Dissertation / Doctoral Thesis
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Oxidative Stress and BPA Toxicity: an Antioxidant Approach for Male and Female Reproductive Dysfunction
antioxidants Review Oxidative Stress and BPA Toxicity: An Antioxidant Approach for Male and Female Reproductive Dysfunction Rosaria Meli 1, Anna Monnolo 2, Chiara Annunziata 1, Claudio Pirozzi 1,* and Maria Carmela Ferrante 2,* 1 Department of Pharmacy, University of Naples Federico II, Via Domenico Montesano 49, 80131 Naples, Italy; [email protected] (R.M.); [email protected] (C.A.) 2 Department of Veterinary Medicine and Animal Productions, Federico II University of Naples, Via Delpino 1, 80137 Naples, Italy; [email protected] * Correspondence: [email protected] (C.P.); [email protected] (M.C.F.) Received: 15 April 2020; Accepted: 7 May 2020; Published: 10 May 2020 Abstract: Bisphenol A (BPA) is a non-persistent anthropic and environmentally ubiquitous compound widely employed and detected in many consumer products and food items; thus, human exposure is prolonged. Over the last ten years, many studies have examined the underlying molecular mechanisms of BPA toxicity and revealed links among BPA-induced oxidative stress, male and female reproductive defects, and human disease. Because of its hormone-like feature, BPA shows tissue effects on specific hormone receptors in target cells, triggering noxious cellular responses associated with oxidative stress and inflammation. As a metabolic and endocrine disruptor, BPA impairs redox homeostasis via the increase of oxidative mediators and the reduction of antioxidant enzymes, causing mitochondrial dysfunction, alteration in cell signaling pathways, and induction of apoptosis. This review aims to examine the scenery of the current BPA literature on understanding how the induction of oxidative stress can be considered the “fil rouge” of BPA’s toxic mechanisms of action with pleiotropic outcomes on reproduction. -
Selective Spatial Upregulation of Intratumoral Stromal Aromatase in Breast Cancer Patients: Evidence for Imbalance of Local Estrogen Metabolism
Endocrine-Related Cancer (2006) 13 1101–1107 Selective spatial upregulation of intratumoral stromal aromatase in breast cancer patients: evidence for imbalance of local estrogen metabolism Christian F Singer1,2, Anneliese Fink-Retter1, Daphne Gschwantler-Kaulich1, Theresia Thalhammer 3, Gernot Hudelist1, Ruth Mueller1,2, Klaus Czerwenka4 and Ernst Kubista1,2 1Division of Special Gynecology, University of Vienna Medical Center, Waehringer Guertel 18-20, 1090, Vienna, Austria 2Ludwig-Boltzmann-Institute of Clinical Experimental Oncology, 3Center for Physiology and Pathophysiology, 4Division of Gynecopathology, Medical University of Vienna, Vienna, Austria (Requests for offprints should be addressed to C F Singer; Email: [email protected]) Abstract The suppression of local estrogens levels is of key importance in the treatment of ER-positive breast cancer. Essentially all endocrine strategies act by either suppressing estrogen formation or competitively inhibiting receptor-binding in tumor cells. Nevertheless, little is still known about the local expression of aromatase and sulfotransferase which are the key modulators of intra-tumoral estrogen levels. We have performed immunohistochemostry to investigate the expression of aromatase and sulfotransferase in 42 samples obtained directly from malignant breast tumors, and compared it to biopsies obtained from uninvolved tissue in the vicinity of the invasion front, and to distant breast tissue. We found that aromatase was equally detectable in both tumor epithelial and stroma, but was mostly epithelial in non-malignant tissues (PZ0.00008, Fisher’s exact test). Also, aromatase protein expression was significantly more common in tumoral stroma when compared with peritumoral and distant breast stroma (PZ0.00005, and P!0.00001 respectively). With the notable exception of cystosarcoma phylloides, sulfotransferase protein was detectable only in epithelial tissues, regardless of the location within the diseased breast. -
R Graphics Output
Dexamethasone sodium phosphate ( 0.339 ) Melengestrol acetate ( 0.282 ) 17beta−Trenbolone ( 0.252 ) 17alpha−Estradiol ( 0.24 ) 17alpha−Hydroxyprogesterone ( 0.238 ) Triamcinolone ( 0.233 ) Zearalenone ( 0.216 ) CP−634384 ( 0.21 ) 17alpha−Ethinylestradiol ( 0.203 ) Raloxifene hydrochloride ( 0.203 ) Volinanserin ( 0.2 ) Tiratricol ( 0.197 ) trans−Retinoic acid ( 0.192 ) Chlorpromazine hydrochloride ( 0.191 ) PharmaGSID_47315 ( 0.185 ) Apigenin ( 0.183 ) Diethylstilbestrol ( 0.178 ) 4−Dodecylphenol ( 0.161 ) 2,2',6,6'−Tetrachlorobisphenol A ( 0.156 ) o,p'−DDD ( 0.155 ) Progesterone ( 0.152 ) 4−Hydroxytamoxifen ( 0.151 ) SSR150106 ( 0.149 ) Equilin ( 0.3 ) 3,5,3'−Triiodothyronine ( 0.256 ) 17−Methyltestosterone ( 0.242 ) 17beta−Estradiol ( 0.24 ) 5alpha−Dihydrotestosterone ( 0.235 ) Mifepristone ( 0.218 ) Norethindrone ( 0.214 ) Spironolactone ( 0.204 ) Farglitazar ( 0.203 ) Testosterone propionate ( 0.202 ) meso−Hexestrol ( 0.199 ) Mestranol ( 0.196 ) Estriol ( 0.191 ) 2,2',4,4'−Tetrahydroxybenzophenone ( 0.185 ) 3,3,5,5−Tetraiodothyroacetic acid ( 0.183 ) Norgestrel ( 0.181 ) Cyproterone acetate ( 0.164 ) GSK232420A ( 0.161 ) N−Dodecanoyl−N−methylglycine ( 0.155 ) Pentachloroanisole ( 0.154 ) HPTE ( 0.151 ) Biochanin A ( 0.15 ) Dehydroepiandrosterone ( 0.149 ) PharmaCode_333941 ( 0.148 ) Prednisone ( 0.146 ) Nordihydroguaiaretic acid ( 0.145 ) p,p'−DDD ( 0.144 ) Diphenhydramine hydrochloride ( 0.142 ) Forskolin ( 0.141 ) Perfluorooctanoic acid ( 0.14 ) Oleyl sarcosine ( 0.139 ) Cyclohexylphenylketone ( 0.138 ) Pirinixic acid ( 0.137 ) -
Metabolism of Reverse Triiodothyronine by Isolated Rat Hepatocytes
Metabolism of reverse triiodothyronine by isolated rat hepatocytes. S J Rooda, … , M A van Loon, T J Visser J Clin Invest. 1987;79(6):1740-1748. https://doi.org/10.1172/JCI113014. Research Article Reverse triiodothyronine (rT3) is metabolized predominantly by outer ring deiodination to 3,3'-diiodothyronine (3,3'-T2) in the liver. Metabolism of rT3 and 3,3'-T2 by isolated rat hepatocytes was analyzed by Sephadex LH-20 chromatography, high performance liquid chromatography, and radioimmunoassay, with closely agreeing results. Deiodinase activity was inhibited with propylthiouracil (PTU) and sulfotransferase activity by sulfate depletion or addition of salicylamide or dichloronitrophenol. Normally, little 3,3'-T2 production from rT3 was observed, and 125I- was the main product of both 3, [3'-125I]T2 and [3',5'-125I]rT3. PTU inhibited rT3 metabolism but did not affect 3,3'-T2 clearance as explained by accumulation of 3,3'-T2 sulfate. Inhibition of sulfation did not affect rT3 clearance but 3,3'-T2 metabolism was greatly diminished. The decrease in I- formation from rT3 was compensated by an increased recovery of 3,3'-T2 up to 70% of rT3 metabolized. In conclusion, significant production of 3,3'-T2 from rT3 by rat hepatocytes is only observed if further sulfation is inhibited. Find the latest version: https://jci.me/113014/pdf Metabolism of Reverse Triiodothyronine by Isolated Rat Hepatocytes Sebo Jan Eelkman Rooda, Maria A. C. van Loon, and Thoo J. Vissef Department ofInternal Medicine III and Clinical Endocrinology, Erasmus University Medical School, Rotterdam, The Netherlands Abstract It deiodinates only the outer ring of substrates such as T4 and rT3 (2-4). -
The Importance of Thyroid Hormone Sulfation During Fetal Development
The importance of thyroid hormone sulfation during fetal development Monique H.A. Kester CIP-data Koninklijke Bibliotheek, Den Haag Kester, Monique Helene Agathe The importance of thyroid hormone sulfation during fetal development Thesis Erasmus University Rotterdam - with summary in Dutch ISBN 90 ·901501 0-2 Cover: White Rabbit Photo I Gert-Jan van den Bemd ~ Printed by Ridderprint offsetdrukkerij BV, Ridderkerk The research described in this thesis was financially supported by the Sophia Foundation for Medical Research (project 211). The publication of this thesis was financially supported by Apotheek J.H. van Waert BV and Organon Nederland BV. The importance of thyroid hormone sulfation during fetal development Het belang van schildklierhormoonsulfatering tijdens de foetale ontwikkeling Proefschrift ter verkrijging van de graad van doctor aan de Erasmus Universiteit Rotterdam op gezag van de Rector Magnificus Prof.dr.ir. J.H. van Semmel en volgens besluit van het College voor Promoties De openbare verdediging zal plaatsvinden op woensdag 5 september 2001 om 15.45 uur door Monique Helene Agathe Kester geboren te Sint-Michielsgestel Promotiecommisie Promotoren: Prof.dr.ir. T.J. Visser Prof.dr. D. Tibboel Overige leden: Prof.dr. F.H. de Jong Prof.dr. A. Brouwer Dr. M.W.H. Coughtrie The research described in this thesis was performed at the Departments of Internal Medicine and Pediatric Surgery of the Erasmus University Medical Center Rotterdam, The Netherlands. Labor improbius omnia vinci! De aanhouder win! Vergilius Contents List of abbreviations -
United States Patent (10) Patent N0.: US 7,288,257 B2 Powell (45) Date of Patent: Oct
US007288257B2 (12) United States Patent (10) Patent N0.: US 7,288,257 B2 Powell (45) Date of Patent: Oct. 30, 2007 (54) DIAGNOSIS AND TREATMENT OF HUMAN 5,342,788 A 8/1994 Kunst et a1. .............. .. 436/500 DORMANCY SYNDROME 5,691,456 A 11/1997 AdamcZyk et al. ....... .. 530/405 6,087,090 A 7/2000 Mascarenhas ................ .. 435/4 (76) Inventor: Michael Powell, 150 Catherine Lance, 2003/0007941 A1 1/2003 Cornelius et a1, Suite 1, Grass Valley, CA (US) 95945 ( * ) Notice: Subject to any disclaimer, the term of this patent is extended or adjusted under 35 OTHER PUBLICATIONS U.S.C. 154(b) by 199 days. _ Hannah V. Carey, The American Physiological Society, Physical _ Rev 83; Mammalian Hibernation: Cellular and Molecular (21) Appl' NO" 10/444’845 Responses to Depressed Metabolism and Low Temperature, 2003, (22) Filed: May 23, 2003 PP' 1153'1181' _ _ _ Primary ExamineriRuth A Davis (65) Pnor Pubhcatlon Data (74) Attorney, Agent, or F irmiBorson LaW Group, PC; D. US 2003/0228628 A1 Dec. 11, 2003 Benjamin Borson Related US. Application Data (57) ABSTRACT (60) Provisional application No. 60/382,913, ?led on May $112002’ provlslonal apphcanon NO‘ 60/383’271’ New methods for diagnosis of human dormancy syndrome e on May 24’ 2002' are provided. Human dormancy syndrome is characterized (51) Int C1 by elevated serum ratio of rT3/iT 3 compared to a population 1462K 3'9/00 (2006 01) of normal subjects from Which subjects suffering from A 61K 38/22 (200601) ?bromyalgia, chronic fatigue, obesity, dementias including A 61K 38/27 (200601) AlZheimer’s Disease and related dormancy conditions are C1 2 Q 1/00 (200601) excluded, and the presence of one or more ?ndings related ' A / A / A to reduced activity including torpor, chronic fatigue, insulin (52) US. -
Comprehensive Thyroid Plus Adrenal Report
Comprehensive Thyroid Plus Adrenal Report Jane Doe SAMPLEDate Collected: 2/13/2017 Comprehensive Thyroid Plus Adrenal Report Patient Name: Doe, Jane Batch Number: B0000 Patient DOB: 12/10/1960 Accession Number: Q00000 Gender: F Date Received: 2/14/2017 Physician Jon Doe, ND Report Date: 2/22/2017 Test Patient Results Reference Value DHEAS µg/dL 0 125 250 375 500 107 35 - 430 TSH µIU/mL 0.020 1.260 2.500 3.740 4.980+ 7.030 0.358 - 3.74 T4, Total µg/dL 0.5 4.4 8.3 12.1 16.0 7.2 4.5 - 12.5 T3, Free pg/mL 0.5 1.9 3.3 4.6 6.0 3.6 2.2 - 4.0 T4, Free ng/dL 0.10 0.83 1.55 2.28 3.00 0.87 0.76 - 1.46 Cortisol µg/dL 0.2 11.4 22.6 33.8 45.0 6.5 3.1 - 22.4 AntiTPO Ab IU/mL 10.0 20.0 30.0 40.0 50.0 + > 1000.0 0.0 - 35.0 AntiThyroglobulin Ab IU/mL 20 30 40 50 60 + 97 ND - 40 Thyroglobulin ng/mL 0 20 40 60 80 38 <= 55 Thyroxinebinding globulin, TBG µg/mL SAMPLE0 11 23 34 45 20 14 - 31 10401 Town Park Drive, Houston, Texas 77072 USA CLIA# 45D0710715 (800)227-LABS(5227) / (713)-621-3101 James W. Jacobson, Ph.D., Laboratory Director Comprehensive Thyroid Plus Adrenal Report Patient Name: Doe, Jane Batch Number: B0000 Patient DOB: 12/10/1960 Accession Number: Q00000 Gender: F Date Received: 2/14/2017 Physician Jon Doe, ND Report Date: 2/22/2017 Test Component Flag Result Reference Range DHEA-S µg/dL 107 35 - 430 TSH µIU/mL H 7.030 0.358 - 3.74 T4, Total µg/dL 7.2 4.5 - 12.5 T3, Free pg/mL 3.6 2.2 - 4.0 T4, Free ng/dL 0.87 0.76 - 1.46 Cortisol µg/dL 6.5 3.1 - 22.4 Anti-TPO Ab IU/mL H > 1000.0 0.0 - 35.0 Anti-Thyroglobulin Ab IU/mL H 97 ND - 40 Thyroglobulin ng/mL 38 <= 55 Thyroxine-binding globulin, TBGSAMPLE µg/mL 20 14 - 31 10401 Town Park Drive, Houston, Texas 77072 USA CLIA# 45D0710715 (800)227-LABS(5227) / (713)-621-3101 James W. -
Effects of Bisphenol a and Its Analogs on Reproductive Health: a Mini Review
View metadata, citation and similar papers at core.ac.uk brought to you by CORE HHS Public Access provided by CDC Stacks Author manuscript Author ManuscriptAuthor Manuscript Author Reprod Manuscript Author Toxicol. Author Manuscript Author manuscript; available in PMC 2019 August 11. Published in final edited form as: Reprod Toxicol. 2018 August ; 79: 96–123. doi:10.1016/j.reprotox.2018.06.005. Effects of Bisphenol A and its Analogs on Reproductive Health: A Mini Review Jacob Steven Siracusa1, Lei Yin1,2, Emily Measel1, Shenuxan Liang1, Xiaozhong Yu1,* 1.Department of Environmental Health Science, College of Public Health, University of Georgia, Athens, Georgia 30602 2.ReproTox Biotech LLC, Athens 30602, Georgia Abstract Known endocrine disruptor bisphenol A (BPA) has been shown to be a reproductive toxicant in animal models. Its structural analogs: bisphenol S (BPS), bisphenol F (BPF), bisphenol AF (BPAF), and tetrabromobisphenol A (TBBPA) are increasingly being used in consumer products. However, these analogs may exert similar adverse effects on the reproductive system, and their toxicological data are still limited. This mini-review examined studies on both BPA and BPA analog exposure and reproductive toxicity. It outlines the current state of knowledge on human exposure, toxicokinetics, endocrine activities, and reproductive toxicities of BPA and its analogs. BPA analogs showed similar endocrine potencies when compared to BPA, and emerging data suggest they may pose threats as reproductive hazards in animal models. While evidence based on epidemiological studies is still weak, we have utilized current studies to highlight knowledge gaps and research needs for future risk assessments. Keywords Bisphenol A; Bisphenol F; Bisphenol S; Bisphenol AF; Tetrabromobisphenol A; Reproductive toxicity 1. -
Exposure to Endocrine Disrupting Chemicals and Risk of Breast Cancer
International Journal of Molecular Sciences Review Exposure to Endocrine Disrupting Chemicals and Risk of Breast Cancer Louisane Eve 1,2,3,4,Béatrice Fervers 5,6, Muriel Le Romancer 2,3,4,* and Nelly Etienne-Selloum 1,7,8,* 1 Faculté de Pharmacie, Université de Strasbourg, F-67000 Strasbourg, France; [email protected] 2 Université Claude Bernard Lyon 1, F-69000 Lyon, France 3 Inserm U1052, Centre de Recherche en Cancérologie de Lyon, F-69000 Lyon, France 4 CNRS UMR5286, Centre de Recherche en Cancérologie de Lyon, F-69000 Lyon, France 5 Centre de Lutte Contre le Cancer Léon-Bérard, F-69000 Lyon, France; [email protected] 6 Inserm UA08, Radiations, Défense, Santé, Environnement, Center Léon Bérard, F-69000 Lyon, France 7 Service de Pharmacie, Institut de Cancérologie Strasbourg Europe, F-67000 Strasbourg, France 8 CNRS UMR7021/Unistra, Laboratoire de Bioimagerie et Pathologies, Faculté de Pharmacie, Université de Strasbourg, F-67000 Strasbourg, France * Correspondence: [email protected] (M.L.R.); [email protected] (N.E.-S.); Tel.: +33-4-(78)-78-28-22 (M.L.R.); +33-3-(68)-85-43-28 (N.E.-S.) Received: 27 October 2020; Accepted: 25 November 2020; Published: 30 November 2020 Abstract: Breast cancer (BC) is the second most common cancer and the fifth deadliest in the world. Exposure to endocrine disrupting pollutants has been suggested to contribute to the increase in disease incidence. Indeed, a growing number of researchershave investigated the effects of widely used environmental chemicals with endocrine disrupting properties on BC development in experimental (in vitro and animal models) and epidemiological studies. -
Chang Et Al Thyroid
Available online at www.sciencedirect.com Toxicology 243 (2008) 330–339 Thyroid hormone status and pituitary function in adult rats given oral doses of perfluorooctanesulfonate (PFOS)ଝ Shu-Ching Chang a, Julie R. Thibodeaux b,1, Mary L. Eastvold c, David J. Ehresman a, James A. Bjork d, John W. Froehlich e,2, Christopher Lau b, Ravinder J. Singh c, Kendall B. Wallace d, John L. Butenhoff a,∗ a Medical Department, 3M Company, St. Paul, MN 55144, United States b United States Environmental Protection Agency, ORD, NHEERL, Reproductive Toxicology Division, Research Triangle Park, NC 27711, United States c Mayo Clinic and Foundation, Department of Laboratory Medicine and Pathology, Rochester, MN 55095, United States d University of Minnesota, Medical School, Department of Biochemistry and Molecular Biology, Duluth, MN 55812, United States e Pace Analytical Services, Inc., Minneapolis, MN 55414, United States Received 29 August 2007; received in revised form 18 October 2007; accepted 20 October 2007 Available online 26 October 2007 Abstract Introduction: Perfluorooctanesulfonate (PFOS) is widely distributed and persistent in humans and wildlife. Prior toxicological studies have reported decreased total and free thyroid hormones in serum without a major compensatory rise in thyrotropin (TSH) or altered thyroid gland histology. Although these animals (rats, mice and monkeys) might have maintained an euthyroid state, the basis for hypothyroxinemia remained unclear. We undertook this study to investigate the causes for the PFOS-induced reduction of serum total thyroxine (TT4) in rats. Hypotheses: We hypothesized that exposure to PFOS may increase free thyroxine (FT4) in the rat serum due to the ability of PFOS to compete with thyroxine for binding proteins. -
Ontogenesis of Iodothyronine-5'-Deiodinase
Ontogenesis of iodothyronine-5'-deiodinase. Induction of 5'- deiodinating activity by insulin, glucocorticoid, and thyroxine in cultured fetal mouse liver. K Sato, … , T Tsushima, K Shizume J Clin Invest. 1984;74(6):2254-2262. https://doi.org/10.1172/JCI111652. Research Article To elucidate the regulatory mechanism of ontogenetic development of iodothyronine-5'-deiodinase in the fetal and neonatal period, fetal mouse liver of the 19th day of gestation, in which no iodothyronine-5'-deiodinating activity was detectable, was cultured in Dulbecco-Vogt medium supplemented with 10% thyroid hormone-depleted fetal calf serum, insulin, hydrocortisone, and thyroid hormones. Iodothyronine-5'-deiodinating activity of the homogenate was assessed by the amount of iodide released from outer-ring-labeled reverse T3 and expressed as picomoles of 127I- per milligram of protein per minute. The enzyme activity was induced in a dose-dependent manner; optimal concentrations for insulin, hydrocortisone, and thyroxine were 1 microgram/ml, 0.4 microgram/ml, and 10(-6) M, respectively. Without supplementation of either hydrocortisone or thyroxine, no 5'-deiodination was detected. The enzyme activity was observed after 3 d of culture, peaked at days 14-20, and then gradually decreased. Lineweaver-Burk analysis revealed that the increase in activity was primarily due to an increase in Vmax (day 3, 0.2 pmol/mg protein per min; day 20, 2.5 pmol/mg protein per min). Half maximal thyroxine (T4) and triiodothyronine (T3) concentrations were 1 X 10(-7) M (free T4: 4 X 10(-10) M), and 2 X 10(-9) M (free T3: 5.0 X 10(-11) M), respectively, whereas reverse T3 did not elicit any activity at 10(-8)-10(-6) M. -
Produktinformation
Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic SULT1E1 MaxPab mouse polyclonal antibody (B02) Catalog # : H00006783-B02 規格 : [ 50 uL ] List All Specification Application Image Product Mouse polyclonal antibody raised against a full-length human SULT1E1 Western Blot (Tissue lysate) Description: protein. Immunogen: SULT1E1 (AAH27956.1, 1 a.a. ~ 294 a.a) full-length human protein. Sequence: MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSG TTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMN enlarge SPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPN PGSLPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKE Western Blot (Transfected DIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQK lysate) LSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI Host: Mouse Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. enlarge Testing: Storage Buffer: No additive Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and