMPA receptors ..................................................................... 44 B. NMDA receptors: signaling molecules and proteins lacking PDZ domains ................. 45 C. NMDA receptors: PDZ domain-containing proteins ...................................... 45 D. Kainate receptors .................................................................... 47 1 Address for correspondence: Raymond Dingledine, Department of Pharmacology, Emory University School of Medicine, 1510 Clifton Road, Atlanta, GA 30322. E-mail: [email protected] 7 8 DINGLEDINE ET AL. XII. Genetic regulation of receptor expression .................................................. 47 A. Transcriptional control ............................................................... 47 B. Translational control ................................................................. 48 XIII. Therapeutic potential: clinical trials ...................................................... 48 A. Ischemic stroke ...................................................................... 49 B. Neuropathic pain .................................................................... 49 C. Parkinson’s disease .................................................................. 50 D. Cognitive enhancement............................................................... 50 XIV. Outlook ................................................................................ 50 XV. Acknowledgments ....................................................................... 51 XVI. References.............................................................................. 51 I. Introduction resorption (Chenu et al., 1998; Patton et al., 1998) raise The ionotropic glutamate receptors are ligand-gated the possibilities that antagonists restricted to the pe- ion channels that mediate the vast majority of excitatory riphery might find uses in the treatment of diabetes and neurotransmission in the brain. The cloning of cDNAs osteoporosis. Moreover, there is evidence for the pres- encoding glutamate receptor subunits, which occurred ence of NMDA and non-NMDA receptors in small, un- mainly between 1989 and 1992 (Hollmann and Heine- myelinated sensory nerve terminals in the skin (Ault mann, 1994), stimulated this field like no other event and Hildebrand, 1993; Carlton et al., 1995). Subcutane- since the recognition in the early 1980s that the N- ous injection of as little as 300 pmol of 6-cyano-7-nitro- 2 methyl-D-aspartate (NMDA) receptor antagonist, quinoxaline-2,3-dione (CNQX) or 30 pmol of MK-801 D-AP5, has neuroprotective and anticonvulsant proper- produced analgesia for a subsequent injection of forma- ties (reviewed by Choi, 1998; Dingledine et al., 1990), lin into the same site. These findings raise the possibil- and that calcium entry through glutamate receptor ity that peripheral glutamate receptors residing on channels plays important roles in development and in nerve terminals in the skin may be a target for certain forms of synaptic plasticity that may underlie higher forms of pain associated with inflammation. NMDA re- order processes such as learning and memory (Maren ceptor antagonists can also reduce histamine secretion and Baudry, 1995; Asztely and Gustafsson, 1996). These from mast cells collected from the rat peritoneal cavity earlier findings implicated NMDA receptors in a variety (Purcell et al., 1996), and NMDA depolarizes and ele- 21 of neurologic disorders that include epilepsy, ischemic vates intracellular Ca in mouse taste receptor cells in brain damage, and, more speculatively, neurodegenerative taste buds (Hayashi et al., 1996). Numerous ionotropic disorders such as Parkinson’s and Alzheimer’s diseases, glutamate receptor subunits appear to be expressed by Huntington’s chorea, and amyotrophic lateral sclerosis. cardiac ganglia, but their functions are unknown (Gill et Glutamate receptors are expressed mainly in the cen- al., 1998). Thus, the potential therapeutic realm of drugs tral nervous system, but several potentially important targeted to glutamate receptors is expanding to include exceptions are worth mentioning. The realization that cells (neural and nonneural) in the periphery. Most re- pancreatic islet cells express glutamate receptors that cently, evidence for a role for ionotropic glutamate re- modulate insulin secretion (Inagaki et al., 1995; Weaver ceptors expressed by plant cells in light signal transduc- et al., 1996, 1998) and that antagonists of NMDA recep- tion has been reported (Lam et al., 1998), suggesting tors expressed by osteoclasts and osteoblasts slow bone that mammalian receptors may have evolved from a more primitive signaling mechanism. 2 Abbreviations: NMDA, N-methyl-D-aspartate; PKA, protein kinase The cloning of the glutamate receptors in the early a A; PKC, protein kinase C; AMPA, -amino-3-hydroxy-5-methyl-4-isox- 1990s has taken the study of glutamate receptor phar- azolepropionic acid; UTR, untranslated region; KBP, kainate-binding protein; RT-PCR, reverse transcription-polymerase chain reaction; macology, physiology, and pathophysiology to the molec- GABA, g-aminobutyric acid; CNS, central nervous system; NO, nitric ular level. Several major reviews of the initial fruits of oxide; ABP, AMPA receptor-binding
Recommended publications
  • Anti-GRIK1 / Glur5 Antibody (ARG59676)
    Product datasheet [email protected] ARG59676 Package: 50 μg anti-GRIK1 / GluR5 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes GRIK1 / GluR5 Tested Reactivity Hu, Ms, Rat Tested Application IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name GRIK1 / GluR5 Species Human Immunogen Recombinant protein corresponding to R271-I450 of Human GRIK1. Conjugation Un-conjugated Alternate Names GluR5; GluK1; GLUR5; EEA3; GluR-5; Excitatory amino acid receptor 3; Glutamate receptor ionotropic, kainate 1; EAA3; Glutamate receptor 5; GLR5 Application Instructions Application table Application Dilution IHC-P 1:200 - 1:1000 WB 0.1 - 0.5 µg/ml Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Properties Form Liquid Purification Affinity purification with immunogen. Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. Preservative 0.05% Sodium azide Stabilizer 5% BSA Concentration 0.5 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/4 Bioinformation Gene Symbol GRIK1 Gene Full Name glutamate receptor, ionotropic, kainate 1 Background Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes.
    [Show full text]
  • A Guide to Glutamate Receptors
    A guide to glutamate receptors 1 Contents Glutamate receptors . 4 Ionotropic glutamate receptors . 4 - Structure ........................................................................................................... 4 - Function ............................................................................................................ 5 - AMPA receptors ................................................................................................. 6 - NMDA receptors ................................................................................................. 6 - Kainate receptors ............................................................................................... 6 Metabotropic glutamate receptors . 8 - Structure ........................................................................................................... 8 - Function ............................................................................................................ 9 - Group I: mGlu1 and mGlu5. .9 - Group II: mGlu2 and mGlu3 ................................................................................. 10 - Group III: mGlu4, mGlu6, mGlu7 and mGlu8 ............................................................ 10 Protocols and webinars . 11 - Protocols ......................................................................................................... 11 - Webinars ......................................................................................................... 12 References and further reading . 13 Excitatory synapse pathway
    [Show full text]
  • Effects of Chronic Systemic Low-Impact Ampakine Treatment On
    Biomedicine & Pharmacotherapy 105 (2018) 540–544 Contents lists available at ScienceDirect Biomedicine & Pharmacotherapy journal homepage: www.elsevier.com/locate/biopha Effects of chronic systemic low-impact ampakine treatment on neurotrophin T expression in rat brain ⁎ Daniel P. Radin , Steven Johnson, Richard Purcell, Arnold S. Lippa RespireRx Pharmaceuticals, Inc., 126 Valley Road, Glen Rock, NJ, 07452, United States ARTICLE INFO ABSTRACT Keywords: Neurotrophin dysregulation has been implicated in a large number of neurodegenerative and neuropsychiatric Ampakine diseases. Unfortunately, neurotrophins cannot cross the blood brain barrier thus, novel means of up regulating BDNF their expression are greatly needed. It has been demonstrated previously that neurotrophins are up regulated in Cognitive enhancement response to increases in brain activity. Therefore, molecules that act as cognitive enhancers may provide a LTP clinical means of up regulating neurotrophin expression. Ampakines are a class of molecules that act as positive Neurotrophin allosteric modulators of AMPA-type glutamate receptors. Currently, they are being developed to prevent opioid- NGF induced respiratory depression without sacrificing the analgesic properties of the opioids. In addition, these molecules increase neuronal activity and have been shown to restore age-related deficits in LTP in aged rats. In the current study, we examined whether two different ampakines could increase levels of BDNF and NGF at doses that are active in behavioral measures of cognition. Results demonstrate that ampakines CX516 and CX691 induce differential increases in neurotrophins across several brain regions. Notable increases in NGF were ob- served in the dentate gyrus and piriform cortex while notable BDNF increases were observed in basolateral and lateral nuclei of the amygdala.
    [Show full text]
  • Chr21 Protein-Protein Interactions: Enrichment in Products Involved in Intellectual Disabilities, Autism and Late Onset Alzheimer Disease
    bioRxiv preprint doi: https://doi.org/10.1101/2019.12.11.872606; this version posted December 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Chr21 protein-protein interactions: enrichment in products involved in intellectual disabilities, autism and Late Onset Alzheimer Disease Julia Viard1,2*, Yann Loe-Mie1*, Rachel Daudin1, Malik Khelfaoui1, Christine Plancon2, Anne Boland2, Francisco Tejedor3, Richard L. Huganir4, Eunjoon Kim5, Makoto Kinoshita6, Guofa Liu7, Volker Haucke8, Thomas Moncion9, Eugene Yu10, Valérie Hindie9, Henri Bléhaut11, Clotilde Mircher12, Yann Herault13,14,15,16,17, Jean-François Deleuze2, Jean- Christophe Rain9, Michel Simonneau1, 18, 19, 20** and Aude-Marie Lepagnol- Bestel1** 1 Centre Psychiatrie & Neurosciences, INSERM U894, 75014 Paris, France 2 Laboratoire de génomique fonctionnelle, CNG, CEA, Evry 3 Instituto de Neurociencias CSIC-UMH, Universidad Miguel Hernandez-Campus de San Juan 03550 San Juan (Alicante), Spain 4 Department of Neuroscience, The Johns Hopkins University School of Medicine, Baltimore, MD 21205 USA 5 Center for Synaptic Brain Dysfunctions, Institute for Basic Science, Daejeon 34141, Republic of Korea 6 Department of Molecular Biology, Division of Biological Science, Nagoya University Graduate School of Science, Furo, Chikusa, Nagoya, Japan 7 Department of Biological Sciences, University of Toledo, Toledo, OH, 43606, USA 8 Leibniz Forschungsinstitut für Molekulare Pharmakologie
    [Show full text]
  • Pharmacological Modulation of Processes Contributing to Spinal Hyperexcitability: Electrophysiological Studies in the Rat
    Pharmacological modulation of processes contributing to spinal hyperexcitability: electrophysiological studies in the rat. By Katherine J Carpenter A thesis submitted to the University of London for the degree of Doctor of Philosophy Department of Pharmacology University College London Gower Street London WC1E6BT ProQuest Number: U642184 All rights reserved INFORMATION TO ALL USERS The quality of this reproduction is dependent upon the quality of the copy submitted. In the unlikely event that the author did not send a complete manuscript and there are missing pages, these will be noted. Also, if material had to be removed, a note will indicate the deletion. uest. ProQuest U642184 Published by ProQuest LLC(2015). Copyright of the Dissertation is held by the Author. All rights reserved. This work is protected against unauthorized copying under Title 17, United States Code. Microform Edition © ProQuest LLC. ProQuest LLC 789 East Eisenhower Parkway P.O. Box 1346 Ann Arbor, Ml 48106-1346 Abstract Two of the most effective analgesic strategies in man are (i) blockade of the NMDA receptor for glutamate, which plays a major role in nociceptive transmission and (ii) augmentation of inhibitory systems, exemplified by the use of ketamine and the opioids respectively. Both are, however, are associated with side effects. Potential novel analgesic targets are investigated here using in vivo electrophysiology in the anaesthetised rat with pharmacological manipulation of spinal neuronal transmission. Three different approaches were used to target NMDA receptors: (i) glycine site antagonists (Mrz 2/571 and Mrz 2/579), (ii) antagonists selective for receptors containing the NR2B subunit (ifenprodil and ACEA-1244), (iii) elevating the levels of N-acetyl-aspartyl- glutamate (NAAG), an endogenous peptide, by inhibition of its degradative enzyme.
    [Show full text]
  • Case-Control Study of GRIA1 and GRIA3 Gene Variants in Migraine Jie Fang1, Xingkai An1, Shuai Chen2, Zhenzhen Yu1, Qilin Ma1,2* and Hongli Qu1*
    Fang et al. The Journal of Headache and Pain (2016) 17:2 DOI 10.1186/s10194-016-0592-2 RESEARCH ARTICLE Open Access Case-control study of GRIA1 and GRIA3 gene variants in migraine Jie Fang1, Xingkai An1, Shuai Chen2, Zhenzhen Yu1, Qilin Ma1,2* and Hongli Qu1* Abstract Background: As the most abundant excitatory neurotransmitter in the central nervous system, glutamate has been accepted to play a major role in the pathophysiology of migraine. The previous studies have reported the glutamate receptor ionotropic GRIA1 and GRIA3 genes variants associated with migraine. The project aims to investigate the polymorphisms in both genes for their association with migraine in the Chinese Han population. Methods: A Han-Chinese case-control population, including 331 unrelated female migraine patients and 330 matched controls, was studied. Variants in genes (GRIA1 and GRIA3) were genotyped by Multiplex SNaPshot assay. Results: In the group of patients, the frequency of allele C was 84.1 % (557 C alleles) and allele T was 15.9 % (105 T alleles) for the GRIA1 (rs2195450) in migraineurs, this was significantly as compared with the controls (P = .001, OR = 1.786, 95 % CI: 1.28–2.49). And an association was also seen in the migraine with aura (MA) subtype (P = .012, OR = 2.092, 95 % CI: 1.17–3.76) and migraine without aura (MO) subtype (P =.002,OR=1.737, 95 % CI: 1.23–2.45). However, no evidence was found that GRIA1 (rs548294) or GRIA3 (rs3761555) is associated with migraine. Conclusion: Our data of this study confirmed the association of GRIA1 (rs2195450) to female migraine (MA, MO) susceptibility in the Chinese Han population.
    [Show full text]
  • Interplay Between Gating and Block of Ligand-Gated Ion Channels
    brain sciences Review Interplay between Gating and Block of Ligand-Gated Ion Channels Matthew B. Phillips 1,2, Aparna Nigam 1 and Jon W. Johnson 1,2,* 1 Department of Neuroscience, University of Pittsburgh, Pittsburgh, PA 15260, USA; [email protected] (M.B.P.); [email protected] (A.N.) 2 Center for Neuroscience, University of Pittsburgh, Pittsburgh, PA 15260, USA * Correspondence: [email protected]; Tel.: +1-(412)-624-4295 Received: 27 October 2020; Accepted: 26 November 2020; Published: 1 December 2020 Abstract: Drugs that inhibit ion channel function by binding in the channel and preventing current flow, known as channel blockers, can be used as powerful tools for analysis of channel properties. Channel blockers are used to probe both the sophisticated structure and basic biophysical properties of ion channels. Gating, the mechanism that controls the opening and closing of ion channels, can be profoundly influenced by channel blocking drugs. Channel block and gating are reciprocally connected; gating controls access of channel blockers to their binding sites, and channel-blocking drugs can have profound and diverse effects on the rates of gating transitions and on the stability of channel open and closed states. This review synthesizes knowledge of the inherent intertwining of block and gating of excitatory ligand-gated ion channels, with a focus on the utility of channel blockers as analytic probes of ionotropic glutamate receptor channel function. Keywords: ligand-gated ion channel; channel block; channel gating; nicotinic acetylcholine receptor; ionotropic glutamate receptor; AMPA receptor; kainate receptor; NMDA receptor 1. Introduction Neuronal information processing depends on the distribution and properties of the ion channels found in neuronal membranes.
    [Show full text]
  • Ligand-Gated Ion Channels' British Journal of Pharmacology, Vol
    Edinburgh Research Explorer The Concise Guide to PHARMACOLOGY 2015/16 Citation for published version: Alexander, SP, Peters, JA, Kelly, E, Marrion, N, Benson, HE, Faccenda, E, Pawson, AJ, Sharman, JL, Southan, C, Davies, JA & CGTP Collaborators 2015, 'The Concise Guide to PHARMACOLOGY 2015/16: Ligand-gated ion channels' British Journal of Pharmacology, vol. 172, no. 24, pp. 5870-5903. DOI: 10.1111/bph.13350 Digital Object Identifier (DOI): 10.1111/bph.13350 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: British Journal of Pharmacology General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 05. Apr. 2019 S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2015/16: Ligand-gated ion channels. British Journal of Pharmacology (2015) 172, 5870–5903 THE CONCISE GUIDE TO PHARMACOLOGY 2015/16: Ligand-gated ion channels Stephen PH Alexander1,
    [Show full text]
  • Sex Differences in Glutamate Receptor Gene Expression in Major Depression and Suicide
    Molecular Psychiatry (2015) 20, 1057–1068 © 2015 Macmillan Publishers Limited All rights reserved 1359-4184/15 www.nature.com/mp IMMEDIATE COMMUNICATION Sex differences in glutamate receptor gene expression in major depression and suicide AL Gray1, TM Hyde2,3, A Deep-Soboslay2, JE Kleinman2 and MS Sodhi1,4 Accumulating data indicate that the glutamate system is disrupted in major depressive disorder (MDD), and recent clinical research suggests that ketamine, an antagonist of the N-methyl-D-aspartate (NMDA) glutamate receptor (GluR), has rapid antidepressant efficacy. Here we report findings from gene expression studies of a large cohort of postmortem subjects, including subjects with MDD and controls. Our data reveal higher expression levels of the majority of glutamatergic genes tested in the dorsolateral prefrontal cortex (DLPFC) in MDD (F21,59 = 2.32, P = 0.006). Posthoc data indicate that these gene expression differences occurred mostly in the female subjects. Higher expression levels of GRIN1, GRIN2A-D, GRIA2-4, GRIK1-2, GRM1, GRM4, GRM5 and GRM7 were detected in the female patients with MDD. In contrast, GRM5 expression was lower in male MDD patients relative to male controls. When MDD suicides were compared with MDD non-suicides, GRIN2B, GRIK3 and GRM2 were expressed at higher levels in the suicides. Higher expression levels were detected for several additional genes, but these were not statistically significant after correction for multiple comparisons. In summary, our analyses indicate a generalized disruption of the regulation of the GluRs in the DLPFC of females with MDD, with more specific GluR alterations in the suicides and in the male groups.
    [Show full text]
  • Mouse Anti-Human GRID2 Monoclonal Antibody, Clone 2B2 (CABT-B10363) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Mouse anti-Human GRID2 monoclonal antibody, clone 2B2 (CABT-B10363) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen GRID2 (NP_001501, 908 a.a. ~ 1008 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone 2B2 Conjugate Unconjugated Applications WB,sELISA,ELISA Sequence Similarities DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGG FFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI* Format Liquid Size 100 μg Buffer In 1x PBS, pH 7.2 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. BACKGROUND Introduction The protein encoded by this gene is a member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. The encoded protein is a multi-pass membrane protein that is expressed selectively in cerebellar Purkinje cells. A point mutation in the mouse ortholog, associated with the phenotype named lurcher, in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved embryogenesis. This protein also plays a role in synapse
    [Show full text]
  • Supplemental Information
    Supplemental information Dissection of the genomic structure of the miR-183/96/182 gene. Previously, we showed that the miR-183/96/182 cluster is an intergenic miRNA cluster, located in a ~60-kb interval between the genes encoding nuclear respiratory factor-1 (Nrf1) and ubiquitin-conjugating enzyme E2H (Ube2h) on mouse chr6qA3.3 (1). To start to uncover the genomic structure of the miR- 183/96/182 gene, we first studied genomic features around miR-183/96/182 in the UCSC genome browser (http://genome.UCSC.edu/), and identified two CpG islands 3.4-6.5 kb 5’ of pre-miR-183, the most 5’ miRNA of the cluster (Fig. 1A; Fig. S1 and Seq. S1). A cDNA clone, AK044220, located at 3.2-4.6 kb 5’ to pre-miR-183, encompasses the second CpG island (Fig. 1A; Fig. S1). We hypothesized that this cDNA clone was derived from 5’ exon(s) of the primary transcript of the miR-183/96/182 gene, as CpG islands are often associated with promoters (2). Supporting this hypothesis, multiple expressed sequences detected by gene-trap clones, including clone D016D06 (3, 4), were co-localized with the cDNA clone AK044220 (Fig. 1A; Fig. S1). Clone D016D06, deposited by the German GeneTrap Consortium (GGTC) (http://tikus.gsf.de) (3, 4), was derived from insertion of a retroviral construct, rFlpROSAβgeo in 129S2 ES cells (Fig. 1A and C). The rFlpROSAβgeo construct carries a promoterless reporter gene, the β−geo cassette - an in-frame fusion of the β-galactosidase and neomycin resistance (Neor) gene (5), with a splicing acceptor (SA) immediately upstream, and a polyA signal downstream of the β−geo cassette (Fig.
    [Show full text]
  • Supplementary Material
    Supplementary Material Table S1: Significant downregulated KEGGs pathways identified by DAVID following exposure to five cinnamon- based phenylpropanoids (p < 0.05). p-value Term: Genes (Benjamini) Cytokine-cytokine receptor interaction: FASLG, TNFSF14, CXCL11, IL11, FLT3LG, CCL3L1, CCL3L3, CXCR6, XCR1, 2.43 × 105 RTEL1, CSF2RA, TNFRSF17, TNFRSF14, CCNL2, VEGFB, AMH, TNFRSF10B, INHBE, IFNB1, CCR3, VEGFA, CCR2, IL12A, CCL1, CCL3, CXCL5, TNFRSF25, CCR1, CSF1, CX3CL1, CCL7, CCL24, TNFRSF1B, IL12RB1, CCL21, FIGF, EPO, IL4, IL18R1, FLT1, TGFBR1, EDA2R, HGF, TNFSF8, KDR, LEP, GH2, CCL13, EPOR, XCL1, IFNA16, XCL2 Neuroactive ligand-receptor interaction: OPRM1, THRA, GRIK1, DRD2, GRIK2, TACR2, TACR1, GABRB1, LPAR4, 9.68 × 105 GRIK5, FPR1, PRSS1, GNRHR, FPR2, EDNRA, AGTR2, LTB4R, PRSS2, CNR1, S1PR4, CALCRL, TAAR5, GABRE, PTGER1, GABRG3, C5AR1, PTGER3, PTGER4, GABRA6, GABRA5, GRM1, PLG, LEP, CRHR1, GH2, GRM3, SSTR2, Chlorogenic acid Chlorogenic CHRM3, GRIA1, MC2R, P2RX2, TBXA2R, GHSR, HTR2C, TSHR, LHB, GLP1R, OPRD1 Hematopoietic cell lineage: IL4, CR1, CD8B, CSF1, FCER2, GYPA, ITGA2, IL11, GP9, FLT3LG, CD38, CD19, DNTT, 9.29 × 104 GP1BB, CD22, EPOR, CSF2RA, CD14, THPO, EPO, HLA-DRA, ITGA2B Cytokine-cytokine receptor interaction: IL6ST, IL21R, IL19, TNFSF15, CXCR3, IL15, CXCL11, TGFB1, IL11, FLT3LG, CXCL10, CCR10, XCR1, RTEL1, CSF2RA, IL21, CCNL2, VEGFB, CCR8, AMH, TNFRSF10C, IFNB1, PDGFRA, EDA, CXCL5, TNFRSF25, CSF1, IFNW1, CNTFR, CX3CL1, CCL5, TNFRSF4, CCL4, CCL27, CCL24, CCL25, CCL23, IFNA6, IFNA5, FIGF, EPO, AMHR2, IL2RA, FLT4, TGFBR2, EDA2R,
    [Show full text]