OBSERVER Vol. 101 No. 17 March 16, 1994
Page 1 All Talk, No Action An Evening of Open Discussion With the Student Forum Michael Poirier Page 2 Hit and Run Slew of Parking Lot Accidents Michael Poirier Classifieds and Personals Page 3 Experiments and Vision Professor Lectures on Avant-garde Film Linnea Knollmueller This Year’s John Bard Lecture Nathan Sivin, Expert on Chinese Culture and the History of Science Anne Miller Page 4 Faces of Bard Stephanie Chasteen Jeana C. Breton Rob Cutler Jeana C. Breton Page 5 News From Larreynaga [Sister Cities Program] Straight From the Stars Shameless Filler Matthew Gilman Page 6 In the Absence of Light Michael Sylvester Page 7 Faculty Responds to Student Participation Menage ‘94 Erotic and Romantic Readings Tonight! Page 8 Who Needs a Hotline? Mary Lindsey “A Subjective View” Josh Ledwell Page 9 Leary! Snipes! Movie Review! Sugar Hill and The Ref, Two Strange Films in March Shawn Taylor Page 10 Bard Life? Jeana C. Breton Senior Class Column Page 11 Bitter? Me Too. T.W. Page 12 Calendar rt.:eflmtcW. .tamp
...Jar Dtta-52. la!lasultJonaliU'bKdptlou-- JaafVUJ• The BARD ~~ . - - - ~ - ~ - V 0 L U-~- E 1 0 1 * N U M B E-R -1 7 B A R D C 0 L L E C E * A N N A N D A L E • 0 N • H. U D 5 0 N * N Y 1 2 5 0 4 MA R C H~- 1 6.. * 1 9 9 ~ ..... ~ . .
"Jam a foJAk, J·will stick n }!OLA J -SoJAel'l Kiel"keeaaJAd as a child
The Student Forum conducted its second this issue. Those favorQfshortenb_:lglnter-·. perspective on the issue. come when meetfug of the semester last Wedne5day. session discussed_ the di~culty of securing . the administration is claiJI:!ing to be ~-cting in . Featured o~ the ~genda were open discus- summer internships or jobs because classes our [students'] interests, they are not really - · sions concerning· the end in May, much later than most other workingWithus?... }ustbecauseBarqdoesn't length of the interses- colleges'. Furt~rmore, &!me ~~d~ts, par- help us much with fin~ing in~mshlps does sion, and ideas of wl\at ticularly international students, ·do not not mean we should get rid of lntersession; should be included· in hav~ ~he ·money to return home over the we should be looking for ways to· improve the upcoming new Stu- break and must spend the six weeks of In- it." - · · dent Center.· Since no t~rces~ion at a lonely, frozen campus.' Dean of Students Shelley Morgan re constitutive. a~tfons or· .. ~those' ~pposed to changing intersession sponded that the w~ole point of the discus decisions were expected· po1ntedoutthattheextra timeisinvaluable sion was that student opinion will greatly or achieved, these dis- for Jariuaty internships, and seniors will affecttheBoard'sdecision. 'W~wo~ldn'tbe cussiqns were intended lose _the extra two weeks to work on their here if it didn't matter,~~ she said. as a preliminary sampling of student opin- project. As Educational Policies Committee Turning to the imminent StudenfCenter, ion. · Chc!ir Renee Cramer argu~, "I like that t~e Forum discussed the ideas provided by Apparentiy, the College's Board of Trust- seniors get to hand in their projects, then. last semester's Student Center Co~ttee, ees is planning to consider shortening the relax and have fun for those final weeks." and those initiated by this semester's new length of the January break by two weeks. Cramer confirmed that. a formal poll of committee. A committee representative Two years ago this week, the Forum passed student opinion is going to be conducted to stated that the College may ·begin breaking ·a resolution requesting the administration determine wheth~r the student body ap- ground this fall. to "reevaluate" the academic calendar. provesordisapprovesofchanginglnterses- Possible locations for the Center are ncar Twenty-four months later, the Board is £1: sion.Shealsoexplained thatthefacultyhas Sottery,onthefieldbetweenKl~neCommons nally responding. ~- not reached a consensus decision either. and thelibrary,orinfrontoftheRavines. The ~tudent opinion was ~ghly divided over - Brent . Armendinger offered a different issue of how centrally located tl}e Center ' ' • ·- " , conti7n~e~ on PQge 2 THE BARD OBSERVER March 16 1994 "2 · · News · · \. · .· ·~ ..... ;:~. · ~ ··- .~ . ~ ~ '"' ~... . /·,, ··~ ·-i·': ~:--;.... :_" ...'.. ...
··e~c.~.. . :
S~SUBLETS Hey Rabbit! Me, myself or I did C.T.B.B. Tortureisgoingtoloose The Graduate school of Envi not pen the personal above, as it's charm real fast if you don't ronmental Studies is lqoking for perhaps you might have thunk. appease me soon! Boldly Yours, student housing for this summer Sweet pea, I will only wear a cow "Innocent little ole me." . According to Kim Squillace, tre another car," said Squillare 'This is -mid June through mid August. boy hat if you lead me' to the DiredorofSafevandSecurityat Bard just a case of people being irrespon Ifyou wish to sublet or rent, please promised land - or at least Wis The International Student Or College, ~has been a dramatic sible.11 sre reportOO that JroSt of the call 758-7483 or see BetteinSottery consin... -from your Cheesehead. ganization organizes its annual iin'ease in the incidents result in repair bills. 101. cultural show. Anyone interested number ci au- cnropnting to over $500, and only My darling best friend Pam: I'll in performing contact t01robilesbeing tarely does tha driver reveal w or The National Library Poetry is love you always, but please stop ANGELINA KOURABAU Box# damaged by himself. · once again holding a contest with freeking me out! Are you sure 964. othercarswhile Squillare stated that Security ~ over $12,000 in prizes. To enter, you don't need a sweet, cuddly parked. on cam- been able 1o rolve a handful of incl.:. send ONE original poem, any Kestral in your life? Or, perhaps Stacie: Thanks for the fish! Love, pus. Theseaai- dents by matching the damage and subject or style, to the National we can find a tan, dashing Centaur Jeana.. P.S.It'snew name is Frenzy. dents have paintremnantsofonecar1oanother~ LibraryofPoetry,11419Cronridge for you instead. Your darling best proved ex- She said that this does· not happen Dr., P.O. Box 704-YF,OwingMills, friend, Aphrodisia. Looking fo:r: a shur-fire cure for tremelycostlyto very often, and even then the perpe MD 21117. Limit of 20 lines. In da blues? Dye yer hair. Then theaus' owners.. ft.:rrtrer complicated traror only reluctantly admits his or clude name and address on top of Hey! Someone stole my. bathing contact Poe. G. Mahoney via by the fact that the violators usually her guilt. 'Ire driver is usually held the page. Deadline: March 31, suit and a pair of shorts from the campus mail, NYC. And Carrue fail to step forward liabletoplyforanydainagesircurred, 1994. locker room in the gym. The suit on! This past week alone, there have whether or not their insurance is patterned and laces up in the bemtwomJreirridentstoaddtothe ronveredtheinddent lOOs OF MARVEL COMICS front. The shorts say "Harker Help! Need to teach a lesson to growing list of accidents. One vehicle fuonecase,astudentstruckacarin _ FOR SALE, CHEAP! INCLUD Academy Staff." If they have a strong-headed Freshman! Please was parked at Cruger Village, the theStevenoon Gyrunasitun parking INGX-MEN,SPIDERMANAND found their way into your closet, send proof that Eddie Vedder does other in the main lot between the lotleftanoteonthecarandrontacted 01HERS. 1 @ .75 OR 2@ $1.00 1000 curses be on your head (un not sing for Stone Temple Pilots Computer Center am Buildings and Security.Squillacesaid thattheowner CONTACf JANCY AT 752-7408. less, of course, you return them to to box828. Grounds. Squillace confirmed that ofthecar,alocalreferee, was then able me through campus mail box both of these two parking areas were togetintouchwith~studentthrough To my most beloved wife 1255). NOT WANTED: Anything relatively cleared of snow and ice, Security. '1twasgreatthat[thestudent] Moriemurinultae. Sed monamur! ''Charming." Send to box #1029. rerrovingthatexcusefortheincidents. contacted us," she conti:imed, urging Keep your chin up & give th~m At Upstate Films check out The By presstime, no one had claimed anyone who accidentally damages a Hell! -Your sweetheart SnaPf!er, March 25-:-31, or Far Away .Dear Gretchen& wife, A wood responsibilityforhittingeitherofthose parked car; or wit:l\e$€S such an ac-- So Close, March 26-29. Call the chuck would chuck if a wood parked Cm'S. _ • - cident to report the incident to Secu- S.B.-All I need for happiness is ·th~aterat876-2515formoreinfor chuck could chuck wood! Peace, '1t's pretty obvious when you hit rity iinlnxiiately. 'il. you & Garth Brooks. Love, Me· ·mation. Love & Tofu! -Gretchen _- Forum continued Passover Pizzazz - :c -- amtfiiiiiii7fom fiiSt page - committee, Laurie Curry, prom- standardized evaluation forms shouldbewasdebated, takinginto ised that E-mail is soon going to filled out at the end of a course, consideration the need for exten:.. be made available to the student and promised revisions to this 1 will be ~aving a Passover seder for ~ive parking spaces and access to body. (Watch for an article on this evaluation process. · Bard students on the second.night of -- roads. - . development next issue.-ed) SLC - Shealsostatedthatanewround As to what facilities should be member Goldie Cider confinned otCurriculumProposalshasbeen · Passover, Sunday, March 27. If you_will loeated in the new Center, debate that new options for campus re- put forward to the College, which centered on whether current ser- cyclingarebeinginvestigated,and she characterized as a ·"working be on campus, and would. like to vices should be moved or new GilAlphonsoaffirmedthatoneof document" for faculty and stu participate, or if you have any facilities created. Moving the the Alumni. dorms is going to be dents. Copies of the document health and counseling services established as theme-housing for have been placed on student questions, please contact· was considered, as well as relo- a "test period" of co--ed doubles. govemmentreserveatthelibraiy. Sandy Kalm through campu~ mail or · eating other facilities, such as re- -'The EPC has been busy as well; · Planning Committee Chair Jeff cording studios and the bookstore. conductingfacultyevaluationswhile Rhyne urged clubs to submit at 752-7410 by March 20. Ciub space for meetings and se- following up on Forum resolutions claims to the Laundry Fund as cure storage was considered, and from last semester. Concerning pro- soon as possible. Money from the ·debate over a student-run coop- fessorsnottumingincoursesontime, Laundry Fund may only be in erativebookandsupplystorewas and making the course catalogue vested in Hcapital expenditures/t Attention scythian hf?rdes tabled until a later meeting. notoriouslylateanivingtostudents, i.e. equipment. Rhyne said that · -First-year student Adam Weiss Cramer said that the committee is clubs must have provisions for II<.< • drafted the winning design of the "stumped" and looking for ideas. preventing any purchases from Some of u.s don't l'ike Freshma-n Student Center contest. His coin- The Registrar'sOfficehasstated that being stolen; and thatifthemoney Seminar, yet some others do. For those· puter generated graphics and el- theywillnotprintinthecataloguethe is not spent by the end of the who do there i:s a H.erodotus class thi.s evations were praised as a source coursestha.tdon'trnakethedead1ine, semester, the funding is lo~t. of inspiration by the Committee. butasCramerexplained,''thathurts Finally, ~ruce Kuznicki was spring, unfortunately some of us are - Ultimately, Student Judiciary usmqrethanitsendsamessagetothe elected to the SLC after a current ' taking, science· cl:asses and· can't take it. Board Chair Kupil Gupta re- faculty." member had to resign because of minded the Forum that "this is an As to the resolution appealing - othercomrnitnients. Kuznicki ran . If you are one of these people and you ongoing process, and we're not tothefacultyevaluatorstopermit last semester, but was elected the · want to talk about Herodotus, a group· going to build the thing tonight." anonymous- student' testimony, second time around on a platform In other Forum news, the Stu- Cramer said that ''it doesn't look that students "need events and will meet on, Tuesday nights. Contact · dent UfeCommittee has been ex-· like it's going to happen." She they need safety/' '11' Luis Alcazar•Roman at 752-7352. tremely aetive. The Chair of the reaffirmed the importance of the · THE BARD OBSERVER March 16 1994 Features , · 3 ·
If there is one thing MTV has school is crucial tO study for sev- the ~al world as something we movie this way is abhoJrent to the violence,sotheseavantgardefilms not been accused of, it is a lack of eral reasons, according to Pruitt _ would like to transform, so fihns Soviet." Asartistsdemonstratedthe were not popular. So in the 3Us style. With its barrage of images 11After the Bolshevik revolution should be about the real world- inherent artificiality of paint on directors got into trouble, and the · · loosely form- of 1917,-the Soviet film industry how it ought to be, not how it is." canvas and writers explored the political situation would not sup ingacoherent wasgivencarteblanche,somany Rather than use the American insufficiency of words, the avant portthem." theme, MTV young directors could experi- method of simply telling a story, garde directors were showing that Intell~ essays like Man With has carved ment. The new government with the focus on narration, they cinema is an illusion. aMovieCamera arerareinthisday out a distinc- wasn'tcentralizedenoughtocon- u~ every artificial technique According to Pruitt, one key andage:"M'lVdoesthesamekind tive niche for trol the artists, so there was a lot of available-out of foe~~ shots, shortcoming of the dominant film of montage, but for surface effect. itself in freedom and resources," he·said. rapid editin& slow motion, among school today is that it is too depen- That's not to say there aren't good· today's pop Along with this freedom came a others-to dominate reality. The dent on narration, and ''emotions rock videos-1 jilst haven't seen culture. Inter- philosophy. Because the govern- ideawasnottocopyreality,norto areservedtotheaudiencethrough any of them," Pruitt noted cyni- estingly, and menthadlittlemoneytogiveand _ makeanimageoftheworld,buta narrative manipulation." Vertov cally.Wheremontagewasamethod some· might say obviously, this film' stock was rare, ~kers stateme~t about i_t. "With the ab- . ~to tell a story in this fashion. of thinking and seeing for Venov, eaitirig (or montage) stfle is in spentagreatdealoftimetheoriz- sence of sound, the films had to Hefeltthatthecamera'seyeissu- imageswereappreciatedsimplyas no way new or original. Russian ing about the kind of films they articulate themselves by the way perior to the human eye, and saw images, and the hero of Man is directors like Livov Vertov were wanted to make, and how. to dra- the shots were spliced together. By . himself as an intellectual worker humankind in general, theglamor using this method in silent films matize their ideas. The young controlling the montage, thedirec- and not an artist. He even attacked ousquickfixentertainmentofMIV 70 years ago. In his lecture for the Soviets were interested i~ .re- tor could rontrol the effect. The other filmmakers for being deca- is easier to watch but lacks the Freshman Seminar series, film thinking film; influenced by the context was more important than dent and bourgeois. However, his philosophy of avant garde film. pro_fessorJohnPruittraisedinter- cubists and other modem art what people actually saw," con- filmsarehard to watch. '~film This year's Freshman Semi esting points such as this as he movements, this film school was tinued Pruitt, who showed.scenes makes no sense if you sit and day- nar lecture series·should prove highlighted Russian avant-garde particularly responsive-to trends from Man With a MtJUie Camera to dream. It makes sense when you · to be an interesting and in films _of the 1920's. Films like in other art fo.rms, including exemplifyN5points.'Wearemeant thinkaboutit.Thefirsttimeyousee depth look at how various VertovsMan WithaMovieCamera painting and literature. to think about what we're seeing. this it is like seeing a James Joyce disciplines reacted to the are little talked about anymore, . The philosophy which evolved The audiences should be alive, and novelgoingacrosstheTimesSquare modern age. They take place exceptbyfilmbuffs,(butareworth _in the 1920's was also influenced respond to the constructs. Arneri- banner," he joked. Audiences of Tuesday at 5pm in the Oli-n the attention they receive.) by Marxist thought~ '''!he ~viets _ cans s_~e film in_ .~n ~~roti~ _. ~e time rea<;~ed the ~e way. Auditorium, and everyone is __The Russian avant-garde film chose to reject reality. They saw voyeuristic' state. To get lost in a '1bey wanted ~romance, sex, and . welcome to attend. ~
On Tuesday, March 8, at 8 p.m. books and numerous essays he's has studied abroad in Taiwan; investigation of the social rela this search for precursors devel inOlinAuditorium,NathanSivin, editedand/orwrit_ten.~onghis Singapore; Cambridge, England; tions of Chinese medicine (from a oped into a conflict. Modem as Professor of Chinese Culture and many professional responsibilities and The People's Republic of pointofviewwhichcombinesthe sumptions are different from an the History of are his roles as Vice-President of China. He has n'Ceived grants conceptual tools of history of sci cient times because now we are Science afthe theAmericanSocietyfortheStudy from the Ford Foundation, Euro- - ence with those of cultural and less certain- about our ideas. University of of Religion and Advisory Editor pean Association for Chinese social anthropology and sociol However, ideas were not uncer Pennsylvania, for Far EastTechnologyand Culture Studies, and the National Science ogy}; and a study of the theoreti tain in classical Greece. Modem presented the . He is a member of numerous Foundation and is c~rrently an cal strt,~cture of Chinese alchemy. textbooks have become our annual John org~zations, including the Uni honorary professor at the Chinese -Sivin, who describes himself ~s schools as opposed to argument. Bard Lecture. versity Seminar on Traditional Academy of Sciences in Bejing. a "dilettante", opened his lecture There has been an increasing Sivin dis- China at Columbia University, Among Sivin's current projects stating that "From the time of failure of modern people to cussed the and is also a Fellow of the are a forthcoming selection of es- Aristotletoourtime, we have been stimulate intellectual interest. The originsofphi- American Academy of Arts and say_son Chinese science by Euro- looking for predecessors." Man problems have seemingly losophy in ~a. _ Sciences. S~vin received his Ph.D. pean and American historians in has always been curious about spawned from solely concentrat Siviri'sworkhasfocusedonsci- - in History of Science from Japenesetrans1ation; two vol:umes the ideas and the people who has ing on the practices developed in enceand~,ashaveth~eleven H~~d University in 1966 and of his ow1_1 essays; an extended come before him. In the 1950's continued on page 11
THE -PINK HOUS.E • COLLISION REPAIR • GlASS REPLACEMENTS BED AND BREAKFAST. • INSURANCE ESTIMATES • fRAME SfRAIGHTENING 124 TOWING ANNANDALE ROAD ~R I . ANNANDALE-ON-HUDSON, NY 12504 ; ONCAMPUS SHOP 914-876-1242,· HOM~ 914-758-3948 ~~;_:wooc:.;:E:~!s:,!~~ '19SI WEST RED HOOK 7 • • ".· ' Stephanie ~ Chasteen is from ·supposedly care about them. of Rocky Horror, as well as not . accepted in . normal to graduate scbo9l for social psy -New Hampshire. She came to As an aside, she added, "the organizing the reading by les- academia- still very new; it's chology, and. will 1'probably be B~rd because "it's purty," and personal is political." bian author- Sarah Schulman a legal form of discrimination." come a _research professor stuck iQ · - -because she tha~ tQok place last Friday. Her Stephanie is not pleased by this some stuffy office ~r the rest of my received an Stephanie, who describes other activities have included and feels that "we need to ac- Iife."HerlifetimegOal,however,is ·EEC (Equa.l herself as "devastatingly being the co-head of .BAGLE, ceptdiversity... then the world "tomake~difference" moSt likely a·nd Excel- handsome, and devastatingly "recently disbanded for a va- might be a happier place." in the form of 11policy change lence Cost) intelligent," is also ·the ·Peer riety of reasons - including a . ~ugh psych·applied to hoino- scholarship. Counselor of Obreshkove lack of communication", and AfterBard,Stephanieplanstogo p~o~~ and biphobia." She is cur- where she has "a bunch of finding time for hobbies. These · ~~~~..,_~..... ----.------~----- ..... rently a Jun- wonder(ul little freshlings." ·include: masturbati_ng, flirting, ior II major- She took the job because she 11 furthering -the academic . ~-~ ---·· _. :. ;·-. . . -: .-· ing in. psy- . wanted a "position of respon- pause," and ,,psychoanalyzing ,- chology;Shedoesnotyetknow sibility," and ''li~ed the idea of my friends." ~: What she Will focus her senior helping othet: people through -~ ~ projecfo~ riext-yea~, but is at- their freshman year." The best She also · says that she is : ~osf positive it will. include . thing about being a PC, she "dedicated to social change · re"Sea·fch :i~volving the psy~ says, is the "people in my through· psychological re - ~ chology. of women, possibly ·dorm, and haingmore of a feel search," and g_ets" "fucking >:· relating feinminism to gay and of the campus and the admin- pissed off by well intentioned :: ', fes:b~an studies. - . istration." The worst _t!ting is homophobia... ! like being bi- ;>' ·'~. c · · · trying to get people to gcr to sexual." She explained that . ~-.;- ..:~ Whe_ri asked what she liked dorm meetings and participate ''I've known since 7th grade; I :·· best about Bard, Stephanie re- in adivities. ." · look at women and drool." She : plied ~ "all the purty girls and is also very concerned about ~ -boys." When asked what she Planning activities is some- gay\lesbian politics because ~.: liked least about Bard, she was thing Stephanie's friends say "it affects m·e and a lo·t of my ~;_ ~f: little ;more serious an_d said, she is ery good at. "She always . friends, and I also feellitera < '~th.e lack of community.'; This knows what she's doing; she .ture on racism and sexism is ·----u-psets· her greatly because · has a good head on her shoul- rolling along well and is well . . . . _: upeopl~ don't seem to be in- ders."Recently~sheorganized developed where as the ho- ·. Stephan·le Chasteen ./·_~pl v~ . _in_. thing~, - ·when· they and_ perf~~-~ in a pro~uction mophobia, e"tc.literature is still . _ ·'' ~ ~---' ~ !t,:~.~ ••••••••••••••••••••••••••••• • . ••••••••••••••••••••.•••••••••••••••• ~ ••••••••••••••••••.••• _: . , Rob Cutler is a Serii9r n ttoin . a place you can grow without adrenaline rush,.. but it has its dOCides to go ~, re Will not be Africa, the Galapagos Islands and ·.. ': Greenwich, ·connecticut. He· is. the realities of the world in- drawbackstoolikenotbeingable -ta]Uired to work iri oroer to~ OUna,. but thiS sl:murer he will be .- ~;_(!q~b~(~jOring in ph:fsics and . tervenirig." .. The only problem ·to leave campus whil~ ..on shift tuition. He is very happy especially working as a ~ aunp coun- · ·.·~. .: · ·~-~ : _·· . · · · · math. His he has with Bard is that it can and ~'you can't talk about what since Vandertllt wasooa of his top selorin~Rob'slifetilregoolis _.", math senior sometimes be ·"too much of a you see or hear." The biggest choices. . · "tobehappy,tohavekids,afumily,to .-; project about good thing." problem,however,hesaysisthat gettherrostoutoflifeandtodOalot . _ " E d g e d "people who know me come to He would also like, however, to as I go along." He would also like Domination When Bard begins to start me instead _of calling EMS even leamTaeKwonDo;andtravehmre. . someday to fotind a foundation for of the N- mounting,Rob,likemanyothers whenlthinktheyshowd... ifyou!re Someday he hopes to gri to Egypt, Children. · · Cube," was here, simply "has to take a break in doubt you should call because finished last fromit."Hedoesthisthroughlittle that's whatwe'retherefor-even semester. He things like going for~ walk or on fo~ the little things~" is currently a mall trip.. His hobbies help too . .:- wo-rking" on- his physicS project TI).ese include: reading, traveling, Hisfriendsdea:ribehimasa "toter- .... .- "on non local effects in electrody- computers, sCuba diving, doing ant,intellectual,peopleper9Jt"aswell . ·· ·.,na:mici/ .'Whenasked \\Thy he was volunteer work,-teaching kids as "really tall, Unique, weird (with a . . · 50 mtere5ted in these two field~, how to swim (Rob teaches 2 atpital W), nice, energeti.c and did I ·. Rob replied "it comes easy to me; sWimrni.rig clasSes~ at Bard) and _mentiontall?'C>fhimseltRobsays, "in that's just the way my mind talking~ friends. somewaysl'mchildlikeUreaJlylike w{)rks." · · ·cNldren and~ understand them), . . . .'·~· Rob - says~"r getthe most out of but, when~, rm serious - · r fie'~ . ai Bard. -on a _Dis tin- life. \\'hen I do t!llngs, I do them completely!'' His friends agree; they ~ guished -Scientist Scholarship, all the way," and this applies to a knowthatheknowswrenasituation ~~t Rob _says the most impor- greatmanyactivities.Forinstance, ·calls for being serious' ard when it's : t~~t rea·son he chose Bard was Rob is an EMT (eme.rgency med.i- alrighttobesilly.OnefrienddesCribes .. __· .bicause the "professors are so · cal technician) and a··:member of Robas"agiantteddybearwhogives · · ·pleasant.~.they remembered Bard EMS. He is on call at least goodhugsthatmakepeoplefeelbet ·_:rrie from when I first visited · twelve hours per week (last se- ter;he'svel)', very, very caring.~' ~aid -." .. o-th~r · scho~ls' ·. didn:Ot mester it was anywhere from 24- . J~Civ~__ !!!l\e for rne.•i The thing. 36). He says that being on EMS After Bard, Rob plans to attend hEdikes best about Bard now is keeps hint on his toes_-"wheri graduateschool.Hehasalreadybeen thit ·;'i(s like a little Utopia, you're asleep... at 3AM and your' ~ted to Vanderbilt University. · a\vay from the real world-it's radio goes off, you do get an ~ gave him a fellowship: if he Rob Cut.ler ...... •...... ········~······ THE BARD OBSERVER March 16 1994 . . Another View · 5 - ..------~ - - ············································~ ~ News.from Larreynaga ~ . . . . • This report is based on the latest E-mail info from Jonah Gensler, Sister Cities Project: Coordinator in Nicaragua (not to mention Bard graduate) editing and extra relevant Bard • graduate). Editing and extra relevant Bard commentary by Phoebe McDuwell. : . . ~~water project is in motion, with trenches already started under the direction of the Larreynaga Development Committee." Bard's Sister Cities project will soon be collecting clothes which will be used to pay those working on the improved water system in Larreynaga so keep us in mind before tossing what you don't use. . - "Last month it was the street light, this month general store o~er Yoyo Bermdez is : building a bar across the s~ from his store (and right next to the health center). Is the • bar adjacent to the health center so that the drunks can easily stumble into the doctor's : office, or because booze is a cheaper alternative than ~cine these-days? R-egardless, • its going up and will certainly add activity to Larreynaga center." Last semester Bard's • SC project raised money to send supplies to the schools inLarreynaga. Here in the states : basic school supplies are much cheaper than in Nicaragua. The latest request from those • in Larreynaga is that the same type of supplies could also be sent to the Health Center. • : One of our newest members, Elane Fernandez has taken the responsibility to locate the • cheapestsuppliesfoundin thisarea. Hall goes well, these will be sentdown to Nicaragua : in the March shipment. · _ · . • : '1'm Uonah] part of a working group that is organizing the July 21, 2?, and 23 • conference in Managua called 'Sister Oties:Just and Sustainable Relations.' July 19 will : be the 15thanniversary of the Nicaraguan revolution." If my mathskillsarecorrectthat • would mean that in July of 79 the Somoza dictatorship in Nicaragua was taken from : power. Jonah suggests that those hoping to attend this conference might want "tO plan • this into their time'' and come early. Despite the fact that government powers have • changed in a variety of ways since the revolution, I'm of ~ opinion that ~ 15th Anniverscny will be an opportune time to reflect on the significance it has had lor the Nicaraguan people. Also it would begood to note thatfashiondoesnothaveto be a huge considerationinrevolutionarycelebrations. Part ofasuccessfulrevolutionis theelement of surprise, therefore it is necessary to come as you are. • Many Sister Cities members are preparing for this areas own conference on • Saturday April30 to be held at th_e Hawthorne Valley school in Harlemville: NY. (My old sch,pol.) The goal of this conference is to promote an under- • standing of the most recent issues facing Nicaragua politically and eco-: nomically on both local and na tionallevels. It is also expected to compliment • the previously mentioned conference in Managua. If you are interested in : more information, show up at the next Sister Cities meeting on Thursday at • Spm in o~e of the Kline Comll}it~ee rooms. Please note that the conference : organizers request that anyone attending the after conference fiesta sho~ld • bring dessert and BYOB. . : ···················~·························· · Straight From the Stars ~~ Pisces (February 19-March 20): Those who count their chickens before they hatch will only end up with egg in their face. Aries (March21-April19): If you'~ lookingforcommittment, you willnotfindit this week, but maybe in a few months. · · Taurus (Apri120-May 20): Goals that are hard to reach will reap the greatest rewards. Gemini (May21-June20):J'ravelinga long road will not necessarily take you very far; look closer to home for what you really want. . Cancer (June 21-July 22): A small prank may have grave consequences, better to leave the humor to the true comedians. Leo (July 23-August 22): You walk a thin line $is week -between happiness and overwhelming joy. Good for you! · Virgo (A~gust 23-September22): The grea~es~ of gifts most often come in the smallest packages, and no package doesn't mean that you have nothing. Libra (September 23-0ctober 22): An unexpected consultati_!>n causes you to change your mind about something very important. - - Scorpio(October 23-Novem~r 21): Xour taste in most ~verything will change unex pect~ly, but after a few days you11 return to your old self. Sagittarius (November 22-December 21): Oosed curtains will keep the outside world fro~ you, but not you fro~ it, so don't hide. _ . . · Capricom (December 22-January 19): Romance is in the air this week. The nights will tum out to be the hottest they've been in awhile. Aquarius (January 20- Febraury18): An old pain intensifies and an old joy dimmers unless you find it within you to forgive. · THE BARD. OBSERVER ~. March 16 1994 6 · Another View - . . In the Bbsen~e of light · by Michael Sylvester . . , ~.a5alwaystOfallbackonmyownsimple Althoughthisratherunsportsmanlike concept aseventy-fivedegreeangleforaboutaquarter "Qey skies are going to dear up, put on a no~ture: Paines' grey swooped, grazing provedeffective,oncewehad the fish, we soon mile. At .the age of fifteen, I ran endless laps happy fare." · · the biancreS as it lard; Alizarin glides with grewtiredofwatchingthemswimaroundthe upanddownthisslopeasiattemptedtolose I am w81king toward the kitdlen when the wings full of air. In my' mind, I can trace the white, plastic bottom;. Thetitresthatwespent the slight paunch which has haunted me wordshit~re.Ifumeattlen,angryandcynical, whole of these woods, map each point, not by fishing on this stream are among my fondest since my earliest years. I ran in my bare feet morbidly torturing myself. I have rot seen the miles but by experience. My maps are textual childhoodmemories. This~lywhylbied and the skin along the bottoms grew thick sun in seven days. I am, you see, chemically and sensual I can follow the curves of the to incorporate them into my first novel and and calloused from trudging over scores of dependenton:thesun'sappearartceinthesky femrinbygagingthetensionsofmybelly. whyiwasunabletoshakethewoodsfrommy branches and rocks. Now, at twenty-four, .~ and no Twelve Step in the world is going to In his essay, '"Sta1king with Stories: Names, mind whenKevindiedofAIDSlastfall.Itisalso my feet are basically insensitive to the beat ~P· I can feel the last thinned residue of PlacesandMOralNarrativesAmongtheWest- onthisstreamthatltriedtObuildaraft,hoping ing I inflicted upon them but.the paunch vi~A.evaporatfugfrommyskin. There is emApache'',KeithBassodescribesthemntex- toeventuallylinkupwiththeMississippi. looms, ever in the distance. nothinglefttodobutcoDapseontothesofaand tual.fundionoftheplacenameswhichPuebio By ten, I became bold enough to entel' the Atthetopoftheslopethereisadearing,a tan" open another box of Archway rookies. NativeA.meriamsgavetotehwaterholes,rocks woods themselves. There are many paths but roughly circular ring of trees. Several small With the endlE'SS cold, my mind has long ago and towering mesas of the AriZona deErt. the easiest is to trespass across ariy neighbor's boulders have been positioned ~thin it like turned tofrozensludgelikethegroundoutside Thesenamesaremadeupofoompletesente~:u:Es back yard and rut through the back field. This Easy Boy recliners about the T.v: There are my window. YetSOireWrerearoundmyfifth _like '1Jig cottonwood trees stand spreading field was the source of many games, troSt of usuallyspuriousbeercansandprophylactics sugared molasses, I begin to day dreain. here and there," or "coarse textured rockS lie which were seasonally determined. In the scattered in the brush and the center of the Whenlamdep:-essed,Itendnottodreamso aboveinacoznprlduster."Theseplacenaines Spring,withthefield'svegetationstillflattened ringhasbeencharredbyuntountablesmall 'much aoout tre Enness possibilities of what are intertwined within nanatives and thenar- by snow and the new grasses not yet begun to fires. At twelve, I tasted my first cigarette might be. I dwell instead on the events which rativesbreathlifeintothePueblo'sn:anoriesof grow, wep1ayed00sehillontheunevenground. here with a bOy whose name I have forgot have really happened. In the middle of this the land. Tostandatop"meitstandabovehere As the grasses sprouted, however, we used ten. It was a Salem and, whenever· someone damned winter, it is too much of a stretch to and there'' is to stand in themidstofastory. them as cover in our games of war. In the lightsoneup,Icansinellthewetpineneedles believe in the wann places I have been. There This is how my memories of the area sur- summerof1979,I~aspecialistatcrawlingon and taste the heavmessofmintonmytongue. has never been warmth or sun, of this I am rounding Thome's Craig are for me, .though mybellyunseen,mybroken-branchriflesecure In_thesameyear,my Florida cousins coerced ~solheadupnorthinmymind,upto likethebirdsandunlikethePueblo,Ihaveno inthecrookofmyanns.Iwillneverbeoomeas me into smoking whatthey claimed was - Maine. · · namesforthetemrlnifindthere.Ican5eethem intimate with a stretch of ground again. The marijauna. The oldest cousin had carved a I grew up in Lewiston, which is tre seoond clearlyand walkthroughitanonceagain. Titre groundofboth the field and thewoodsismade crude pipe out of one of my woo"sten build- . largest city in Maine. It is not one of the pretty fallsawayandmyageshiftsaslstepfromp1ace up almost entirely ofclay. When itismoist,itis ing blocks. The oregano tasted both sweet · citiestowhichthetouristsgoto.l.ewistonisone to place, the years attached and dislodging possible to form rough, misshapen figures. and acrid and· we smoked it until it was all of the many mill towns that French Canadians themselves like briars on the husky si2ed oor~ When the day diies, it cracks and the thin gone. flocked to in tre early to mid 1800s seeking to duroys I used to wear. · fissuresresembleshatteredglass.Honeysuckle Just past the circle is a swampy· pond ere find workin the red bricked factories clustered ASI enter the field ~hich borders the woods _grows up along the base of the grass stalks and a ted by a lack of sun and the drainage from about the shores of the Androscogin River. proper,itislateSurn:ffierandlamsevenyears anendlesslitanyofcaterpillarsandbeesvkfor the hills extending to the West. There are llinlgh.the river has recovered 'significantly old.Aflockofbutterflieseruptsfromthethistle space and food. almost always cat tails groWing there fromtredecadesofindustrial waste which the in front of me. Ibecomeabsolutelystilland the In the winter of 1978, a blizzard was fol- amongst the odd debris floating on the sur mills dumped into its waters, I can remember butterflies settle once agaiiL A single butterfly lowed by several days of sub-zero weather. face. It is a paradise for snails an<:( slugs ofall that, as a boy, with the wind just right, the· iandsonthezipperofmyooatandmymouth There was easily three feet of snow in the kinds. . Spring time Androscogin would release an goesdry.ItisaviCeroyiwilldiscover1aterinthe field and the cold had frozen the top layer Iamtwoageshere.Rightoffthetrailwhich odor similar to a bowl of nine week-old-egg onlynatureguideweown,anoldSienaguide into smooth sheets of ice. One evening, my loopstrepond,Iamthirteenandstandingwith ·salad. Even a reeking stertcl\ however, am to butterflies. I stand_ watching the butterfly for sister and I skated along the surface in our my best friend Chris. We are looking into the hold a subtle chann. In fact, the smell of the over a half hour, the patterns Qf orange and snoWlllQbile boots, the moon reflecting into pond and rontemplating how deep the water Androscogin is immortalized in a French-Ca.- black and thehairsalongthebackofitsleg. The our near frozen faces. My sister, four years might be. Ouis is wearing his favorite cmnou na.diansongwhichsays, when roughly bans- guidebookwilltellmethatthesebutterflieslike older than I, wasalittletooheavyandbroke flage fatigues/the ones that re has spent all lated,'1..ewiston,mycity,myhorre.Yousmell to live by the edges of fields and streams, throughthesw:faceoccasionallybutlwasin Summergettingabsolutelymuddy,absolutely likeshitbutatl~tyourbeertastesgood." feeding on milkweed and cattails. At seven perfect equilibrium with the crusted snow. cool.l}eleansoutoverthemurkywaterto try Mynx>ther'shouseliesina valleytoward the years-old,however,nothingseemsmorenatuml To this day, when I see· a stretch of 5now that . toseethebottomandicannothe1pit,Ipushhim outskirts of the city. wren we troved into the than tohavethislittlefriendlivingonthezipper has frozen over, I can not resist stepping into straight in. It turns out that the pool is over his tiny, ore story rouse, long fields of grass and of my coat. it, praying it will hold my weight once again. head. He climbs out, his face red and weeds in thistlegrewuparound themoundsoflardfill furmanyyears,Iamafraidtoexploremuch Iamalwaysdisappointed,ofcourse,butlam his blonde hair. His camouflage pants have. which only hinted at future hone. I can dis- further than the field. I spend my time on the a junkie for those brief moments of hope. been washed entirely clean. · tinctly recall the long hours I spent on one of edge where the long grasses eventually give The trees around the bird sanctuary- are By the far end of the pond, I am se\renteen those mounds, stretched out ina depression of way to trees. 1bere is a stream which I used to mostly pines and white birches, both trees and making love to my then girlfriend. \Ve dirt which resembled the nest of an eagle or a "fish" in with my ccnsin Kevin, using broom which flourish in relatively young forests. I have talked about it all Winter long and so, small pterodactyl. I lay among the twisted handles and paper clip hooks baited with rai- · decided around fourteen years ofage,armed while taking a walk one day, we lay out on branches in its bottom and let the warm sun Sins. It is :r\6tmuch of a stream to be sure. In the with this new knowledgeofilie succession of the ground without a blanket and try to feel tummybodyasdarksasthedirtofthemounds. SpringitreachesitSfullgloryand, with the help forests, that there must have been an enor- sexy. It is over quick and what I feel for the Small black ants burrowed through the clay, ofgroundwa!er,becomeslargeenoughtoflood mous fire some time in the last couple of mostpartisnervousthatsomconewillcome often crawling into my socks arid under the the odd rouple of basements. For most of the centuries. This explanation neatly solved the along. For the first time, I feel how close the collMofmyshirt.Otherwise,lwasaloneonmy sumriler,itisathinnbbontricklingitswayover mystery of the raised house foundation. I road at the gates of the sanctu_ary is to my small motmWn. . · srnallstQ:tleS. 'Therearenotmanyfishwhich live held endless images of a young, pioneer stomping grounds. When I make it back :_ To the West of my house ~ wa5 a bird' in it except for a moille colored species we· fanilly,hopelesslytrappedinaseaofinflarned home, I find leaves in my underwear and sanctuary, a small stretch of w~s called called "stickers." The suckers can sometimes oaks. I realize this concoction of mine is mosquito bites in places I would rather not. .100me's Craig. The sanctuary consiSted ()f grow to reach about 6'' in length but they are probably entirely false. I chose to believe my There are other memories ~broidered. several miles of woods, through the·middle of bottom feeders and you can not eat them even own story rather than take the obvious route into that ~tretch of land but for the most part ._which, there was a hand built stone wall and if you rou14 overlook how ugly they are. of consulting a local history. Even now, re- . they are flashes, like the time I could see my · thecrumblingfoUndationofahouse.Iusedto Kevinandlnevercaughtanythingwithour ~ching facts rather than deducing them pronebodyreflectedinhereyes.Orthetime sit on the walland watch the grey squirrels leap 1llClke-shift poles but we didn't seem to care, formyselfcanchafe. There is a part ofme that I fell headlong into a·patch of briars and tore fonnthebranchestotreground.lwouldwatch changing"wonns''whaltheraisit)sgrewsoggy has always been convinced that secondary mynewshirtinaboutfifteenpiaces.Istayed thebird5aswellwithoutanyideasasthenames orslippedoff,eatingthebaitourselveswhen source material is a bit like fishing with a inthewoodsovernightratherthangohome of the different species. The birds were either we grew hungry. Eventually, We ·upgraded bucket. and the temperature dropped below fifty. blue or yellow or spotted, a:OO e\ren though I ourtech,niqueandbegantousebuckets.Kevin AboutahalfmileintothewoOdsofThome's These memories are there but usually they ·now knoV{.iiOmetheirtechnical riames,myfirst held the bucket while I herded the suckers in. Craig, the terrain becomes steep and rises at continued on next page THE BARD OBSERVER March 16 1994 · · Another View··· 7
Faculty responds to -.E·~AGE.'GARDE. 4 ..M - -. ... r 9 student participatiOn Erotic & Romantic Readings Tonight! The Educational Policies Committee received thefolluwing letter from the Faculty Evaluation The crew of Menage '94 invites you to a Literary Salon, 'lfuutic &: Romantic Committee, regarding student participation in faculty meetings. We ~l.be meeting with the Readings" TONIGHr Wednesday, March 16, 1994 in Olin Auditorium from 7:00- facUlty committee to discuss a possible general campus forum, and we would like your input. 9:00PM. Please-address comments and suggestions to Renee Cramer at Box 7~. This year marks the VthanniversaryofMenage a Trois at Bard College. The Menage isnotquiteaclub,notjustaparty,definitelyatradition,butalmostaHomecoming to: Educational Policies CoDunittee certainly Bard's largest student event: The Menage is absolutely "queer;" neither from: Faculty Executive Committee . . . · . ~ fish nor fowl. 'The Executive Committee recently received a petition from a group of stu4ents We plan to present a formal, but infonnative, pleasant and pleasurable evening to requestingstudentparticipationin the Faculty meetings. TheCoriunitteediscussed this discussemergingissuesofsexintoday'sculturethroughliterature. Weexpectarich at length, as had the faculty as a whole at a in the Fall. . . · m:eMg and elastic selection of essays, articles, excerpts-fiction and non-fiction-pro~ · The petition and letter in last week's Observer [Feb.16, 'We Live Here!"-eel.), s_how a passages from great literary masterpieces or poems from minor marginalized studentinterestinsubstantivestudentinvolvementin thegovernanceofthecollege. We voices. We look forward to sharing a range of hwrian perspectives, diverse expe-_ would suggest that such participation isd~ble, but that a forum other~ faculty riences; intimate misgivings. We hope to be pleasantly surprised by your unique meetings for such student-faculty-administrationex~ges of ideas and perspectives and creative contributions to the evening. , . would be more appropriate. . · . . · Basic communication is a way for all of us to learn about the experience, conscious Wewouldliketohaverepresentativesofthefaculty,chosenfromtheirelectedbodies ness, and anxiety of living in the era of AIDS. These days love, lovers, and loving is (Executive Committee and Faculty Senate), meet with elected representatives of the not just about putting on a condom-the 90's icon for all forms of safe sexual politics student body (presumably EPC members) arid appropriate administrators to discuss and practice-it's about how to thinkabou,t putting ona condom, how to think about the possible structure of a gerieral campus forum. In such a forum, all interest~ parties getting into the right frame of mind. Please remember, the Menage has always been could. meet regularly to discuss thedirectiono~ theacademci prol¥'amandothercollege about inclusiveness, connectedness, and collective response. Our purpose for the matters. · '~ , · . literary salon is to emphasize dialogue, discussion, and the underlying discourse: Faculty Meetings are primarily for facultY to discuss amongst eachother a yariety of AIDS affects us all; HIV knows no borders. 'l_be participation of all members of the matters affecting the college. It is in the interest of p~ng the integrity of such Bard community will assist in this understanding. discussions that student attendance was not approved. Last fall, the faculty approved Readers to include (so far!) Professor Peggy Ahwesh, Prof. Jane Bai-Soong, and the acceptance of a sh;J.dent media representative as well as does the EPCrepresentative Head Librarian Jeffrey Katz. atallfacultymeetings.Itwasfeltthatthiswasthebestwayforstudentstobekeptaw~ of the substance of faculty debates over policies that affect them. We look forward to a response to this intiative and to starting the work toward setting up a structure for campu~ meetings that we would all find cons~tive. Light continued
_ continued from pm,;ous page bWsanctuarynowexistsonathinlywooded requiresomethingelsetotriggerthem.Iwill couple acres of land and the streams have be sitting in a coffee shop tracing my finger beenfilledinorre-routedthroughpipes.My over the graphitti and ·an of a ·sudden I am own valley has beCome so clogged .with .. weeping by the side of an oak tree that my housesthatthereisnoroomtobuildanother uncle has informed me I have helped to kill even ifyou wished to. As I continually find is by carving my name in the side of the bark. true with so many things that I took for Ateighteenyears-old,IleftLewistoninorder granted in the Maine of my childhood~ the to attend rollege in Boston. I eventually left only proof of my little woods existence lies Boston as well to attend another school in Los locked within my own mind. I can see the Angelesand,bythetimelhadfoundmyway land clearly in my thoughts and these to Chicago, I was longing for Maine. I pur- . namelessplacesholdmystories.Thereinmy chased a bus ticket and, twenty six hours later, memory, unlike the birthdays and-names of . Ireturnedforthefirsttimeinnearlyfouryears. acquaintanceswhichc<.'"t'\Stantlyslipbeyond I must admit that in that time; I had thought mygrasporthesunwhichlhavelostallhope little of my woods. I had become wrapped up of ever seeing again, the trees of Thome's in my busy metropolitan life. Craig extend unfettered for miles and the air Of course, when I returned nothing was remains fragrant with pine-even on those the same. The fields and woods had been days when the wind is blowing off the s6iled. tun1ed into hOmes and paved streets. The Androscogin. THE BARD OBSERVER March· 16 1994 8 ' Anothe-r View , Who, needs a hotline? ...... ' - ' ' . ', by Mary lindsey . march on Red Hook?Second, people come the groups of the past. What are the many Why has getting these things been such Hotliries are for crises and the last time I hereto Bard from all kinds of backgrounds complaints that ~ve been circulating for a a . problem? Because Shelley Morgan . checked, there wasn't a coming 'out crises and at all different stages of coming to whilenow?BAGLEisintimidating. Whyis hasn't had fifty angry dykes and fags · going on Bard's campus. The dissolution terms· with their sexuality. People who itintimidating?I'msureanygroupwill be march into her office, screaming their of BAGLE was fairly inevitable consider haven't even come out to their roomma~e intimidating to a first goer or someone heads off, and refusing to leave until ing the negative feelings towards it for the aren't going to want to talk aboui partiCi- who isn't very·comfortable with their own they get wh~t they want. Because we last yeai.and a half, but a hotline isn't the pating in a Gay Dating Game and people identity, but is there something else going can't get fifty of us into the same room solution. I know the "gay hotline" isn't who are thinking of chaining themselves on here? Rumors of ''politics" and group together for even two seconds, and presenting itself asanalternative to BAGLE, to a desk leg in the Oval Office to protest dynamics run rampant but what does that none of us seem to be too angry that but considering the fact that nothing else is the gays in the military 11Compromise" mean? What that means is that there are BAGLE has consistently recelved less availi!-ble in terms of gay services, that i~ in aren't going to want to hear another thou- somepeopleinthegroupthatotherpeople money every semester. fact what it is. sand coming out stories. Then there's the find annoying or scary. There's nothing we I don' t know what the solution is, :What is the 5olution then? I think that fact that Bard is a really small school. Even can do about that. There are annoying but I am concerned about the future of · first, we have to look at what were the though there is probably a higher concen- people everywhere, they have just as much the gay community and I do want to do problems that caused the destruction of tia~on of gay people here than, say, SUNY right to belong to a group as you or I. We something about it, I just don't know BAGLE. and the Lesbian/Bi-Women's New Paltz,thegayeommunity here is small. have to fin4some way ofdesigning a group what. Don't get me wrong, I'm not call Discussion Group so that we can come up No matter what kind of group forms here,· so that someone, who someone else finds ing for the dissolution of the hotline. I with something that maximizes the most itsureisn'tgoingtobethekind where you annoying, doesn't stop that person from just think there should be som~thing people's satisfaction and something that can go to a meeting '1just to see what it's beingpartofthegroup. Whataboutspend- else. What would be appropriate? What . ~last. · ··aoout" and nobody's going to know about ing less time in meetings and more time does everybody want? What will work? .-&fore-IooiCmg at the specific problems itt~e next-day. I'm sorry, but part of being actually doing stuff? How about getting a Why don't allthe peopl~ with ideas get with BAGLE; let's consider some of the gay is being out. HBard had a big, positive, god damn permanent office with a together .and see if somethipg can be ·problems inherent to any gmup that might friendly gay community, there wouldn't goddamn phone and a goddamn answer worked out for next semester? Contact . try to form. First, Bard is out in the middle bean~ for a coming out hotline. People ing machine so if someone has an idea, me at Box 1005, but if you're not writ of no where. Anyone who is looking for a would look at us and say, "Yeah! I want to they could just call up, leave a message and ing to be helpful or if you have nothing radical, militant activist group aiil't going be one of those people!" deal one-on-one with someone else who new to say or if you're just on a power to find it here. What are we going to do, Which brings me to problems specific to was specifically interested in thatidea~ too. trip, do us all a favor and stay home. .··A Subjective View•• by Josh Ledwell brief 'I don't want to be the first to talk' to 8ay what they really thought. these practices Symbolized to some the · On 1'1\ursday, February 24th, Bard Ri silence,5omecourageousindividual broke We talked for a long time about different way men look at sex- as a sport, not an sponse to Rape and Associated violence the ice and we were off. · · aspects. of rape. How far can you go in intimate act. One man explained how dif sponsored an informal discussion entitled On the role of men in society, we touched persuadingsomeonetohavesex?Students fiC!Jlt it would be to challenge some ideas '"Too Horny to Communicate?" in the on the influences of the media, family up- talked about the pressures involved in of gender roles within groups of men, as Ro"-'bins l.ounge. I found the title of the bringing, and sports. I watched an inter paving sex. Imagine yourself without opposed totherelativelysafeenvironment meeting a little intimidating: would my esting give-and-take over parenting: sev transportation, isolated, with your date .. of our BRAVE-sponsored discussion. An function be as a kind of target for the re eral people expressed their ideas about saying, "Come on, Come .. on, let's do it." other suggested that we hold discussions senbnent of Bard women? However, I had raising children and how they planned to Friends' expectations matter - do· you · similar to this one for men to talk amongst pronused a friend, a BRAVE counselor, go about it themselves to avoid gender want to be known as a wuss?· themselves. that I would go. He was worried that no typing. Discord started to seep. into the Noteverybodypresentwaspleased with The discussion lasted for an hour and a .. one would attend• . conversation when the discussion topic the way the discussion was progressing. half, when, after a pause in the talking, As it fulppened, so many pe<)ple arrived evolved into the influence of male and Onewomanpointedlynotedthatthefemale everybody rose almost in unison and that some had to sit on the floor. Surpris female hormones on our lives. Some of the speakers were constantly being cut off... straggled out. It had been a success. In my ingly to me, there were almost as many men, and most of the women, disagreed Another man said that the issues brought opinion~ the discussion would not have men as women among the twenty-odd vocally· with the he suggestion that hor up were he~rosexist,since we were mainly worked without the wide range of peoples' people who attended. We sat ·in a circle,· mones might help determine 'natural' discussing male-female interaction. opinions and their willingness to express facing each other more or less corilfortably. gender roles. The most interesting part of the debate them.OneBRAVEcounselorsaidthatthere - The BRAVE counselors present opened I began to loosen up and enjoy the dis for me was the discussion of male groups might be similar meetings in the future. I the talk with their own views on violence etission. I was surprised that people felt arid their views on women and sex. This offer a warning to those cotni.ilg to· any in relationships. Then,oneasked a question freetoexpressopinionsthatweredectdedly was the first' time I had heard of the Sperm further meetings: you .might find them too to start the discussion. I think it was ''How not politically correct. Though I had PosSe, a high school gang whose members engaging to leave. I will probably attend do you view the roles of men and women thought the discussion would be hope co:r;npeted torackupthehighestnumherof another discussion, but next time rm go in society," but don't quote me. After a lessly stilted, the Bardians present felt free 'scores' on women. Though an extreme, ing to finish my homework first. "' Due to the disorganization of the editor-in-chief, 'his piece:is· appearing late. We apologize for any and all inconveniences.
'The Bard Music Festival _ ~eeds people The Bard Music Festival is looking for to work in the Festival box office.froin-- housing for Festival musicians for the May ~1-Aug 21. We also need staff weeks of.August 7-21 or for the-entire (ushers and concession sales) _forth~ month of August. If you are interested weekends of the Festival ~Aug.l~-14 in renting you~ home and want more and 19-21~. If.you are .interested c~ll details call Robin at 758-7410. Robin at 758-7410.
• • - ~• "' .,., •' • • • • " , _ '" Oo _ ..,.. • • • • ~ - -r ... •'* . ... W ...... Y . • ._ -. -"' ~ -• 0' ' . "" • -.. -... . -L,, .. ,• ~ - .· J , > 6 3 0 oh • _ _ _...,.. ... - ..J -. .,." '-"" -- .6.- ...... , . _._ ...... -.. .-... -,r.. ... • • • ,.., • • .... - ...... - . ~ · " " · - • ... w ~ -- .-., ..• ~ • •"" - . . .., , - •- · - ...-.-_. 7 THE BARD OBSERVER March 16 1994 · Special · ·. · 9 · t
Will the real Sugar Hifl please been ravagedJ~y heroin been really easy to make a rolling when the couple tries stand up? Sugar Hill is a film and drug-related vio- . Denis Le'!ry vehicle, just a to cope with their own prob- thatwalksafineline--it'spart lence) m~ke Snipes -want . chance for him to do his Iemsatthesametimethatthey art, part crap, out. Of course, there's also raging 'as~hole bit on the keep the situation with Leary a and when it's a pretty young girl in- big screen for a couple of .secret from the visiting rela~ all oyer you volved, the~one he _wants hours, and all his fans tives, each of whom is a per- can't be sure to run off with. could go ·see it and be fectly recreated stereotypical which one is Basically, the story is the happy. But no~ this is a real nightmare of annoyance.· · the real heart lesser parts of Carlita's. movie, or at least it tries to The chemistry between the of the film. ·Way, part True Romance, be. The story is ·very well various characters is really im- The story it- and maybe a tiny bit of conceived, but requires a pressive, and whoever did ~_ the self is to a - New Tack City, all thrown serjous effort of suspension castingforthisfilmdeservessome . htrge·.degree together,butwithnoneof of disbelief. Leary plays a kindofaward.Evenifyou.aren't crap, not too bad but defini- the fast~paced activity that crook on the run who hi- . into Denis I;..ear}r's style 9f com- _tively unoriginal, and badly made those films work so jacks a couple at a conve..: _edy,thisfilmhasalottooffer,and written-Snipes plays a drug well.Itreallyshouldn'tbe . .. nience store apd forces . ~he exchal\ges between the 1'!us- pusher whose cons~ience gets a very go,od . movie. . . _them to tal c ii). library room 402. 8-1 Opm. . Stevenson. (Also Monday·mornings, 10am-12pm.) "THE. BARD ·oBSERVER ·March 16 1994 ·. 10 . Edit-orial · . · Senior Class Column Who is a senior? Anyone who shouldhavealistofwhat'sbeenrov recruitment by mapr company's, so graduatoi inJanuruy,anyore gradu- end Plmse cheCk it. you am use tlvJse new ABCs after ating next Jan~, and those cJ us Dates to remember.Wednesday, your naire to get a MeJob. wm are graduating (Clt please God Mard116...NEXT SENIOR CLASS Just a reminder, all seniors with let it be true!) in :May. MEETING. BE TIIERE. (Where? baOO~Corthebig"IP'srouid like Ire seniors we are, as a class We're not suppose to knOw every- get them tousin writing(rosts,details, , we're jtN a little bit better off than thing. Ask you idiot!) . etc) ASAP. Like yesterday dude. broke. Wehaveraisai$137ofourgool Wednesday, March ·16-Junior Hyou need information onacoom cJ $10,(XX}. Hi1aJy Kaufman & crew nmninatims due! Uh, please. Irodation5foryourfamilyandfriends rcmoo beauroup bucks selling anna- March2L.TheDeadlindorSprlng forgraduati()I\oontactGioricl Gomez, .tion. Hemy· Ringel & crew raised & Fmals Baskets orders. Tell your Senior (lag; Secretaty, through ann mucho dollars selling rookies from 'ole man or your moms to buy a E- pus mail. She has a three-page list Teny's Baskets. Thanks guys and k'n ~ Theygotaletter(lateof ooncemingthe surrounding area. IA> gals! Anybody else got any bright rourse) from the senior class hy'na this soon! Plai:Es are being booked ideas? scrounge up some c8t for the ''I'P". NOW. AI&>, if you have friends that 01, and thanks to Greg Bemton at And don't fmget to say the magic havegradUa.tedfrom Ban:icomingup thelastFcrumMeeting,wegetwhat- word, 11please" (with feeling thjs fo wish you well, do trey know they ever is ]eft of the convocation fund time). mn get ao::oillD:OOations on campus toward our goal of $10,(XX). Yippie! 1hmsday, Manit 24-0pen Mike as .Alumni? We rou1d use it. N'Jght in Dekline for Seniors. A Watchtlnseslre$levels.-Ourrrotto 11 1 OK guys, our senior class gift has Fundraiser. is ''fry not to pl>irt' thoreanxieties been dErided on. Sasha suggestOO. Monday March 28, 1994-Survival onanyoneelse." Besensitivetoothers. renovating the gazebo? Great idea Boxes. And l-ey, let's be careful out there. huh?! Thanks Sash (He says it was SaturdayAprii,2...Coffee, Tea, and Hey, know what? Wouldn't it be where our first class party was-way wislHhey-werepuff-pastries.Alittle nice to spend a little quality goodbye back when during L&n. Also, good food for thought. titre with that old friend woo's been 10le frieJXlly, wonderful, and charm- Friday AprillS.-Auction of Bard through everything with you? Or, ing Kiia Odtwood, Mi$ Southern Memorabilia. A Fundraiser. maybe evm clear the air with that~ Blains, Beauty & Brawn, was elected Monday May 2...All-Nighter and-so on campus who, somehow, asourdassAlumrepresmtati.ve(OK, Cramming Care Packages available. you've lost touch with. Didn'tyou use you got me, she's a friend, just a: little · -WedneSday May 4....l'iUjects Due tobesuchgOOdfriends? Thinkabout favoritismtomakererday. ~will by 5:00 PM (yeah, we know you it. Were oufa here sooner than you ya!). . . know),CoddailParty.forSenimsonly think folks Do you rerrenberthattreMtnage . at Olin Ahium, ~PM. If you're a junior, a sophomore, originated with OUR clas:;? I 1l'81Il, Who are your officers, what are we or a first year student, and one of we started it, we were &ere first, and doing for you? . your friends is a senior doing the we should be proud. What did Tammi:l) major project-Tent ''P" thing, be patient with them, ~eddetoweartothefirstMenage? Party2)minorpro~ropm gfvethema little unexpected TLC, You know, we suggest that you Mike 3) Junior Marshals 4) Survival or just surprise them with unex- c juniorsreadingthiswithjmlousrelish Boxes Gloria:l) inapr projtrt-5e pected secret Santa-like gifts to needtorallynowanddecidewooyou' nior Gift 2) miror pro~tail pick up their spirits and stressed -wouJd like to noininate for your next Party3) Senior Class Meetings4) Tent out minds.That would be very nice. _.. ymr's~orclassspeaker. Wedidit't Party Van Ephen: l)maprprop:t Oh, and, don't ask about the haveachoice. I..aunfromourlackof GiftBaskets2)minorproja.;ts---&rior ''P" thing or the "G" thing so often infonilation. You need to tell either Oass Column 3) Menage Mocktail these days. ·We know you're try Sasha Gonnan or Ephen Glenn Col- Bar4)TentPartyBeel"Gillian:l)major ing to be helpful, but, well, just ter~~tativestotheBoard project-The Auction 2)minor encourage them, don't grill them. ofTrustees-aboutyoursuggestions. projects-Bulletin Board ~) Snack <;me day, you too will understand 11 1reJastnmii:tgoftheBoa:rdisSatur-. Night 4) Senior Trip 5) Call Officer about the ''P" and the G" expe day, May27, 1994. · MeetingsJ~l)maprprop:t-The rience. We're touchy. So just hug Fact There are approximately 200 Bard 1994 Senior Oass acnnmt 2) us and handle with care. students in the 1994 senior class, give . minor projects-Tent Party Food & If you have - ~nything to add or or take a pro~ or two. Do you know Soft Drinks . any info for the column, please the break down by divisions? Com- srow a little class spirit and inform drop it into Box 715 . We accept ingup,samebattirre,sarremtchan- us about important dates, i.e. seni6r only positive, upbeat, energy rei. artexhibits,senionnusicrecitaJs,senior giving senior "P'' words of wis Hey,haveyapersuadedsorrepoor film premiers, senior chama or darce dom & Personals per~ining to unsuspecting, underplid professor to opening nights, even senior board senior stress, senioritis, and basic senility. We also like brief & ~i!~~!!!l!!!!!!llllll~~~~~~~~~to~~~~oomingup? Hyouknowsomethingof :reason we're rotisbEmuseofalack of nostalgic Bard memories, they're ~ there's, sotre memento or memma- awareness. CaUing all seniors: There's especially welcome. (Non-seniors bilia,thatyouwantupforgrabs,tren- still lots to do. Wherever you ~ need not waste our time.) ti.on it Quick. make t:iire we could use your help at Final note, Ephen apologizes for Fact Every year about this time something. Just rome to a ~ missing the last two Senior Oass some irate group of students decide and jump right in. Or just get hold of meetings. Miss Thang hears that Anonymous in &rrytoWil~ ~eet van at Sec~rlty at 7:45p: * Dance Theatre, 'at the Dance Studio. ·Unreserved seating; 8p.: * ··Afcoh~lics m~ing .·...... ;·, . / · "''· . * .. Ltte~~ Salon: Erotic and Romantic ~ding~. Tonight between 7p anci 9p in Olin- Auditorium. · · ·- · · · · · · - * MONDAY. MARCH 21 * * Alcoholics Anonymous ~d Narcotics Anonymous will ~ m~ng in Ai~~tvaii304 at 12 noon. - · * THURSDAY. MARCH 17 * · -- '~ Women's Center ~ng. Annandaie House, rm 110, 6:~0p. _ -* Alcoho~cs Anonymous meting in Aspin~all. 3o4 at 7:30p. * -; .~ - -. ' - -,.-- ' . meeting in Red Hook. Meet van at Security a~ 6:30p . *.J:avola ltiillana.. -Kline President's Room. All Welcome! J~in us for,conversation "* Co-Dep::ndents Anonymou~ . . at 5:30-&:00p. Benvenuti! . ' . . . _.* Wom~·· We~ln.- •nd· Heaith, a £o~· _Olin 204, Sp. _Refre~hrne~_t_s· -rll be served . .* ..Sls~r cities .Meeting. Kline Committee Rooms, Sp ' I _l ' • . .. • , ,.. Dance Theatre I, at the Dane~ Studio. Unreserved seating, Sp. . * . ... . - ;! _..... *· Senior: Projects In .Progress, presented by the Gender Stud.ies P~gram.' . Brlef presentations by seniors moderated in gender studies will be given in Olin 203 at 6:30p. * TUESDAY. MARCH 22 * Refreshments will be served after the event. * A_l~o~olics Anon~ous and N~otics Anonymous will be meeting today in Aspin~alr · * ~ .. mlc CoffHho~ ~ DeKiin~ at 9p. Cali 7.S2-7352 to sign up. Any performance 304 at 12 noon. ~der 20 niinut~s Iori~ will be accepted. · - _ _ · · .* Leonard Schwartz will be giving a talk entitled •Modernist ThoUght, Poetic * FRIDAY. MARCH 18 * . Practice.• Olin Auditori~, ·· 5p. Pre-!ecture reception at 4:20p. * Alcoholics Anonymous meeting~ 1~~ Hook. Meet ~an at Security at 7:4Sp. * Alcoholics :Anonymous m~g in Aspinwall 3o4 at 12 noon. ... . - ... { ' . . * -·gECH IT OUT! Do you have a'n interest in Czech ctilture? Would you like to learn * WEDNESDAY. MARCH 23 * some ~ech words, Czech expressions or experience Czech humor? Come to the Czech table. * Mesa d~ Espafiol. iNo tela pierdas! Kline Commltee Room 6-7p. Kline_Presidents _Room. 5-6:30p. . " *.-. o;ereaters Anonymou~ meting in IGngston. Meet van at Security at S:lSp. * Ga:a'nd Union Run. Leaves~t 6p and returns at 7p~ Meet the van - ~hlnd Kline. - -_- - - ' :- - --· . 1. · Se~ piays directed &rd student~ wil be perfo~ed today * N~tics Anon:fm~~ meeting in Catskill. Meet ~an at Security at 7:1S.P· -· * S~de~' R.rtoty by at the Dance StUdio at Sp. ~or reservations call 75~22. · · - · . .* ~ohft.-Cille, ~vant--garde composer, penormer ~d fOunding member Qf the Vel~ Untle111round will be givirig a isoto performance tonight at 7:30p in Olin Auditorium. · Ad~~ion_ is $1~ with Bard !I'· * .. -~ - ft.atre-1, at ~e Danee Studio. U~ed seatinS, Sp. * SATURDAY. MARCH 19 * · .* -Alcoholics Anonymous meeting in Aspinwall 3M at 12 noon. * Narcotics Anonymous ~gin WOOdstock. Meet van at Security at 2:tSp. · Meet ail v~ns or·buses i:n the parking lot behind Kline Commons.