DOCSLIB.ORG

Stakeholder Reference Group Presentation, July 2016

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Stakeholder Reference Group Presentation, July 2016 :HOFRPHWRWKH 2[IRUGWR&DPEULGJH ([SUHVVZD\ 6WUDWHJLF6WXG\ 6WDNHKROGHU5HIHUHQFH*URXS -XO\ AGENDA Item Topic Lead Start Time 1 Networking Opportunity All 10:00 2 Welcome Philip 10:30 Introductions Agenda 3 Strategic Studies update Paul 10:35 4 A1 East of England Strategic Study – from Long List to short list Kieron 10:45 5 Breakout session to review/comment on short listed options All 11:15 6 Feedback and Comments All 12:00 7 Next steps Paul 12:15 8 Lunch / Networking Opportunity All 12:30 9 Welcome to those joining the afternoon session Alan 13:00 Introductions Agenda 10 Update on RIS1 A428 Black Cat to Caxton Gibbet and other schemes within the Dave/ 13:05 study vicinity Alan 11 Strategic Studies update Paul 13:35 12 Oxford to Cambridge Expressway Strategic Study – from long list to short list Adrian 13:45 13 Breakout session to review/comment on short listed options All 14:15 14 Feedback and Comments All 15:00 15 Next Steps Paul 15:15 16 Event closure Paul 15:30 A428 Black Cat to Caxton Gibbet improvement scheme A1 East of England and Oxford to Cambridge Expressway Study Stakeholder Reference Group 7th July 2016 Introductions / Agenda . Andrew Kelly, Highways England, A428 Project Manager . Ian Cook, Jacobs, A428 Project Manager . A428-Strategic Studies Timing & Interfaces . Background, Context & Challenges . Progress to date . Next Steps . Questions Timing & Interfaces Road Road Road Period 1 Period 2 Period 3 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 OPTIONS / DEVELOPMENT CONSTRUCTION A428 DCO A1 SS CONSTRUCTION OX-CAM SS CONSTRUCTION (A1 / Ox-Cam Strategic Studies complete) $1RUWK 7XGGHQKDPWR 5HJLRQDO&RQWH[W 6FKHPH/RFDWLRQ (DVWRQ $%ORILHOGWR1RUWK %XUOLQJKDPGXDOOLQJ $:DQVIRUGWR $ 1RUZLFK 6XWWRQ $ $$ $*X\KLUQ 7KLFNWKRUQ-XQFWLRQ -XQFWLRQ $$FOH6WUDLJKW 3HWHUERURXJK $DQG$-XQFWLRQ HQKDQFHPHQW $ 0 $&DPEULGJH WR+XQWLQJGRQ $ $ 1RUWKDPSWRQ $ $ $ $ $ &DPEULGJH %HGIRUG $ZKROHURXWH $%ODFN&DW WHFKQRORJ\XSJUDGH $ WR&D[WRQ*LEEHW ,SVZLFK 0- 0LOWRQ WHFKQRORJ\ .H\QHV 0 XSJUDGH $ $ 0 )HOL[VWRZH /XWRQ 6WHYHQDJH $ $ 0 0- $ &ROFKHVWHU $0/LQN VPDUWPRWRUZD\ $ $&KHOPVIRUGWR 0 $ZLGHQLQJ 0 -XQFWLRQ &KHOPVIRUG XSJUDGH 0 A1-A421Black Cat Junction Planned future development Challenges Safety/Serviceability issues Congestion and delays Huntingdon Environmental issues A14 Access/Integration issues Strategic Study A1 St Neots Eastern A1198 A1198 Expansion Caxton Gibbet St Neots A428 roundabout A428 Cambridge A1/A428 Strategic junction Study Cambourne Bourne West Airfield New Expansion Village Black Cat A1198 roundabout Strategic Study Road Investment Strategy Announcement “improvement of the A428 near St Neots, linking the A421 to Milton Keynes with the existing dual carriageway section of the A428 to Cambridge, creating an Expressway standard link between the two cities via Bedford. The scheme is expected to include significant improvements to the Black Cat roundabout, where the A1 currently meets the A421.” Road Investment Strategy N Caxton Gibbet Cambridge Road St Neots Roundabout A1 A428 Eltisley Junctions Croxton Junctions Barford Road Key Wyboston Existing junction/s Junction A428 (A1 to Caxton Gibbet) A1 A421 Black Cat East Coast Mainline roundabout A428 Project Area A421 A1 © Crown copyright and database rights 2015 Ordnance Survey 10018341 Progress To Date April 2014 Previous route strategy studies completed Road Investment Strategy (RIS) published December 2014 - April 2015 and commissioning of Strategy, Shaping and Prioritisation works Data gathering/review, scheme development, May 2015 – February 2016 strategic outline business case development and early stakeholder events Options phase commenced and initiation of March 2016 – to date Options Identification Initial engagement with key stakeholders Surveys (incl. traffic & environmental surveys) Traffic model development Next Steps July - September 2016 Targeted engagement with key stakeholders Develop options for public engagement October- December 2016 Preparation for engagement on scheme options Completion of A1 and Ox-Cam Strategic Studies January - March 2017 Engagement on scheme options Spring 2017 Ministerial announcement of preferred route Spring - Autumn 2017 Development of preferred scheme Autumn 2017 Formal consultation on preferred scheme Summer 2018 Submission of development consent application Winter 2019 Secretary of State decision Spring 2020 Start of works Options Engagement Timeline May 2016 Forum invitations (Members / Economic / Environmental / Technical / Community) Summer 2016 Options engagement Forums Workshops Local information briefings January - March 2017 Formal non-statutory consultation on scheme options Other RIS 1 schemes within the vicinity of the study corridors Highways England Schemes: - A1 J6-8 Smart Motorway: Start of Works 2019 - A14 Huntingdon to Cambridge: Start of Works by December 2016 - A34 Technology Improvement: Start of Works 2017 - A34 Oxford Junction Improvement: Start of Works 2017 - A5 to M1 Link: Open for Traffic end of June 2017 - M11 J8-14 Technology: Start of Works March 2020 Other: - A421 to M1 J13 to Milton Keynes (Eagle Farm): Completion subject to funding 2018/19 ,WHP6WUDWHJLFVWXGLHVXSGDWH 6WDNHKROGHU5HIHUHQFH*URXS-XO\ $(DVWRI(QJODQG2[IRUGWR&DPEULGJH([SUHVVZD\-RLQW65*-XO\ 1RUWKHUQVWUDWHJLFVWXGLHVXSGDWH )LQDOUHSRUWVSXEOLVKHGE\WKH 7UDQV3HQQLQHFRQQHFWLYLW\ HQGRIWKH\HDU QRUWKRI0DQFKHVWHULVSRRU WKHUHLVQRFRPSOHWHHDVW 7KHUHLVFXUUHQWO\QR ZHVWGXDOFDUULDJHZD\OLQN PRGHUQURDGOLQNLQJ EHIRUH(GLQEXUJK 0DQFKHVWHUDQG6KHIILHOG$ 8SJUDGLQJ1RUWKHUQ7UDQV 7UDQV3HQQLQH7XQQHO 3HQQLQHURXWHVWKH$ XQGHUWKH3HDN'LVWULFW DQG$FRXOGEHLQJ 1DWLRQDO3DUNLVWHFKQLFDOO\ VLJQLILFDQWEHQHILWVWRIUHLJKW IHDVLEOHDQGFRXOGUHGXFH MRXUQH\WLPHVE\PLQXWHV 0DQFKHVWHU¶V1RUWK:HVW DQGEULQJVLJQLILFDQWZLGHU 4XDGUDQWLVYHU\FRQJHVWHG HFRQRPLFEHQHILWV7KLVLV DQGQHDUFDSDFLW\DGGLWLRQDO WKHODUJHVWVLQJOHSURMHFW FDSDFLW\HLWKHURQWKHURDG DQGLVOLNHO\WRSURYHYHU\ RUQHDUE\FRXOGVXSSRUW H[SHQVLYH JURZWK0XOWLPRGDORSWLRQV DUHEHLQJFRQVLGHUHGWR PLWLJDWHWKHHQYLURQPHQWDO FKDOOHQJHV 6RXWKHUQVWUDWHJLFVWXGLHVXSGDWH 7KH$LQWKH(DVW $Q2[IRUGWR&DPEULGJH RI(QJODQGLVDSRRU ([SUHVVZD\YLD0LOWRQ.H\QHV TXDOLW\GXDO FRXOGEHWWHUFRQQHFW(QJODQG¶VWRS FDUULDJHZD\ZLWK NQRZOHGJHHFRQRP\FHQWUHVDQG VLJQLILFDQW SURYLGHPDMRUHFRQRPLFEHQHILWV HQYLURQPHQWDO SUREOHPV7KHVWXG\ KDVIRXQGEHQHILWV DOOURXQGLQSURYLGLQJ 6(&85,7<&/$66,),&$7,21$1''5$)767$786&/,&.$33/<72$// DPRUHPRGHUQOLQN 7KH06RXWK:HVW4XDGUDQWLVRXU EXVLHVWVWUHWFKRIURDGDQGWKHUHLVDQ XUJHQWQHHGWRDGGUHVVFRQJHVWLRQ (',77+,67(;7,1,16(57!+($'(5)227(5,1&/8'(7($01$0( $DQG2[IRUGWR&¶EULGJHILQDO ,QWURGXFLQJH[WUDFDSDFLW\PXOWLPRGDO UHSRUWVSXEOLVKHGE\WKHHQGRI LPSURYHPHQWVRUGHPDQG WKH\HDU0ZLOOUHSRUWLQ -XO\ PDQDJHPHQWZRXOGUHGXFHWKLVEDUULHU HDUO\ WRJURZWK 6WUDWHJLF6WXGLHVWLPHOLQHRYHUYLHZ $XWXPQ 6XPPHU $XWXPQ :LQWHU 6SULQJ 7XQQHO1RUWKHUQ 3XEOLVK0$ $OO)LQDO5HSRUWV 7UDQV3HQQLQH DQG2[IRUGWR 3XEOLVKHGE\(QGRI DQG0,QLWLDO &DPEULGJH,QLWLDO <HDU UHSRUWVSXEOLVKHG UHSRUWV 'HILQHWUDQVSRUW (YDOXDWHVKRUWOLVWHG REMHFWLYHV 6LIWLQJRIORQJOLVWHG RSWLRQV RSWLRQV 5HYLHZHYLGHQFH 3UHSDULQJLQLWLDO EDVH ,GHQWLILFDWLRQRI RSWLRQVWREHWDNHQ EXVLQHVVFDVHVIRU ,GHQWLI\ORQJOLVWVRI IRUZDUG PRUHSURPLVLQJ RSWLRQV RSWLRQV 6WDNHKROGHU(QJDJHPHQW 0RYLQJ%ULWDLQ$KHDG -XO\ 7KHSURFHVVRIGHYHORSLQJ5,6LVXQGHUZD\±HYLGHQFHLV EHLQJJDWKHUHGIURPPDQ\VRXUFHV :K\ :KHQDQGKRZ 7KH5RDG,QYHVWPHQW6WUDWHJ\SURFHVVHQDEOHVD 3URFHVVSXEOLVKHGZLWK%XGJHW PRUHVWUDWHJLFSURFHVVRIVHWWLQJLQYHVWPHQW 5HVHDUFKSKDVHJDWKHUVHYLGHQFHIRUSRWHQWLDO 3UHYLRXVO\PLQLVWHUVKDYHKDGWRFKRRVHIURPD SULRULWLHVDQGLQYHVWPHQWVVHHNVWKHYLHZVRI VHWRIKLVWRULFDOO\GHWHUPLQHGRSWLRQV VWDNHKROGHUV7KLVLVVFKHGXOHGWRODVWXQWLOWKH 1RZLWLVSRVVLEOHWRVHWWKHDJHQGDDQGEXLOGXS HQGRI DQLQYHVWPHQWSURJUDPPHIURPWKHEHJLQQLQJ )RUPDOQHJRWLDWLRQVZLWK7UHDVXU\DQG +LJKZD\V(QJODQGZRXOGVWDUWLQ7KLV ZRXOGGHWHUPLQHWKHIXQGLQJDYDLODEOHDQGVHW :KDW WKHSHUIRUPDQFHVSHFLILFDWLRQ 7KHUHDUHIRXUSDUWVWRWKH5,6 7KH5,6ZLOOEHIRUPDOO\SXEOLVKHGE\0DUFK 6WUDWHJLF9LVLRQ ZLWKFRQVWUXFWLRQVWDUWLQJIURP ,QYHVWPHQW3ODQ 3HUIRUPDQFH6SHFLILFDWLRQ :KHUHDUHZHQRZ 6WDWHPHQWRI)XQGV$YDLODEOH 6WUDWHJLF6WXGLHVDUHZHOODGYDQFHG +(FROOHFWLQJHYLGHQFHIRU5RXWH6WUDWHJLHV WKURXJKRQOLQHPDSSLQJWRRO 3URFHVVIRUJDWKHULQJHYLGHQFHDQG VWDNHKROGHUYLHZVWRLQIRUPWKH5,6XQGHUZD\ +RZGRZHFXUUHQWO\WKLQN5,6ZLOOORRN" 1 2 3 5,6KDVILYHNH\DLPV« ,WVHHNVWRWDNHDFFRXQWRID $QGZLOOQHHGWRPDNH FKDQJLQJZRUOG« GHFLVLRQVDERXW« D (FRQRP\ D 'HYROXWLRQ D 6KDSHRIWKH1HWZRUN E 1HWZRUN&DSDELOLW\ E *URZWK (FRQRPLF E /HVVRQVIURP5,6 6(&85,7<&/$66,),&$7,21$1''5$)767$786&/,&.$33/<72$// &KDQJH F ,QWHJUDWLRQ F /LQNLQJXSRXUZRUN F 3RSXODWLRQ*URZWK ZLWKWKH1DWLRQDO G (QYLURQPHQW 'HPRJUDSKLF6KLIWV ,QIUDVWUXFWXUH &RPPLVVLRQ H 6DIHW\ G (QYLURQPHQW &OLPDWH &KDQJH G 1DWLRQDO5RDGV)XQG H 7HFKQRORJ\ (',77+,67(;7,1,16(57!+($'(5)227(5,1&/8'(7($01$0( -XO\ +RZZLOOWKHVWUDWHJLFVWXGLHVEHFRQVLGHUHGLQWKH5,6" 5HQHZDOV 5LQJ IHQFHG IXQGV 5RXWH VWUDWHJLHV 6WUDWHJLF VWXGLHVVWXG 6(&85,7<&/$66,),&$7,21$1''5$)767$786&/,&.$33/<72$// FHQJDJHPHQW 5,65,6 VFKHPHVVFKHPHV (',77+,67(;7,1,16(57!+($'(5)227(5,1&/8'(7($01$0( 6WDNHKROGHUSXEOL -XO\ ,QYHVWPHQWSODQ ,QIUDVWUXFWXUHLVNH\WRWKH*RYHUQPHQW¶VHFRQRPLFSODQ 4XHHQ¶VVSHHFKFRQILUPHGWKDWWKH&RPPLVVLRQZLOOKDYHD VWDWXWRU\DQGLQGHSHQGHQWEDVLV 7KH&KDQFHOORUDVNHGWKHFRPPLVVLRQWR«PDNH UHFRPPHQGDWLRQV>WRJRYHUQPHQW@WRPD[LPLVHWKH SRWHQWLDORIWKH&DPEULGJH±0LOWRQ.H\QHV±2[IRUG FRUULGRUDVDVLQJOHNQRZOHGJHLQWHQVLYHFOXVWHUWKDW FRPSHWHVRQWKHJOREDOVWDJHZKLOVWSURWHFWLQJWKHDUHD¶V 6(&85,7<&/$66,),&$7,21$1''5$)767$786&/,&.$33/<72$// KLJKTXDOLW\HQYLURQPHQWDQGVHFXULQJWKHKRPHVDQGMRE WKHDUHDQHHGV &DOOIRUHYLGHQFHXQWLO$XJXVW 7KHH[SUHVVZD\VWUDWHJLFVWXG\LVDQLQSXWLQWRWKH1,& (',77+,67(;7,1,16(57!+($'(5)227(5,1&/8'(7($01$0(
Load more

Recommended publications
  • A428 Black Cat to Caxton Gibbet Improvements
    A428 Black Cat to Caxton Gibbet improvements TR010044 Volume 6 6.1 Environmental Statement Chapter 13: Road Drainage and Water Environment Planning Act 2008 Regulation 5(2)(a) Infrastructure Planning (Applications: Prescribed Forms and Procedure) Regulations 2009 26 February 2021 PCF XXX PRODUCT NAME | VERSION 1.0 | 25 SEPTEMBER 2013 | 5124654 A428 Black Cat to Caxton Gibbet improvements Environmental Statement - Chapter 13: Road Drainage and the Water Environment Infrastructure Planning Planning Act 2008 The Infrastructure Planning (Applications: Prescribed Forms and Procedure) Regulations 2009 A428 Black Cat to Caxton Gibbet improvements Development Consent Order 202[ ] Chapter 13: Road Drainage and the Water Environment Regulation Reference: Regulation 5(2)(a) Planning Inspectorate Scheme TR010044 Reference Application Document Reference TR010044/APP/6.1 Author A428 Black Cat to Caxton Gibbet improvements Project Team, Highways England Version Date Status of Version Rev 1 26 February 2021 DCO Application Planning Inspectorate Scheme Ref: TR010044 Application Document Ref: TR010044/APP/6.1 A428 Black Cat to Caxton Gibbet improvements Environmental Statement - Chapter 13: Road Drainage and the Water Environment Table of contents Chapter Pages 13 Road drainage and the water environment 3 13.1 Competent expert evidence 3 13.2 Legislative and policy framework 3 13.3 Assessment methodology 8 13.4 Assessment assumptions and limitations 21 13.5 Study area 25 13.6 Baseline conditions 26 13.7 Potential impacts 53 13.8 Design, mitigation and enhancement measures 55 13.9 Assessment of significant effects 88 13.10 Monitoring 134 13.11 References 136 Table of Tables Table 13-1. Criteria to determine receptor importance......................................................
    [Show full text]
  • ED222 Aylesbury Vale Local Plan
    Heritage Appraisal Aylesbury Vale District Council July 2019 Heritage Appraisal Quality information Prepared by Checked by Approved by Katerina Koukouthaki Gillian Scott Mark Fessey Built Heritage Consultant Principal Heritage Consultant Associate Director Orlando Prestidge Andy Mayes, Dr. Steven Smith Senior Archaeological Consultant Associate Director, Heritage Technical Director Revision history Revision Revision date Details Authorized Name Position Distribution list # Hard Copies PDF Required Association / Company Name AECOM Heritage Appraisal Prepared for: Aylesbury Vale District Council Prepared by: Katerina Koukouthaki Built Heritage Consultant E: [email protected] M: +44-(0)7825-709-036 Orlando Prestidge Senior Archaeological Consultant E: [email protected] M: +-44-(0)-778-559-2713 AECOM Infrastructure & Environment UK Limited The Colmore Building Colmore Circus Queensway Birmingham B4 6AT United Kingdom © 2019 AECOM Infrastructure & Environment UK Limited. All Rights Reserved. This document has been prepared by AECOM Infrastructure & Environment UK Limited (“AECOM”) for sole use of our client (the “Client”) in accordance with generally accepted consultancy principles, the budget for fees and the terms of reference agreed between AECOM and the Client. Any information provided by third parties and referred to herein has not been checked or verified by AECOM, unless otherwise expressly stated in the document. No third party may rely upon this document without the prior and express written agreement of AECOM.
    [Show full text]
  • E-W Rail Position Paper
    RAIL FREIGHT GROUP (RFG) East-West Rail Position Paper 18 July 2017 RAIL FREIGHT GROUP (RFG) EXECUTIVE SUMMARY The reopening of East West Rail link will play a vital role in supporting economic development of the Oxford-Cambridge corridor, including new housing and infrastructure. Rail freight has a significant role to play in supporting and servicing that development, in supply of construction materials and in facilitating efficient logistics for consumer goods. Estimates suggest that some 85,000+ homes are planned in the corridor over the next twenty years. As each freight train can move the equivalent of 30 houses worth of building materials, and keep up to 75 lorries off the roads, it is clear that encouraging rail freight must be a key imperative. To demonstrate the potential of the route, we have produced a position paper outlining where rail freight is already successfully operating, and where the reopened route offers opportunities for growth. Yet this cannot happen unless rail freight is planned from the outset, particularly given that new and different approaches to funding, construction and operation are being considered. We therefore urge Government to ensure that rail freight is a key part of the development of this route. EAST - WEST RAIL: FREIGHT POTENTIAL 1. Route and Infrastructure capability This study has assumed the route of East- West Rail (E-WR) phase one to be Oxford North Junc. – Bicester Gavray Junc. - Claydon LNE junc. – Bletchley Flyover Junc. – Bedford St. Johns – Bedford Midland. The route of Phase Two is, at present, unclear but will link the Phase One route at Bedford to Cambridge, with a link on to the ECML in the St.
    [Show full text]
  • LCA 4.6 A421 Ridge Landscape Character Type: LCT4 Undulating
    Aylesbury Vale District Council & Buckinghamshire County Council Aylesbury Vale Landscape Character Assessment LCA 4.6 A421 Ridge Landscape Character Type: LCT4 Undulating Clay Plateau B0404200/LAND/01 Aylesbury Vale District Council & Buckinghamshire County Council Aylesbury Vale Landscape Character Assessment LCA 4.6 A421 Ridge (LCT 4) Key Characteristics Location A sparsely settled area stretching between Padbury in the southwest to Nash in the northeast, contained by the settlements of Ridge runs east to Thornborough to the northwest and Great Horwood and Singleborough to west the southeast. The A421 Buckingham to Milton Keynes road runs across the Land drains towards middle of the area. Padbury Brook Sparse settlement Landscape character A shallow ridge with steeper slopes on the northern Small dispersed side and shallower slopes and eroded valleys on the southern side, lying copses between two tributaries to the Padbury Brook. The area is intrinsically rural Mixed farmland use and sparsely settled. Smaller scale grazing parcels to the north with mature Predominantly hedgerows and scattered mature trees. Small woodland copses are parliamentary frequent. General intensification of arable land use in the southwest. The enclosure fields settlement of Nash lies at north eastern end of area. The area is crossed by the A421 road which is heavily used and there is small scale commercial development adjacent to A421. Distinctive Features Geology Glacial till with undifferentiated glacial deposits. Exposures of Village of Nash mudstone (Stewartby Member and Peterborough Member) as well as head deposits in incised valleys. Dispersed farmsteads Irregular shaped fields Topography The ridge slopes gently from 140m AOD in the east to Straight roads approximately 105m AOD in the west.
    [Show full text]
  • Oxford to Cambridge Expressway Strategic Study: Interim Report
    OXFORD TO CAMBRIDGE EXPRESSWAY STRATEGIC STUDY Deliverable 1 – Examination of the Strategic Case for New Expressway East-West Road Links 08/07/2016 Confidentiality: Quality Management Issue/revision Issue 1 Revision 1 Revision 2 Revision 3 Remarks First Issue Second Issue Third Issue Fourth Issue Date February 2016 April 2016 April 2016 July 2016 Prepared by Andi Redhead Andi Redhead Andi Redhead Andi Redhead Edward Shortridge Edward Shortridge Edward Shortridge Edward Shane Luck Shane Luck Shane Luck Shortridge Shane Luck Signature Checked by Adrian Hames Adrian Hames Adrian Hames Adrian Hames Signature Authorised by Mike Batheram Mike Batheram Mike Batheram Mike Batheram Signature Project number 70015095 70015095 70015095 70015095 Report number 1 1 1 1 Revision 1.4 1.5 1.6 1.7 1 | 144 OXFORD TO CAMBRIDGE EXPRESSWAY STRATEGIC STUDY Deliverable 1 – Examination of the Strategic Case for New Expressway East-West Road Links 08/07/2016 Client Highways England / Department for Transport Lead Consultant WSP | Parsons Brinckerhoff Limited Tel: 01223 558 050 www.wsp-pb.co.uk Registered Address WSP UK Limited 01383511 WSP House, 70 Chancery Lane, London, WC2A 1AF Integrated Delivery Team Contacts Adrian Hames – [email protected] 07825643848 Helen Spackman – [email protected] 01793 816555 Mike Batheram – [email protected] Project number: 70015095 Dated: 08/07/2016 2 | 144 Table of Contents 1 Introduction and Study Objectives ......................................... 4 1.1 Introduction ...........................................................................
    [Show full text]
  • River Basin Management Plan Anglian River Basin District
    River Basin Management Plan Anglian River Basin District Annex D: Protected area objectives Contents D.1 Introduction 2 D.2 Types and location of protected areas 3 D.3 Monitoring network 12 D.4 Objectives 19 D.5 Compliance (results of monitoring) including 22 actions (measures) for Surface Water Drinking Water Protected Areas and Natura 2000 Protected Areas D.6 Other information 118 D.1 Introduction The Water Framework Directive specifies that areas requiring special protection under other EC Directives and waters used for the abstraction of drinking water are identified as protected areas. These areas have their own objectives and standards. Article 4 of the Water Framework Directive requires Member States to achieve compliance with the standards and objectives set for each protected area by 22 December 2015, unless otherwise specified in the Community legislation under which the protected area was established. Some areas may require special protection under more than one EC Directive or may have additional (surface water and/or groundwater) objectives. In these cases, all the objectives and standards must be met. Article 6 requires Member States to establish a register of protected areas. The types of protected areas that must be included in the register are: • areas designated for the abstraction of water for human consumption (Drinking Water Protected Areas); • areas designated for the protection of economically significant aquatic species (Freshwater Fish and Shellfish); • bodies of water designated as recreational waters, including areas designated as Bathing Waters; • nutrient-sensitive areas, including areas identified as Nitrate Vulnerable Zones under the Nitrates Directive or areas designated as sensitive under Urban Waste Water Treatment Directive (UWWTD); • areas designated for the protection of habitats or species where the maintenance or improvement of the status of water is an important factor in their protection including 1 relevant Natura 2000 sites.
    [Show full text]
  • VALP Summer 2016 Consultation Responses - Evidence Documents
    VALP Summer 2016 Consultation Responses - Evidence Documents ID Respondent Name Comment VALP16-07-12-00204 Kate Wright Gypsy and Traveller Site Assessment - The Draft Plan states that 'The site has only recently, in 2016, been granted temporary permission for 3 pitches. The inspector concluded that the development would have a significant adverse visual appearance and materially harm the character and appearance of the surrounding area. The site is not readily accessible to local amenities given its rural location.' It has been concluded that this will not be one of the sites which is considered for permanent occupation. This statement should be redrafted to include the following: This temporary site is planned for closure at the end of the existing term ie 09 Feb 2019, or earlier, when the new VALP is in place. VALP16-07-18-00209 Lynne Garton Housing and Econimc Land Availability Assessment - The sites identified are not in line with the Neighbourhood Plan and as such are not supported by the local community VALP16-07-22-00213 Geoff Pearman Gypsy and Traveller Site Assessment - I wish to be assured that the Gypsy Travellers site ( ref GT8 ) will continue to be designated as temporary and as such will be forced close after three years i.e. by early 2019. It is a far from ideal site and totally unsustainable for human habitation. Date: 25/11/2016 Project Number: 1664569/A0 Page 1 of 100 VALP Summer 2016 Consultation Responses - Evidence Documents ID Respondent Name Comment VALP16-07-22-00216 Joanna Male (Gregory Housing and Econimc Land Availability Assessment - Gregory Gray Associates is instructed to write on behalf of Wyevale Gray Associates) Garden Centres Ltd.
    [Show full text]
  • A421 Dualling Upgrade Into Milton Keynes Complete
    A421 dualling upgrade into Milton Keynes complete In partnership with Milton Keynes Council and the South East Midlands Local Enterprise Partnership (SEMLEP) we pleased to announce that works are complete on our project to upgrade a key section of the A421 road into a dual carriageway, which means that drivers can now enjoy a faster and easier route around Central Bedfordshire and Milton Keynes. The 3km of the road has been upgraded to better link Junction 13 of the M1 motorway in Central Bedfordshire with Milton Keynes. The stretch runs from the roundabouts by the junction up to the new Eagles Rest housing development and the Altitude Magna Park logistics and distribution site in Milton Keynes. The A421 forms a key section of the strategic east-west travel corridor and helps underpin the future of the Oxford-Cambridge Arc. Enhancing east-west connectivity is a key component of the enabling infrastructure which will help to create opportunities for the wider area to become the UK’s innovation region, delivering growth in science and technology. As well as easing congestion, the upgraded A421 will help improve access to planned developments in Central Bedfordshire, such as the 5,000 homes proposed in new villages in the Marston Vale area (in our Local Plan), as well as 40 hectares of employment land. Previously there were no safe routes for pedestrians beside the A421, so we built a new cycleway which stretches along the length of the newly dualled A421 and a footbridge over it. The new cycleway is part of a future larger cycle network.
    [Show full text]
  • Balfour Beatty Plc Annual Report and Accounts 2005 B a L F O U R
    EATE ALFOUR BEATTY: B CR CARE Balfour Beatty plc Balfour Beatty plc Annual report and accounts 2005 Annual report and accounts 2005 Balfour Beatty plc Annual report and accounts 2005 130 Wilton Road 130 London SW1V 1LQ Balfour Beatty plc www.balfourbeatty.com Facsimile: 44 (0) 20 7216 6950 Facsimile: 44 (0) 20 7216 Telephone: 44 (0) 20 7216 6800 44 (0) 20 7216 Telephone: Balfour Beatty is a registered trademark of Balfour Beatty plc The year in brief Highlights of the year Strong growth in comparable Balfour Beatty is a world-class pre-tax profits engineering, construction and services Strong operating cash group, well positioned in infrastructure performance Adjusted earnings per share markets which offer significant growth impacted by increased long-term growth potential. We seek tax charge Full year dividend increased to operate safely and sustainably. by 23% Order book at record £7.6bn Financial summary Pro forma† Percentage 2005 2004 Increase/decrease 2004 Three PPP concessions reach Revenue including joint ventures financial close and associates £4,938m £4,239m 16% £4,239m US civil engineering returns Pre-tax profit from continuing operations to profit – before exceptional items £134m £107m 25% £122m – after exceptional items £141m £106m 33% £120m Earnings per share – adjusted* 24.1p 22.1p 9% 22.5p – basic 24.9p 58.7p (58)% 57.4p Financing – net cash before PFI/PPP subsidiaries (non-recourse) £315m £311m £311m – net borrowings of PFI/PPP subsidiaries (non-recourse) £(14)m £(244)m £(244)m Revenue by destination * before exceptional US UK Asia Pacific items and the premium arising on the buy-back £480m £3,728m £258m of preference shares, and including the results Central and Europe of discontinued operations.
    [Show full text]
  • 6.6: Travel Plan 1 Covanta Rookery South Limited Waterman Boreham
    The Planning Act 2008 The Infrastructure Planning (Applications: Prescribed Forms and Procedure) Regulations 2009 Regulation 5(2)(q) The Proposed Rookery South (Resource Recovery Facility) Order Travel Plan 4 August 2010 Document Reference: 6.6 Contents 1.0 Executive Summary 1 2.0 Introduction 3 2.1 Background....................................................................................... 3 2.2 National and Local Policy.................................................................. 3 2.3 Guidance on Transport Assessment (DfT, 2007).............................. 3 2.4 Benefits of a Travel Plan ................................................................... 4 2.5 Aims and Approach........................................................................... 5 3.0 Existing and Proposed Conditions 7 3.2 Site Description................................................................................. 7 3.3 Existing Strategic and Local Highway Network ................................. 7 3.4 Accessibility ...................................................................................... 9 3.5 Public Transport.............................................................................. 11 4.0 Objectives and Targets 17 4.1 The Focus of the Travel Plan .......................................................... 17 4.2 Objectives ....................................................................................... 17 4.3 Targets............................................................................................ 17 5.0 Travel
    [Show full text]
  • Chapter 9 Ecology
    TRANSPORT AND WORKS ACT 1992 Transport and Works (Applications and Objections Procedure) (England and Wales) Rules 2006 THE NETWORK RAIL (EAST WEST RAIL WESTERN SECTION PHASE 2) ORDER DRAFT ENVIRONMENTAL STATEMENT CHAPTER 9: ECOLOGY 133735-PBR-REP-EEN- Document Reference 000009 Author Network Rail Date June 2017 Date of revision and revision June 2017 number 2.0 The Network Rail (East West Rail Western Section Phase 2) Order Draft Environmental Statement CONTENTS 9. INTRODUCTION ........................................................................................... 1 9.1 General .......................................................................................................... 2 9.2 Limitations and Assumptions ......................................................................... 3 9.3 Legislation, Policy and Guidance ................................................................... 3 9.4 Approach and Methodology ........................................................................... 6 9.5 Baseline ....................................................................................................... 23 9.6 Effects ....................................................................................................... 197 9.7 Mitigation ................................................................................................... 325 9.8 Residual Effects ......................................................................................... 376 9.9 Species Scientific Name Glossary ............................................................
    [Show full text]
  • Month/Year 2013 2014 2015 2016 2017 2018 January 2081 3990
    Num of speeding tickets both Officer Witnessed and Camera detected Month/Year 2013 2014 2015 2016 2017 2018 January 2081 3990 3442 2369 1577 4166 February 1778 3241 3894 2833 3138 3899 March 1554 3706 3711 3076 2930 3240 April 748 4774 5547 3941 7464 4055 May 1105 4639 4453 5428 3660 2992 June 990 6558 4667 4295 4559 2636 July 972 6285 4012 3387 5592 2182 August 1265 4035 3612 3022 4402 1916 September 4020 3831 2519 3096 3263 1761 October 2128 3552 3291 2712 3597 2907 November 3553 2980 2127 2468 3653 2773 December 3302 2716 2842 2029 1565 2675 Age at time of offence Age Month 2015 2016 2017 2018 16 January 1 16 March 1 2 16 April 1 1 2 16 May 2 1 16 June 2 2 1 16 July 1 5 16 August 1 2 16 September 2 1 2 16 October 1 1 2 16 November 2 2 3 16 December 1 1 17 January 2 6 3 17 February 5 11 1 17 March 3 9 17 April 9 9 6 17 May 7 5 5 17 June 4 4 4 17 July 11 4 7 17 August 4 3 1 17 September 5 5 4 2 17 October 6 5 4 2 17 November 3 2 4 1 17 December 3 5 1 2 18 January 6 13 10 18 February 14 11 18 18 March 15 19 12 18 April 24 43 16 18 May 15 16 11 18 June 23 19 22 18 July 19 17 11 18 August 14 12 8 18 September 9 14 18 7 18 October 9 20 16 13 18 November 7 18 20 9 18 December 12 18 4 5 19 January 13 21 21 19 February 18 21 27 19 March 34 30 26 19 April 33 64 28 19 May 32 17 24 19 June 38 37 13 19 July 41 58 14 19 August 22 28 21 19 September 10 22 35 13 19 October 20 20 21 13 19 November 11 28 13 16 19 December 23 18 15 11 20 January 19 13 44 20 February 22 31 42 20 March 29 25 36 20 April 24 80 52 20 May 57 46 37 20 June 36 50 25 20 July
    [Show full text]