Characterisation of Edible Seaweed Species
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Seaweed Products on the Swedish Market As a Source of Omega-3 Fatty Acids
Faculty of Natural Resources and Agricultural Sciences Department of Food Science Seaweed products on the Swedish market as a source of omega-3 fatty acids Sjögräsprodukter på den svenska marknaden som en källa till omega-3 fettsyror Helena Martinsson Independent Project in Food Science• Master Thesis • 30 hec • Advanced A2E Publikation/Sveriges lantbruksuniversitet, Institutionen för livsmedelsvetenskap, no 430 Uppsala, 2016 Seaweed products on the Swedish market as a source of omega-3 fatty acids Sjögräsprodukter på den svenska marknaden som en källa till omega-3 fettsyror Helena Martinsson Supervisor: Jana Pickova, Department of food science Examiner: Kristine Koch, Department of food science Credits: 30 hec Level: Advanced A2E Course title: Independent Project in Food Science – Master Thesis Course code: EX0425 Programme/education: Agronomy in Food Science Place of publication: Uppsala Year of publication: 2016 Title of series: Publikation/Sveriges lantbruksuniversitet, Institutionen för livsmedelsvetenskap Serie no: 430 Online publication: http://stud.epsilon.slu.se Keywords: macroalgae, rhodophyta, phaeophyta, ω-3 fatty acids, polyunsaturated fatty acds Sveriges lantbruksuniversitet Swedish University of Agricultural Sciences Faculty of Natural Resources and Agricultural Sciences Department of Food Science Abstract To know if seaweed products on the Swedish markets could contribute to a better ω3 polyunsaturated fatty acid (PUFA) nutritional status a selection of eight dried red and brown macroalgae were chosen for this study. The fat content was deter- mined in all the algae and the fatty acid composition was examined by gas chroma- tography. Overall the seaweeds displayed a low fat content with 0.24 and 3.28g/100g dry weight (DW). The red algae Porphyra yezoensis had the highest content of PUFAs with 58.7% and also the highest content of eicosapentaenoic acid (EPA) with 49.8%, while Undaria pinnatifida displayed the second highest levels with 44.4% PUFA and 13.3% EPA. -
Kappaphycus Alvarezii) in Malaysian Food Products
International Food Research Journal 26(6): 1677-1687 (December 2019) Journal homepage: http://www.ifrj.upm.edu.my Application of seaweed (Kappaphycus alvarezii) in Malaysian food products Mohammad, S. M., Mohd Razali, S. F., Mohamad Rozaiman, N. H. N., Laizani, A. N. and *Zawawi, N. Faculty of Food Science and Technology, Universiti Putra Malaysia, 43400 UPM Serdang, Malaysia Article history Abstract Received: 15 August, 2018 Kappaphycus alvarezii is a species of red algae, and one of the most important carrageenan Received in revised form: sources for food, cosmetic, and pharmaceutical industries. It is commercially cultivated in the 24 May, 2019 eastern part of Malaysia. Although K. alvarezii is rich in nutrients, it is limited in its integration Accepted: 25 September, 2019 into Malaysian food products. Therefore, the present work was conducted to investigate the quality characteristics, sensorial attributes, and antioxidant activity of K. alvarezii in Malaysian food products. Seaweed puree (SP) from K. alvarezii at 10%, 20% and 30% concentrations were Keywords prepared in the formulations of fish sausages, flat rice noodles and yellow alkaline noodles. Seaweed, Kappaphycus Proximate analysis, physicochemical analysis, microbial count, total phenolic content (TPC), Alvarezii, Fish sausages, sensory evaluation, and consumer acceptance survey of the formulated food were conducted. Noodle, Physicochemical The incorporation of K. alvarezii significantly increased the fibre, moisture, and ash content in properties, Consumer formulated foods. In addition, the TPC content of K. alvarezii food also significantly increased acceptance up to 42 mg GAE/100 g. The presence of SP in food at higher concentration decreased the microbial counts. Sensory analysis confirmed that only fish sausages added with SP was overall acceptable as compared to control. -
Edible Seaweed from Wikipedia, the Free Encyclopedia
Edible seaweed From Wikipedia, the free encyclopedia Edible seaweed are algae that can be eaten and used in the preparation of food. They typically contain high amounts of fiber.[1] They may belong to one of several groups of multicellular algae: the red algae, green algae, and brown algae. Seaweeds are also harvested or cultivated for the extraction of alginate, agar and carrageenan, gelatinous substances collectively known as hydrocolloids or phycocolloids. Hydrocolloids have attained commercial significance, especially in food production as food A dish of pickled spicy seaweed additives.[2] The food industry exploits the gelling, water-retention, emulsifying and other physical properties of these hydrocolloids. Most edible seaweeds are marine algae whereas most freshwater algae are toxic. Some marine algae contain acids that irritate the digestion canal, while some others can have a laxative and electrolyte-balancing effect.[3] The dish often served in western Chinese restaurants as 'Crispy Seaweed' is not seaweed but cabbage that has been dried and then fried.[4] Contents 1 Distribution 2 Nutrition and uses 3 Common edible seaweeds 3.1 Red algae (Rhodophyta) 3.2 Green algae 3.3 Brown algae (Phaeophyceae) 3.3.1 Kelp (Laminariales) 3.3.2 Fucales 3.3.3 Ectocarpales 4 See also 5 References 6 External links Distribution Seaweeds are used extensively as food in coastal cuisines around the world. Seaweed has been a part of diets in China, Japan, and Korea since prehistoric times.[5] Seaweed is also consumed in many traditional European societies, in Iceland and western Norway, the Atlantic coast of France, northern and western Ireland, Wales and some coastal parts of South West England,[6] as well as Nova Scotia and Newfoundland. -
Suitability of Seaweed Meal Incorporated with Rhodovulum Sp
BORNEO SCIENCE 30: MARCH 2012 SUITABILITY OF SEAWEED MEAL INCORPORATED WITH RHODOVULUM SP. BACTERIUM AS FEED SUPPLEMENT FOR FINFISH LARVAE Sujjat Al Azad & Teo Zhi Xiang Borneo Marine Research Institute, Universiti Malaysia Sabah, 88400, Kota Kinabalu, Sabah, Malaysia. ABSTRACT. The proximate compositions of three Chlorophyta (Caulerpa sp., Halimeda macroloba, and Halimeda opuntia), three Phaeophyta (Sargassum sp., Padina minor, and Dictyota sp.), and one Rhodophyta (Laurencia sp.) were determined in order to evaluate their suitability for feed supplement. The evaluated seaweed showed variable protein content between 4 to 14% (dry weight). The highest protein level of 14% dry weight (lDW) was determined in Sargassum sp., but this species also recorded the lowest level (0.2-0.5%) of lipid. On the other hand, the highest content of 4% (DW) lipid and 11% (DW) protein level was observed in the species Dictyota. Of the other species, Padina minor from the same group, shows 10% (DW) and 1% (DW) levels of protein and lipid respectively. Seaweed meal of these three species was prepared and mixed separately with 2% of Rhodovulum sp. Thus, three types of supplementary diet were prepared for Tilapia fry feeding trials. Rhodovulum sp. bacterium biomass alone was used as control diet. The preliminary feeding trial showed that the growth and survival of fin fish larvae were improved with the supplemented diet made from Dictyota meal mixed with 2% of Rhodovulum sp. Thus, indigenous self-flocculated phototrophic bacterium Rhodovulum sp. is improved when used as a feed additive enhanced with this seaweed meal in Tilapia (Oreochromis niloticus) fry rearing period. KEYWORDS. -
Common Edible Seaweeds in the Gulf of Alaska
eliciousor millennia, Alaska edible Natives have seaweedssubsisted COMMON EDIBLE Don the wild edibles—plants, animals, and F seaweeds—found in abundance along Alaska’s shores. In this book, Dr. Dolly Garza, a Haida-Tlingit Indian, shows you how to look for, identify, harvest, preserve, and prepare several species of seaweeds SEAWEEDS and one plant for tasty snacks or for the dinner table. IN THE GULF OF ALASKA A University of Alaska Fairbanks professor emerita, Dolly was raised in southeast Alaska Second Edition where her family routinely harvested seaweeds as a diet staple, a practice they continue today. Dolly enjoys sharing her traditional Native knowledge through presentations to Elderhostel groups, youth groups, and others. In this book she shares with you her lifetime of first-hand knowledge about the pleasures of harvesting, preparing, and eating some of the most common and delectable wild edibles found along Gulf of Alaska shores. US $10.00 CAN $10.00 DOLLY GARZA Seaweeds book cover.indd 1 3/28/12 9:30 AM COMMON EDIBLE SEAWEEDS IN THE GULF OF ALASKA Second Edition DOLLY GARZA Published by Alaska Sea Grant, University of Alaska Fairbanks SG-ED-46 Elmer E. Rasmuson Library Cataloging in Publication Data Garza, Dolly A. Common edible seaweeds in the Gulf of Alaska / Dolly Garza. — Fair- banks, Alaska : Alaska Sea Grant College Program, University of Alaska Fairbanks. p. : ill. ; cm. - (Alaska Sea Grant College Program, University of Alaska Fairbanks ; SG-ED-46) 1. Marine algae as food—Alaska—Alaska, Gulf of. 2. Cookery (Marine algae) I. Title. II. Series: Alaska Sea Grant College Program, University of Alaska Fairbanks ; SG-ED-46. -
Seaweed Goes Global. It's Not Just for Sushi Anymore
Seaweed goes global. It's not just for sushi anymore. Posted on: 2008-02-29 Grab your gumboots and forage the green way with BC's ‘Seaweed Lady,’ then dine on, or get wrapped up in, your bounty. By Margo Pfeiff "You are looking at one great, big, wild, exotic garden," says Diane Bernard. Actually, she's talking about southern Vancouver Island's coastline. This is where the "Seaweed Lady" and Outer Coast Seaweeds (her company) pickers hand-harvest some of British Columbia's 500 varieties of edible seaweed. From her overflowing bucket, she offers up neon-green sea lettuce that is crisp, fresh, slightly salty. Egregia, an underwater brown-feather-boa of a plant, evokes hints of citrus and caviar. Seaweed isn't just about the Japanese nori wrapped around your sushi anymore. It's woven into your yogawear to soothe your skin, featured in the latest spa treatments and surfacing on top BC menus. Chefs are blanching, sautéing, pickling and roasting veggies fresh from the surf. Seaweed stars in everything from pesto and hummus to a stand-in for martini olives. Outer Coast harvests seaweeds sustainably. And the green stuff is loaded with vitamins B to K, enzymes, plus anti-inflammatories to soothe what ails you. Europeans have been thalasso "sea" therapy-savvy for years. Bernard's seaweeds end up in spa products free of dyes, animal by-products and artificial fragrances at Vancouver's Spruce Body Lab, Absolutely Fabulous and Whistler's Four Seasons Hotel. Now you, too, can stomp along the beach and splash through tidal pools in colourful, hand- painted gumboots with the Seaweed Lady. -
Aquaculture and Seafood Processing in Japan
AQUACULTURE AND SEAFOOD PROCESSING Aquaculture and Seafood Processing in Japan Tooru Ooizumi Introduction ture and Forest, 2002). Principal species produced by aqua- culture are yellow tail, sea bream, trout, scallop, and oyster; A number of marine products have been utilized as a ma- edible seaweed is also included in the production. jor protein resource in Japan since ancient times. Despite the current diversified diet, around 20% of the total protein There are numerous cuisines and processed seafoods supply for a Japanese per day is derived from seafood, ac- prepared from varied species of marine products. In particu- counting for 40% of animal protein supply (Institution of lar, sashimi, a sliced raw fish flesh, is a typical cuisine in Statistics in Agriculture and Forest, 2002). Furthermore, the Japanese food culture. As to processed seafoods, surimi beneficial functions of seafood for human health, such as based products such as kamaboko, as well as salted/dried preventive effects of polyunsaturated fatty acids against fish, frozen food, and canned food, are produced in large atherosclerosis, have been successively revealed (Dyerberg, quantities. Among them, surimi based products have the 1986) so that the advantage of seafood intake is now appre- largest production, accounting for over 700,000 tons per ciated. year (Institution of Statistics in Agriculture and Forest, 2002). However, Japanese fisheries production has considerably decreased in the past two decades. For example, over 11 The post-mortem biochemistry of fish muscle is different million tons of catch in 1990 was lowered to around 6 mil- from that of land animal muscles, such as beef, pork, and lion tons in 2000 (Institution of Statistics in Agriculture and poultry. -
Seaweeds – a Potential Source for Functional Foods
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Defence Life Science Journal Defence Life Science Journal, Vol. 5, No. 4, October 2020, pp. 315-322, DOI : 10.14429/dlsj.5.15632 2020, DESIDOC Seaweeds – A Potential Source for Functional Foods A.K. Pandey, O.P. Chauhan*, and A.D. Semwal DRDO-Defence Food Research Laboratory, Mysuru - 570 011, India *E-mail: [email protected] ABSTRACT Seaweeds are microalgae growing in coastal regions and resistant to salinity. Seaweeds are rich resources of natural nutrients some of which cannot be obtained from terrestrial plants. Bioactive compounds of seaweeds such as sulphated polysaccharides, peptides, minerals, phlorotannins, carotenoids and sulfolipids have proven health benefits against various diseases. Traditionally, seaweeds are used as folk medicine for treating diseases like goiter, wounds, burns, rashes, inflammation, diabetes and also gaining attention of pharmaceutical industries due to their anti-cancer, anti-aging, anti-angiogenesis, anti-bacterial, anti-viral and antioxidant properties. Seaweeds polysaccharides have wide applications in foods as well as in pharmaceutical industry due to their bio-chemical properties such as stabiliser, emulsifier and gelling property. In food industry, seaweed polysaccharides are used as a functional ingredient in many products such as frozen foods, ice-cream, jam, jelly, beverages etc. Several commercial food preparations from seaweeds are also available in the market such as sea salt, nori snack wasabi, pink rock salt, seaweed thins toasted coconuts, crunchy seaweed chips, raw unroasted seaweed under different brand names. The present review is a compilation of nutritional, pharmacological and food properties of seaweeds along with its potential towards development of functional foods. -
Seafood Watch
Farmed Seaweed Image © Monterey Bay Aquarium Worldwide All Production Systems July 28, 2014 Andrea Flynn, Consulting Researcher Disclaimer Seafood Watch® strives to have all Seafood Reports reviewed for accuracy and completeness by external scientists with expertise in ecology, fisheries science and aquaculture. Scientific review, however, does not constitute an endorsement of the Seafood Watch® program or its recommendations on the part of the reviewing scientists. Seafood Watch® is solely responsible for the conclusions reached in this report. 2 Final Seafood Recommendation Criterion Score (0-10) Rank Critical? C1 Data 6.25 YELLOW C2 Effluent 9.00 GREEN NO C3 Habitat 6.18 YELLOW NO C4 Chemicals 10.00 GREEN NO C5 Feed 10.00 GREEN NO C6 Escapes 4.00 YELLOW NO C7 Disease 8.00 GREEN NO C8 Source 10.00 GREEN 9X Wildlife mortalities 0.00 GREEN NO 10X Introduced species escape 0.00 GREEN Total 63.43 Final score 7.93 OVERALL RANKING Final Score 7.93 Initial rank GREEN Red criteria 0 Interim rank GREEN FINAL RANK Critical Criteria? NO GREEN Scoring note – scores range from zero to ten where zero indicates very poor performance and ten indicates the aquaculture operations have no significant impact. Summary The final numerical score for seaweeds farmed in open water systems worldwide is 7.93, which is in the green range. Three criteria (data, habitat and escapes) received yellow rankings; however, this did not affect the overall green ranking. 3 Executive Summary Around the world, particularly in Asia, seaweed is commercially produced on coastal farms. These farms can vary in size, with very large farms producing millions of metric tons of seaweed per year. -
Bioaccessibility of Metals in Fish, Shellfish, Wild Game, and Seaweed
Food and Chemical Toxicology 58 (2013) 381–387 Contents lists available at SciVerse ScienceDirect Food and Chemical Toxicology journal homepage: www.elsevier.com/locate/foodchemtox Bioaccessibility of metals in fish, shellfish, wild game, and seaweed harvested in British Columbia, Canada ⇑ Brian D. Laird, Hing Man Chan Centre for Advanced Research in Environmental Genomics, University of Ottawa, 30 Marie Curie, Ottawa, ON, Canada K1N 6N5 article info abstract Article history: Fish, shellfish, wild game, and seaweed are important traditional foods that are essential to the physical Received 23 November 2012 and cultural well-being of Indigenous peoples in Canada. The goal of this study was to measure the Accepted 15 April 2013 concentration and bioaccessibility of As, Cd, Hg, Se, Cu and Mn in 45 commonly consumed traditional Available online 9 May 2013 foods collected by harvested by the First Nations Food, Nutrition, and Environment Study (FNFNES) from 21 First Nations communities in British Columbia, Canada, in 2008–2009. A significant and negative Keywords: correlation was observed between Hg concentration and Hg bioaccessibility. Metal bioaccessibility In vitro tended to be high; median values ranging between 52% (Mn) and 83% (Cu). The notable exceptions were Gastrointestinal observed for As in wild game organs (7–19%) and rabbit meat (4%) as well as Hg in salmon eggs (10%). Micronutrient Traditional food Results of Principal Components Analysis confirmed the unique pattern of bioaccessibility of As and Contaminant Hg in traditional foods, suggesting that, unlike other metals, As and Hg bioaccessibility are not simply PCA controlled by food digestibility under the operating conditions of the in vitro model. -
Seaweed Week! with Maine Sea Grant and MITA Jaclyn Robidoux, Marine Extension Associate Maine Sea Grant and University of Maine Cooperative Extension Seaweed
Seaweed Week! With Maine Sea Grant and MITA Jaclyn Robidoux, Marine Extension Associate Maine Sea Grant and University of Maine Cooperative Extension Seaweed Algae Macroalgae Microalgae Sea Vegetables Ew Collection: J. Morill, 1975 A L G A E M I C R O A L G A E M A C R O A L G A E ( S E A W E E D ) Microscopic/single celled Macroscopic/multi-cellular Freshwater and marine species Marine species Form base of aquatic food webs Provide habitat and food (“sea vegetables”) Maine’s coast is home to over 200 species of seaweed, that provide essential primary production, nutrient cycling, habitat, and food to healthy coastal ecosystems. Seaweeds also play a role in Maine’s marine resource economy and working waterfront heritage, as a regulated fisheries and aquaculture product. A L G A L C L A S S I F I C A T I O N R E D S B R O W N S G R E E N S Dulse (Palmaria) Sugar Kelp (Saccharina) Sea Lettuce (Ulva) Irish Moss (Chondrus) Winged Kelp (Alaria) Microalgae Nori/Laver (Porphyra, etc.) Rockweed (Ascophyllum) Ecological role of seaweeds Sunlight Oxygen Structure and Habitat CO2 Marine Living Biomass Food Webs Nutrients Human Resource Collection: V. Krishnamurthy, 1964 S E A W E E D V S P L A N T S Seaweeds are the the precursors to land plants and serve similar ecological roles in the marine environment: Habitat and structure Primary production Photosynthesize However, seaweeds are fundamentally different than land plants because they lack true plant structures: Roots Leafy shoots Flowers Vascular tissues Ok but they have to be pretty closely related? Nope! Current evolutionary “tree of life” based on molecular DNA Seaweeds are polyphyletic – they belong to multiple kingdoms within on the tree of life! Algae (3rd Edition). -
The Global Status of Seaweed Production, Trade and Utilization
GLOBEFISH RESEARCH PROGRAMME The global status of seaweed production, trade and utilization Volume 124 FAO GLOBEFISH RESEARCH PROGRAMME VOL. 124 The global status of seaweed production, trade and utilization by Fatima Ferdouse Susan Løvstad Holdt Rohan Smith Pedro Murúa Zhengyong Yang FAO Consultants Products, Trade and Marketing Branch Fisheries and Aquaculture Policy and Resources Division Rome, Italy FOOD AND AGRICULTURE ORGANIZATION OF THE UNITED NATIONS Rome, 2018 5HTXLUHGFLWDWLRQ )$2 7KHJOREDOVWDWXVRIVHDZHHGSURGXFWLRQWUDGHDQGXWLOL]DWLRQ *OREHILVK5HVHDUFK3URJUDPPH9ROXPH 5RPHSS /LFHQFH&&%<1&6$,*2 7KHGHVLJQDWLRQVHPSOR\HGDQGWKHSUHVHQWDWLRQRIPDWHULDOLQWKLVLQIRUPDWLRQSURGXFWGRQRWLPSO\WKHH[SUHVVLRQRIDQ\RSLQLRQZKDWVRHYHU RQWKHSDUWRIWKH)RRGDQG$JULFXOWXUH2UJDQL]DWLRQRIWKH8QLWHG1DWLRQV )$2 FRQFHUQLQJWKHOHJDORUGHYHORSPHQWVWDWXVRIDQ\FRXQWU\ WHUULWRU\FLW\RUDUHDRURILWVDXWKRULWLHVRUFRQFHUQLQJWKHGHOLPLWDWLRQRILWVIURQWLHUVRUERXQGDULHV7KHPHQWLRQRI VSHFLILFFRPSDQLHVRU SURGXFWVRIPDQXIDFWXUHUVZKHWKHURUQRWWKHVHKDYHEHHQSDWHQWHGGRHVQRWLPSO\WKDWWKHVHKDYHEHHQHQGRUVHGRUUHFRPPHQGHGE\ )$2LQSUHIHUHQFHWRRWKHUVRIDVLPLODUQDWXUHWKDWDUHQRWPHQWLRQHG 7KHYLHZVH[SUHVVHGLQWKLVLQIRUPDWLRQSURGXFWDUHWKRVHRIWKHDXWKRU V DQGGRQRWQHFHVVDULO\UHIOHFWWKHYLHZVRUSROLFLHVRI)$2 ,6%1 )$2 6RPHULJKWVUHVHUYHG7KLVZRUNLV PDGH DYDLODEOHXQGHUWKH&UHDWLYH&RPPRQV$WWULEXWLRQ1RQ&RPPHUFLDO6KDUH$OLNH ,*2OLFHQFH && %<1&6$ ,*2KWWSVFUHDWLYHFRPPRQVRUJOLFHQVHVE\QFVDLJR 8QGHUWKHWHUPVRIWKLVOLFHQFH WKLVZRUNPD\EHFRSLHGUHGLVWULEXWHG DQGDGDSWHG IRUQRQFRPPHUFLDOSXUSRVHVSURYLGHGWKDWWKHZRUNLV DSSURSULDWHO\FLWHG,QDQ\XVHRIWKLVZRUNWKHUHVKRXOGEHQRVXJJHVWLRQWKDW)$2