Steeleville buys more property Page 9
Steely case Page 6 Weir Ford moves Serving The Area With Local News Since 1980 Page 10 Perry primary race Page 15 © Copyright 2015, County Journal www.countyjournalnews.com
Volume 37 Number 10 32 Pages Your Local News Leader Thursday, March 10, 2016 75¢ Illinois voters will cast Jury says Young’s their ballots next Tuesday death was accident After nine months of in- vestigation, an inquest was It’s primary election time. held Tuesday into the death Testimony The polls open next Tuesday of Joshua Young of Sparta. at 6 a.m. The Illinois Primary Young died during the indicated he put Voters must declare their early morning hours of party affiliation to get a bal- May 31 in Apartment 4 at the gun in his lot unless they want to vote 140 W. Broadway in only for any referendums on Sparta. mouth; family the ballot. After hearing about a half thinks someone There will be spots on the hour of testimony, the jury ballots to nominate a U.S. of six people took more else did it senator, state comptroller, than an hour to come up congressman from the 12th with a decision. They ruled District, state senator, state that Young died due to ac- bre pistol, had been taken representative, county coro- cidental shooting. from the apartment but was ner, circuit clerk, state’s attor- Randolph County Coro- soon found in a vehicle. ney, county commissioner, ner Randy Dudenbostel Kempfer testified that he and two appellate judges. called three witnesses, interviewed those involved In the 20th Judicial Circuit, Sparta police officer An- several times. He said the voters will decide on two cir- drew Dahlem, Sparta As- gun was owned by Sparta cuit judges for St. Clair sistant Police Chief Jeremy resident Anthony Stewart, County. They are for the po- Kempfer and Randolph who had been in the apart- sitions of John Baricevic and Voting for president County Chief Deputy Coro- ment when the shooting Robert Haida. ner Carlos Barbour. took place. Also present Judge Richard Brown, a Next Tuesday, Democrats and Republicans will nomi- Young was pronounced were LeJuan Lanton and Democrat, will run for reten- nate candidates for the November election. dead at the scene at about Isaac Hyte of Sparta. tion in the November election. They will also take care of party business, choosing 2 that morning. He died of Kempfer said Stewart told He is not on the primary bal- presidential delegates to their national conventions a gunshot wound to the him that he had laid his gun lot. this summer. head. on the floor. Young grabbed C.J. Baricevic from St. Clair The Illinois ballots, in one spot, list all of the presi- Dahlem was the first of- it and stuck it in his mouth, County is running for Con- dential candidates. In another spot, it lists delegates ficer on the scene. He said then the gun went off. Stew- gress from the 12th District. and the candidate to whom they are sworn. he took information from art picked up the gun and He has no primary opposition. Which vote—for the candidate or his/her delegates— three men who came to the left the scene. He went to On the state level, Republi- is most important? scene after he arrived. his mother’s house, where cans have a contest for 58th The two parties handle their delegate selection a little Some told him they had he awakened his brother District senator. They are differently in Illinois. been in the apartment and told him what had Paul Schimpf and Sharee Heather Kimmons, legal counsel for the Illinois State when Young was shot. The gun used, a .45 cali- Continued on Page 5______Continued on Page 5______Continued on Page 5____ Perry Co. board releases much-anticipated transcript By Travis Lott release only a transcript and ests.” After months of criticism, leave out the names of non- “The contents of that tape the Perry County Board of Comments show board members came from and attributing that line for Commissioners voted to re- animosity between Perry County State’s Attorney line would only give (the lease a transcript of the por- David Stanton, and he ex- highway workers) fuel,” Robb tion of the closed session in workers and plained what led to Stanton’s said. “It’s only going to fos- which the board allegedly vio- request. ter hostilities on their part.” lated the Illinois Open Meet- administration “The relationship between Robb’s letter raised another ings Act by discussing the the highway department question pertaining to the idling of highway department only the transcript. union workers, the engineer OMA. employees in November. The transcript identifies and the board is not good,” He wrote that the elected of- During the previous meet- only board members who Robb said. “If (the union work- ficials in the closed session ing, the board voted to ap- spoke during the closed ses- ers) were high school stu- could have discussed the mat- point Commissioner Sam sion and omits the names of dents, they would be called ter outside the board meeting Robb to prepare the informa- anyone else. bullies. They abuse (Otten) without the requirements out- tion to be released to the However, the question re- and work against the good of lined in the OMA. press. mains of whether or not that the county.” “If the board made an error, However, during the Febru- was proper, considering that Robb wrote in a cover letter it was in not excusing those ary 18 board meeting, the the others who spoke during sent with the transcript that officials to meet elsewhere for Sam Robb commissioners voted on a mo- the closed session are elected omitting the names of those their discussion,” Robb wrote. public business.” tion to release a tape of the officials. who spoke in the meeting is That, however, would, in it- That means any two mem- meeting, not a transcript. “With the exception of an effort to deflect ridicule self, have been in violation of bers of the three-member Since the intent all along (highway department engi- against any nonboard member the OMA. board of commissioners would was to release a transcript of neer) Brian Otten, everyone from the “... mean spirited The act states that a “... meet- be considered a quorum. the closed session, the board in that meeting was an people who have proven time ing means any gathering of Robb later said that the re- voted March 3 to rescind the elected official,” Robb said. and time again that their only a majority of a quorum of the mark in his letter was high- motion to release the actual Robb, who is not seeking re- interest is in promoting them- members of a public body held recording and voted to release election, said that the call to selves and their selfish inter- for the purpose of discussing Continued on Page 5____ Republicans have race to replace Senator Luechtefeld By Dan Zobel that I’ve lobbied,” Langenstein transparent and thoughtful For the first time since 1995, said. “Anyone who will criti- answers to very serious issues the 58th District Senate seat cize me for that, my answer facing the state economic cri- in Illinois will be occupied by is bring it on.” ses.” someone other than Dave She is in favor of reducing Langenstein said that two Luechtefeld. the restrictions on concealed days before she ran for office, Luechtefeld announced last carry and is working toward someone told her there was year that he would retire at adding additional due process already a candidate picked, the end of his current term. protections into the law for and she should stay out of the He was appointed to his posi- persons who have been denied race. tion in 1995, following the concealed carry rights. “I ask you to join me in my resignation of Ralph Dunn. Langenstein is pro-life and rebellion,” Langenstein said. Luechtefeld has not lost since. said she is the only pro-life “I ask you to join with me to That retirement decision candidate running for this preserve southern Illinois val- was made, in part, because in seat. ues for the next generation. 2012, his residence was “Unlike my opponent, who “I ask you to join me in fight- moved out of the 58th Dis- recently made statements to ing for faith, for firearms and trict. If Luechtefeld wanted to the St. Louis Post Dispatch for family. When you vote, run for reelection, he would that pro-lifers need to compro- please vote me as your next have had to go against Repub- Sharee Langenstein Paul Schimpf mise with pro-abortion orga- state senator.” lican Kyle McCarter in the cused on constitutional law, good life. nizations, I will never ever Schimpf grew up in Water- 54th District. especially as a gun rights law- “I’m not looking to make poli- compromise on values core to loo and left for the U.S. Ma- Instead, Luechtefeld chose to yer. tics my career,” Langenstein our party. rine Corps in 1989. He spent retire, ushering in an oppor- Langenstein said she took a said. “I renounce a pension, “I will not compromise on 24 years in the military. tunity for new Republican good part of three days off the and I renounce health care life; I will not compromise on “While I was in the military, candidates, which later took campaign trail to assist in benefits. It’s very important to family, and I will not compro- I was an infantry officer in the the form of Sharee Lang- getting people in the area hot me that I continue on with mise on the second amend- Marine Corps, which means, enstein of Murphysboro and meals who lost their homes to that. ment. I am a conservative. I’m if you trust me to be your next Paul Schimpf of Waterloo. flooding. “I’ve been married for 17 not backing down from that.” state senator, you will actu- The winner will face Demo- “I would never choose win- years and we have six beauti- She also stated that she re- ally have a senator who made crat Sheila Simon in Novem- ning an election over serving ful daughters.” cently received the endorse- his living with an M-16 for ber. Simon is unopposed in the people of southern Illi- Langenstein is also a mem- ment of the Chicago Tribune, four years. That will cause the primary. nois,” Langenstein said. ber of the NRA, and because which she said did not ask her some progressive minds to Both GOP candidates took “That’s the most important of her expertise in firearms about life, babies or guns, but explode up in Chicago.” time to speak at the March 5 thing.” law, she said the Illinois State about the budget, pensions, Schimpf said a recent candi- Lincoln Day dinner at the She added that it is not that Firearms Association asked health care and education. date survey by the NRA gave Steeleville Legion. she does not want to win, but her to start lobbying for them. “I’m excited that I earned the Langenstein is a lawyer fo- she has a good family and a “I am not ashamed of the fact endorsement because I had Continued on Page 5_____ Page 2 County Journal March 10, 2016
Brothers, cousin Police blotters for the past week
Brandon M. Catch- drug paraphernalia license revoked. He James Loucks, 39, of arrested in Tilden ings, 22, of Sparta was and aggravated as- was given a notice to Coulterville was cited arrested February 29 by sault. appear in court March 3 by the Perry Brothers accused of stealing Sparta police on a St. **** **** County Sheriff’s De- Clair County warrant Edward Ohlsen, 46, A 15-year-old Sparta partment for driving a As a result of an in- for disorderly conduct of Marissa was arrest- juvenile was arrested vehicle with expired vestigation by the Ran- and driving on a sus- ed February 4 by March 2 by Sparta po- registration and no in- dolph County Sheriff’s pended license. He was Marissa police for pos- lice for unlawful pos- surance. Department and police jailed. session of a controlled session of a controlled He was given a no- in Steeleville and Til- **** substance and posses- substance and posses- tice to appear in court. den, two brothers were Shannon L. Knuck- sion of a controlled sion of drug parapher- **** arrested in connection Timothy Jason les, 34, of Nashville was substance with intent nalia. He was taken to Brandi Rice, 31, of with burglaries, and Zacheis Zacheis arrested March 3 by the to deliver. jail. Willisville was arrested their cousin was ar- Randolph County sher- **** **** March 1 by the Perry rested for production iff’s office on a Ran- Kimberly Winter, 29, Crystal I. Williams, County Sheriff’s De- of cannabis. dolph County warrant of Marissa was cited by 28, of Sparta was ar- partment on a warrant Timothy L. Zacheis, for permitting truancy. Marissa police Febru- rested March 2 by for probation viola- 33, of Tilden was ar- Knuckles was re- ary 6 for driving with- Sparta police for driv- tion—unlawful posses- rested for burglary and Shelby Lopez leased on a recogni- out a valid license. ing while license sus- sion of methamphet- Jason L. Zacheis, 32, of zance bond. **** pended. She was given amine. Steeleville, for theft. residences of both **** Karen Girken, 47, of a notice to appear in She was taken to jail The brothers were ar- men and reportedly Danielle E. Rachell, Pinckneyville was cit- court. with bond set at $3,000 rested for seemingly uncovered the stolen 20, of Fairview Heights ed by Marissa police **** cash. unrelated incidents. property. was arrested March 3 February 14 for unlaw- Dorreen K. Dobson, **** According to court During the raid on on a Randolph county ful visitation interfer- 25, of Sparta was ar- Zachary Anderson, documents, Jason was the home in Tilden, warrant for failure to ence. rested March 3 by 18, of Ava was cited charged with theft un- police discovered a appear in court on a **** Sparta police for driv- March 2 by the Perry der $500, a Class 4 marijuana-growing possession of a con- Justin Martin, 37, of ing while license sus- County Sheriff’s De- felony, for stealing operation, which re- trolled substance Steeleville was arrest- pended. She was given partment for negli- from Head Waters. sulted in the arrest of charge. She was jailed. ed by Marissa police a notice to appear in gent driving in Willis- Timothy was Shelby R. Lopez, 22, of **** February 17 on a St. court. ville. charged with burglary Tilden. Aristeo A. Castaneda- Clair County warrant **** March 7, Anderson for knowingly entering Timothy was also Chavez, 53, of Percy was for DUI. Denise F. Dunnavant, was arrested by Steele- the residence of a charged with produc- arrested March 3 by **** 29, of Granite City was ville police for posses- home on the Ran- tion of cannabis. Steeleville police for Nicole Schnieder, 25, arrested March 5 by sion of alcohol by a dolph/St. Clair County The two brothers re- driving an uninsured of Marissa was arrest- Sparta police for unlaw- minor, fleeing or at- Line Road with the in- main incarcerated. vehicle and driving ed by Marissa police ful possession of drug tempting to elude po- tent to commit a theft. Timothy is being held without a valid driver’s February 17 for posses- paraphernalia. She was lice and speeding. This is a Class 2 felony in lieu of $7,500 cash license. He posted sion of a controlled given a notice to appear He posted $150 cash and is non probation- bond and Jason in bond. substance and two in court. and was released. able due to prior bur- lieu of $2,500. **** counts of endangering **** **** glary convictions in Lopez was released Daniel D. Murphy, 30, the health of a child. Jackson and Spokane after posting $1,000 of Imperial, Missouri **** counties. cash. was arrested March 4 Ayla Jones, 23, of Police executed The investigation is by the Randolph Coun- Sparta was arrested by search warrants at the ongoing. Tired Of Inept Retailers ty sheriff’s office on Marissa police Febru- And Deceptive Sales? See Me! warrants for failure to ary 17 for possession of appear in court on a re- a controlled substance. tail theft charge and pe- **** FULL SERVICE Coulterville wreck tition to revoke proba- Amanda Smith, 29, of JEWELRY A Murphysboro wo- 100 feet north of City tion. He was jailed. Marissa was arrested man escaped with lit- Lake Road when a deer **** by Marissa police Feb- CENTER tle or no injury when entered the roadway. Joshawa K. Bulliner, ruary 24 on a St. Clair In Store Full Service • Custom MFG 18, of Sparta was ar- County warrant for her car struck a power Broadway swerved to Great Style Selection • 10-18K & Platinum Since pole near Coulterville miss the deer and lost rested March 4 by Spar- theft. Loose Stone Service 1949 just before 8 p.m. March control of her car, ta police on a Jackson **** Excellent Prices • Remounting 5. which traveled about County warrant for fail- Clifton Crowell, 21, of Paul R. Wicker The Randolph County 75 feet through a ditch ure to appear in court Marissa was arrested sheriff’s office identi- and struck a utility on a possession of can- by Marissa police Feb- 301 W. Broadway creative excellence fied the woman as 18- pole. nabis charge and resist- ruary 21 for driving on Steeleville, IL 62288 year-old Kendra C. The Coulterville Fire ing an officer. He a suspended license www.wickersjewelry.com (618) 965-3413 Broadway. She was driv- Department also re- posted bond. and driving an unin- ing north on Route 153, sponded to the scene. **** sured vehicle. Bethany D. Payne, 23, **** of Murphysboro was ar- William King, 53, of rested March 5 by the Marissa was cited by Music Lessons Randolph County sher- Marissa police Febru- Fire damages tavern iff’s office on a Jackson ary 25 for failure to ob- BERKLEE COLLEGE OF MUSIC ALUMNI Broadway Corner about 11:20 p.m. March County warrant for fail- tain an occupancy per- PROFESSIONAL INSTRUCTOR Lounge in Willisville 6. The bar was closed at ure to appear in court mit. was still closed as of the time. on a contributing to the **** With More Than 25 Years Of Experience Tuesday night after a Vickery estimated delinquency of a child Lisa Thompson-King, fire Sunday. that the fire caused charge. She posted 52, of Marissa was cit- Has Openings For Students Of All Ages Willisville Fire Chief about $7,000 worth of bond. ed by Marissa police Doug Vickery said an damage, including the **** February 25 for failure Guitar • Bass • Banjo • Piano • Violin electrical problem in a wall on which the sign Christopher M. Fos- to secure an occupancy neon sign on the north was hanging. ter, 30, of Chester was permit. Call Rich Creadore 618-317-3311 wall of the building He said there was a arrested March 5 by **** was the cause of the lot of smoke and water state police in Ran- Stacey Glessner, 34, Located in Sparta fire, which broke out at damage. dolph County for driv- of Renault was arrest- ing on a suspended li- ed by Marissa police cense, illegal transpor- March 1 for disorderly tation of an alcoholic conduct (filing a false Lane is sentenced beverage, failure to police report). ACCIDENTS HAPPEN A Randolph County doephedrine for use in wear a seatbelt and **** man will spend the the manufacture of speeding. He posted Shain Endicott, 22, of We’ll Restore Your Vehicle Quickly next eight years in a meth. bond. Marissa was arrested & At An Affordable Cost! federal prison for his The judge found that **** March 3 by Marissa role in a methamphet- Lane was responsible Jarvis S. Smith, 56, of police for reckless con- Estimates Available amine conspiracy. for the possession of Sparta was arrested duct and endangering After Hours & Weekends... Brian T. Lane, also 151.88 grams of pseu- March 5 by Ruma po- the health of a child. Just Give Rick A Call! known as Squirrel, 32, doephedrine and two lice on a St. Clair **** of Coulterville was sen- grams of ice/metham- County warrant for pro- Eric McDonald, 37, of Any Type Of Collision tenced March 3. He phetamine. bation violation. He Marissa was arrested was also fined $200. The offense occurred was released to St. Clair March 4 by Marissa SPRAY IN BED LINERS Lane had previously between 2013 and June County authorities. police on a St. Clair pleaded guilty to one 2015 in Perry, Jackson **** County warrant for pro- Sandblasting On Small Or Large Items count of conspiracy to and Randolph coun- John C. Payne, 48, of bation violation. distribute and manu- ties. Chester was arrested **** facture meth. Two codefendants March 5 by Chester po- Brian Frame, 39, of WE TAKE DENTS OUT OF ACCIDENTS Hillside Auto Body Evidence at the plea were previously sen- lice for aggravated as- Marissa was arrested Across From Trico • Rte. 4 • Campbell Hill • 426-3226 and sentencing hear- tenced, and five others sault and possession of March 4 by Marissa ings established that pleaded guilty and are drug paraphernalia. He police on a St. Clair Lane was involved with awaiting sentencing. posted bond. County warrant for traf- others in the manufac- Four codefendants **** fic violations and a ture and distribution of have pleaded not guilty Andrew S. Demond, Missouri warrant for meth. Lane obtained and are awaiting an 29, of Evansville was ar- parole violation. and collected pseu- April 18 jury trial. rested March 6 by **** Ruma police on a Roseann Parker, 28, Randolph County war- of Marissa was arrest- rant for failure to ap- ed by Marissa police Randolph court pear in court on a crimi- March 5 for disobeying The following cases Marlon Patterson of nal trespass to land a stop sign and driving have been terminated Sparta, domestic bat- complaint. He posted on a suspended li- in Randolph County tery, guilty, fine. bond. cense. circuit court. Richard Ripley Jr. of **** **** When You Want it to Work... Jennifer Higgins of Granite City, posses- Keith A. Claybourn, Ricky Carle, 27, of Sparta, unlawful visita- sion of drug parapher- 30, of Sparta was ar- Marissa was arrested tion interference, not nalia, court supervi- rested March 6 by March 5 by Marissa po- Beautifully guilty. sion, fine. Sparta police for aggra- lice on a Randolph Chace Kempfer of Bethany York of Per- vated battery of a po- County warrant for for- Evansville, consump- ryville, criminal dam- lice officer. He was gery. tion of liquor by a minor, age to property, dis- jailed. **** You want a Raynor garage door court supervision, fine. missed. **** Misty Calvert, 26, of Christopher D. Har- Marissa was arrested from Gateway FS. tig, 24, and Shaun K. March 5 by Marissa po- Rocher woman dead Crumby, 36, both from lice on a Monroe Coun- Raynor offers hundreds of colors, pane options Missouri, were given a ty warrant for retail and panel styles to make your home look its best. An investigation is uled for Wednesday. notice to appear in theft, possession of a taking place into the Masterson was di- court by Chester police controlled substance death of Jennifer Mas- vorced and was preg- March 1 for not having and criminal damage terson, 30, of Prairie du nant. a peddler’s license to property. Rocher. The investigation is when required. **** Masterson was found being conducted by **** Brandon M. Catch- dead at her 804 Bluff Randolph County Cor- John C. Payne, 48, of ings, 22, of Barnhart, Street home Sunday at oner Randy Duden- Chester was arrested Missouri was arrested about 10 a.m. by a bostel, the sheriff’s of- March 5 by Chester po- February 29 by Sparta 3631 Old State Route 3 Red Bud, IL friend fice, state police and lice for possession of police for driving while 282.3454 | (866) 551.3454 fsconstructionservices.com An autopsy was sched- Rocher police. March 10, 2016 County Journal Page 3 Marissa man faces several charges after car hits house A Marissa man is in She said he had battered damaged. the St. Clair County Jail her. Charles fled the scene after an incident in Kahle told police that but was chased then lost Marissa March 5. she and a 5-year-old boy by the homeowner. A According to Marissa fled the scene in a ve- police officer caught Police Chief Tom hicle, and Charles Charles about five blocks Riess Ford & Ford Truck Month Prather, his officers re- chased them in another away from the scene, ceived word Saturday vehicle. and he was arrested. night at about 9:20 of an He allegedly caught up Kahle and the child Are A Winning Team! accident in the 500 block to the woman, rammed were not injured. of South Euclid Street. her vehicle in the side, Charles was taken to St. It’s Time To Spring Into These Savings! Prior to their arrival at and her car ran off the Elizabeth Hospital in the scene, officers saw a road, striking an unoc- Belleville, where he was woman, later identified cupied vehicle. treated and released to 2016 Ford F150 XL as Nichole Kahle, who After Charles’ vehicle police custody. had been involved in the hit hers, his went on to Charles is charged Power Equipment Group accident. hit a house on Euclid with domestic battery, NEW MSRP ...... $30,045 Kahle told police that Street. aggravated DUI, endan- Riess Ford Discount ..... $1,000 she and her boyfriend Prather said there was gering the life of a child Bonus Customer Cash . $1,500 Tyrone Charles, 26, had minor damage to the and failure to report an Retail Customer Cash ..... $500 been involved in an al- house, but an air condi- accident with injuries to tercation on Mill Street. tioning unit outside was police. Riess Ford Truck Month Price – $ Stk. #5188 27,045 Walker releases court details Randolph County Hagene admitted to mation gained from his State’s Attorney Jer- possessing fewer than prosecution helped bol- 2016 Ford F150 4x4 XLT emy Walker has re- five grams of metham- ster our case against a SuperCrew • 3.5L • EcoBoost • Chrome Package leased details of the phetamine December codefendant. For those MSRP ...... $49,900 February court cases. 17 in Steeleville. reasons, we elected to a Riess Ford Discount ..... $3,000 Cheyanna Cole “Hagene had a prior probation disposition,” NEW Bonus Customer Cash . $1,500 Cheyanna K. Cole, 34, felony reduced to a mis- said Walker. F150 Special Retail of Coulterville was sen- demeanor in 2014, and Tina Miller Customer Cash ...... $1,250 tenced February 5 to for that reason, I did Tina A. Miller, 34, of Retail Customer Cash .. $1,000 five years in prison. not believe first of- Sparta, was sentenced Cole had previously fender probation was February 25 to eight Riess Ford Truck Month Price – admitted to entering an appropriate and a years in prison. Miller automobile in Coul- felony conviction was previously pleaded $ terville September 14, necessary,” said Walk- guilty to unlawful par- Stk. #5181 43,150 2015 with the intent to er. “Treatment and op- ticipation in metham- commit a theft. tions to help the defen- phetamine production, At the sentencing dant will be made avail- and a sentencing hear- hearing, the state re- able to him.” ing was set before 2015 Ford F150 XLT Judge Richard Brown. quested a seven-year Curtis Parrott MSRP ...... $43,895 sentence, and the de- Curtis W. Parrott, 36, During the hearing, SuperCab 4x4 fendant requested three of Farmington, Mis- Miller requested a term Riess Ford Discount ..... $3,000 years. souri was sentenced to of probation, while the Bonus Customer Cash . $1,700 “Cole has accumu- 60 days in the Ran- state requested eight NEW Retail Customer Cash .. $2,250 lated numerous felony dolph County Jail and years in prison. F150 Special Bonus convictions and has 30 months of probation “The presentence re- Customer Cash ...... $1,000 been to DOC in the following a sentencing port showed Miller had “EcoBoost” Bonus past,” said Walker. hearing February 18. prior felony convic- Customer Cash ...... $300 “However, her longest He will also have to tions and a sentence to Riess Ford Truck Month Price – prior sentence was for register as a sex of- the Missouri Depart- three years. I hope the fender the rest of his ment of Corrections,” $ time in corrections fi- life. said Walker. “It is typi- Stk. #5090 35,645 nally wakes Cole up. Parrott was found cally my belief that a “At the sentencing guilty October 26 of prison sentence should hearing, it was obvious indecent solicitation of go up each time we see she suffered/suffers a child. somebody. We are very 2016 Ford F150 XLT from a drinking prob- At the trial, it was pleased with the sen- MSRP ...... $46,725 lem. However, numer- proven that Parrott had tence of seven years.” SuperCrew 4x4 ous efforts have been discussed an act of Kenneth Monroe Riess Ford Discount ..... $3,000 made in the past to help sexual penetration with Kenneth Monroe, 54, Bonus Customer Cash . $1,500 alleviate it.” a minor by using of Sparta, pleaded NEW Retail Customer Cash .. $1,500 Caylon Daniel Facebook in May 2014. guilty February 29 to F150 Special Bonus Caylon M. Daniel, 20, During the sentenc- unlawful possession of Retail Cash ...... $750 of Chester, was sen- ing hearing, it was a controlled substance “EcoBoost” Bonus tenced February 5 to shown that Parrott had He was sentenced to Customer Cash ...... $300 nine months in the no prior criminal his- two years of probation Randolph County Jail, tory. Additionally, it with a condition to seek Riess Ford Truck Month Price – two years of probation was never alleged or alcohol/substance $ with a condition to seek proven that the defen- abuse treatment. Mon- Stk. #5153 39,675 anger management and dant ever made any roe’s probation is un- will have to register as physical contact with der the terms of the first a violent offender the minor. offender probation act, against youth. The state requested a and he will have the op- Just Arrived! Daniel previously ad- sentence of one year in portunity to have the mitted to causing prison, while the de- felony dismissed after 2016 Ford bodily harm to a child, fense argued for proba- successful com-pletion who resided with him tion. of the probation period. August 16, 2015. “Even through the de- During the negotiated Mustang GT 350! During the sentenc- fendant has no prior plea, Monroe admitted to ing hearing, the state history and no physi- possessing fewer than 15 requested a sentence of cal contact was made, I grams of dihydroco- PRE-OWNED TRUCK MONTH DEALS five years in prison, and felt it was necessary to deinone (a prescription Daniel requested time request a sentence to pill) April 8. already served with DOC,” said Walker. “It Jared Davis 2015 Ford F150 2014 Ford F150 probation. is a very scary situa- Jared M. Davis, 25, of “During the sentenc- tion when you had an Percy, pleaded guilty ing hearing, it was adult talking in a March 3 to burglary shown that the defen- sexual nature with a and was sentenced to dant had no prior crimi- person they know to be six years in prison. nal history, and the a minor.” During the negoti- Stk. #R28608 child has fully recov- Joshua Elliott ated plea, Davis admit- Stk. #R28622 ered from the injuries Joshua L. Elliott, 28, ted to entering a some- SuperCab XL Sport • 9k Miles 4x4 • SuperCrew XLT • Leather • 25k Miles sustained in the inci- of Caseyville, pleaded one else’s motor vehicle $ $ dent,” said Walker. guilty February 23 to in Percy with the in- Truck Month Deal – 26,881 Truck Month Deal – 32,617 “Nonetheless, I re- theft over $500. tent to commit a theft quested a sentence to He was sentenced to November 1. 2016 Ford Explorer 2016 Ford Explorer DOC, as the victim was two years of probation, Pursuant to the terms 14 months of age at the with a condition to seek of the negotiation, Stk. #R28621 time.” alcohol and substance Davis will be referred Tim Hagene abuse counseling and to the impact incarcera- Timothy D. Hagene, pay restitution to the tion program (boot 25, of Steeleville, victim. camp) within the De- pleaded guilty Febru- During the negoti- partment of Correc- Stk. #R28578 ary 18 to unlawful pos- ated plea, Elliott admit- tions. Limited • Loaded • 1,300 Miles XLT • SHARP! • 100 Miles session of methamphet- ted to exerting unau- “Davis has an appar- $ $34,988 amine. thorized control over ent drug problem,” said Truck Month Deal – 38,988 Truck Month Deal – Pursuant to the ne- property of a heavy Walker. “We see all the gotiated plea, Hagene equipment business in time that those addicted was sentenced to 90 Randolph County Feb- have to resort to steal- SERVICE DEPARTMENT days in the Randolph ruary 2, 2014. ing to support their County Jail and two He had a prior crimi- habits. I hope his time Buy Four Select Tires, years of probation with nal history. in DOC, particularly And Get Up To An a condition to seek al- “However, our case the boot camp program, $ 95 cohol/substance abuse against Elliott was not will give Davis the in- 29 $ * $ 00 counselling. as strong as it could sight and motivation to After 10 Rebate By Mail During the plea, have been, and infor- kick his habit.” • Synthetic Blend Oil Change 80 • Tire Rotation & Pressure Check Rebate By Mail • Brake Inspection • Battery Test See Dealer for details. • Multi-Point Inspection • Filter Check S’ville Legion, Lions in litigation • Fluid Top-Off • Belts & Hoses Check See Dealer for details. A small claims lawsuit nancial arrangement Call 618-295-3721 To Schedule Your Appointment is pending in Randolph that came out of that County circuit court Small claims special meeting. concerning the Steele- The Legion, through Find Us Online At www.riessford.com Or On Social Media ville July 4 picnic. court filing its attorney David Friess As filed November 24, of Red Bud, has filed a Your Friendly Ford Dealer For Over 50 Years! 2015, the Steeleville Li- motion for dismissal be- ons Club is suing for the 2012, 2013 and cause, Friess claims, the Steeleville American Le- 2014 picnics. The suit lawsuit papers do not gion Post 480. Both or- states that the amount include a copy of the ganizations have jointly of money is based on minutes from the 1952 RIESSRIESSRIESS sponsored the picnic for what was agreed to at a meeting that explain the years. special Legion and Lions financial arrangement. 768 State Rte. 13 • Marissa According to court meeting held in 1952. The most recent devel- records, the Lions are The suit also seeks to opment in the case was 618-295-3721 • www.riessford.com have the Legion cease a status hearing held seeking $858 they say Prices Do Not Include Tax, Title, License Or Documentation Fees. the Legion owes them trying to change the fi- last month in Chester. Page 4 County Journal March 10, 2016
We can pay a little now or a lot more later
he County Journal is years. and from menting these permanent T rarely in favor of big This is a the ceiling fixes would save the government spending. The small price Vote yes on the in various county around $60,000 a citizens’ tax dollars should for each parts of the year. be spent with discretion, citizen to building. A permanent fix to these and no government entity pay for the courthouse referendum The air problems would also keep has the right to waste what repairs condition- them from getting worse we all work for. We are necessary ing doesn’t and causing damage to taxed and taxed. to the Ran- regulate something irreplaceable, That said, Randolph dolph County Courthouse, This means that pipes, temperature throughout such as court documents County is proposing a ref- which are estimated at roofing and other aspects the facility. that date all the way back erendum on next week’s $2.95 million—money that need to be updated. Pipes going to facilities in to the 1700s. election ballot to refinance the county simply does not Last week, water once the jail have eroded away So when voting Tuesday, bonds, which would ex- have on hand. again poured into Judge through the limestone in- remember that a small tend a tax of 12 cents per The courthouse is not just Gene Gross’ courtroom, sulation behind the cells, cost in the short run could $100 of assessed valuation. a gem of the county or damaging his computer and cell doors sometimes save you a lot more in the The measure should pass. southern Illinois, but for and other electronic equip- don’t work properly, which long run. The tax that property the entire state. ment, causing the county could lead to a major haz- A yes vote on the referen- owners would pay will be The facility was con- to spend extra money to ard for jailers and inmates. dum would be a wise in- reduced from 14 cents, structed 42 years ago, and have the carpet dried and Band-Aid repairs have vestment. which is based on the pre- while it is still as aestheti- the room cleaned. become such a regular oc- Voters who do not wish to vious bonds that expire in cally pleasing as the day it Water also leaks into currence that county declare their party affilia- two years, to 12 cents and was opened, much of the electrical outlets in the board Chairman Marc Kie- tion, can request only the extended for eight more structure is original. state’s attorney’s office hna estimates that imple- referendum ballot. Getting serious about cereal Fashion me as a model? ittle did I know un sponsoring “The Lone hankfully, I’ve size smaller. “It works if Ltil I watched a Buzz Ranger” radio broadcast T never had aspira- you don’t button it,” she 60 video that Monday in 1941 and continued tions to be a model. At 5 A said. Another option was National Cereal its ties until the last tele- feet 1.5 inches, the best would be just to carry it Day. I did some re- Meacham vision episode aired in thing I could model and throw it over the search, and it really 1957. At its peak, the might be a wheelbarrow, Musing shoulder while strutting brought back some Madness television show drew 45 or maybe I could be a ® down the runway. memories. million weekly viewers, hand model like George View The next order of busi- But first some back- and the radio broadcast Costanza from the Sein- ness was to find some ground, which I got off By John Meacham had 20 million listen- feld TV series. Of course, By Martha Peebles cute jewelry to go with the internet: ers.” my hands, full of bulg- it. They had a nice neck- At the time of the War GM’s offers included ing veins, pouchy lace that matched per- of 1861, people ate so til inadvertently con- toy guns, Lone Ranger knuckles and short stub- fectly. Unfortunately, I much salted meat that cocting a process that masks and pocket-sized by fingernails would am still waiting for my they had frequent belly- allowed wheat to flake. comic books, pedom- likewise not be photoge- lobotomy (ear lobe sur- aches. In addition, re- Two years later, corn eters, two-inch-tall fig- nic. gery) to heal so only one formers of the 1860s flakes were formulated, ures of cowboys and In- Somehow I got talked earlobe can sport an ear- viewed too much meat and they became an im- dians, big as life posters into being in a spring ring. Maybe a more nau- consumption as un- mediate success. and the Lone Ranger fashion show for the tical pirate look, com- wholesome, both physi- Today, of the more Frontier Town. Home Extension meet- plete with eye patch and cally and spiritually. It than 314 million people But one of the most un- ing held in Murphys- one hoop earring would was believed by some in the U.S., 49 percent usual promotions oc- boro last Saturday. The have been appropriate. that a high-protein diet start their day with a curred in 1951 when 10 instructions were to go While walking out of contributed to lust and bowl of cereal. children won a trained to Christopher & Banks the store, the thought sloth and that constipa- When I was a boy back white horse through in the mall and get fitted occurred that white tion and other maladies in the ’50s, my friends Cheerios’ Lone Ranger for an outfit. Their cloth- shoes were also needed of the gastrointestinal and I weren’t nearly as Coloring Contest. (I ing line is actually very to complete the look. tract were God’s punish- concerned about a wasn’t one of them.) nice, and it was fun pick- Thinking that my toes ment for too much pork cereal’s taste or nutri- I also remembered that ing out something to were looking good from and beef. tional value as we were Kellogg’s Sugar Corn wear. A turquoise lay- last week’s pedicure, John Kellogg, a Sev- about which TV Western Pops sponsored the ered top with white den- sandals might be just enth Day Adventist and it sponsored and what “Wild Bill Hickock” im capris and a white the ticket. After search- a surgeon, created gran- free gift was in or on the show, starring Guy Mad- denim jacket looked to ing for just the right heel ola as a healthy alterna- box. ison as Wild Bill and be a good choice. Tur- size, not too low (who tive to meat. I seem to recall that Andy Devine as Jingles, quoise is a color that is wants to see a dumpy With the help of his Cheerios sponsored whose last name, I supposed to look good model?) and not too brother, Will Kellogg, “The Lone Ranger,” and learned, was Jones. on everybody. high (likewise, a clumsy the pair would continue I was right. The General One Sugar Pops box They didn’t have my model is never a good to invent healthy, meat- Mills website says that size in the jacket, so the Martha in the outfit she less breakfast foods un- General Mills began Continued on Page 5 salesgirl had me try a modeled Continued on Page 5
The new bonds will Appreciated also allow the court- More scams are out there Rader article house’s aging, ineffi- Editor, County Journal: Letters cient heating and air requently, this and to Publishers Clearing Fmany other news- House. Thank you for printing conditioning systems to papers publish stories She told the clerk that the article about Charlie To The be replaced with new, about scams, which usu- she had received a call Rader and to the family more efficient systems. ally come via telephone. Editor’s from PCH that she had of Charlie Rader for al- Furthermore, a yes vote Recently, a Sparta man won a major prize. She lowing it to be printed. Editor will allow for jail cell im- called me to relay some needed to wire them Tex Driver’s letter, in provements that will stories about scams of Space some good faith money, my opinion, could not bring the jail in line with which he was involved. then they would fly her but help resonate a con- modern safety stan- and maintenance to His name is not impor- to Las Vegas, where she nection with Charlie’s dards. By Jerry Willis keep it in good condi- tant here. would collect her prize. story for any combat vet- Taken together, it is es- tion. The time for those He received a phone She was ready to send eran. timated that these repairs and renovations call from a girl who said the money until Wal- It was a most respect- changes will save tax- is now. she was his grand- suspicious and recom- mart personnel warned ful tribute to a valiant payers $60,000 per year We have seen, first- daughter. mended that he not wire her that it was probably and honorable man. hand, many of the struc- in reduced energy and “She sounded just like the money. That tip a scam. “Lest we forget.” tural problems in need repair costs. Addition- my granddaughter,” he saved him $2,000. The A company representa- of repair. For example, ally, because the exist- said. call was a scam. tive said Walmart hand- Gerald Poenitske Sr. the leaking roof in ing bonds will be paid The girl told the man The man said he also les a lot of money trans- Walsh Judge Gross’ courtroom off in two years, all of that she had an accident once received a call fers all over the country recently caused damage these repairs and reno- and needed $2,000 so from someone saying he and world, and it is com- to the sound equipment vations can be accom- the couple in the car she was from Amazon. He pany policy to do what Support tax a computer. Several plished while lowering hit could get back home wanted the man’s birth can be done to protect referendum trash cans even had to the amount of taxes to the country of Leba- date, social security customers from scams. Editor, County Journal: be placed around the compared to what is cur- non. number and other infor- I tried to get more in- The members of the courtroom, including on rently paid to the The man said he would mation. The man wisely formation from Wal- Randolph County Bar the judge’s desk, to cap- county. get the money to the in- refused to give him any mart as to how many Association recently ture the leaking water. As fellow Randolph jured couple’s attorney. of those details. suspected bogus money passed a resolution in Obviously, these prob- County citizens, we, like He went to Sparta Wal- Another time, he was orders they stop, but I favor of the upcoming lems have interfered you, take pride in our mart to wire money to a in Walmart and saw an was unable to get bond referendum (on with court proceedings. courthouse and hope supposed attorney. elderly woman with a through to the media the March 15 ballot) for In addition to harming However, the Walmart stack of $50 bills. She department in Arkan- you join us in voting yes repairs and improve- expensive courthouse clerk said it sounded was going to wire money sas. for these necessary re- ments to the Randolph technology and interfer- pairs and improve- County Courthouse. ing with court proceed- ments. The courthouse is over ings, the leaking roof Policies Of The County Journal River Stages 40 years old and, just places decades of irre- Members of the A Publication Of Willis Publishing, Inc. Mississippi At Chester like any other building, placeable court files in Randolph County Larry Willis, Kristin Anderson, John Falkenhein Flood Stage 27 Ft. needs regular repairs jeopardy. Bar Association Owners/Publishers Mar. 4 ...... 17.3 PUBLISHED EACH THURSDAY Mar. 5 ...... 16.8 1101 East Pine • Box 369 • Percy, Illinois 62272 Mar. 6 ...... 16.5 Legal questions, answers (618) 497-8272 Mar. 7 ...... 16.0 Illinois Law Now is an from carefully weighing Question: What laws Letters to the editor must be signed in order to be Mar. 8 ...... 15.9 ongoing series of short the pros and cons based exist to protect kids published. A telephone number is also required for Mar. 9 ...... 15.7 answers to common le- on your personal situa- against internet preda- verification. Letters and news items are published at gal questions distrib- tion in consultation with tors? the discretion of the editors. All copy will be edited. uted by the Illinois State an estate planning attor- The County Journal does not publish poetry. Answer: The federal Classified advertising must be prepaid except for es- Bar Association and Illi- ney. Children’s Online Pri- tablished accounts. Political and certain other adver- County Journal nois Press Association. Question: Someone vacy Protection Act is tising must be prepaid. (USPS 549-110) Question: Do I need a dumped a pile of used designed to keep any- is published weekly on Thursdays Any person or organization holding a money mak- revocable living trust? car tires and other de- one from obtaining a ing event and wanting it advertised in the County Jour- for 75¢ each issue,$23.00 per Answer: A living trust bris on one of my prop- child’s personal infor- nal must discuss their promotion with the advertising year in Randolph, Perry and is a legal document you erties. Is removing it my department. Generally, if the organization charges for Jackson counties and Marissa. mation without a parent $ create which bypasses responsibility? the event, goods or services, the County Journal 25.00 per year in Illinois, $30.00 knowing about it. per year elsewhere, by County the costly and time-con- Answer: Under Illinois charges to advertise its event. suming process of pro- laws, the landowner is COPPA requires web- Letters advocating a candidate or referendum will Journal, Box 369, 1101 East Pine, sites to explain their pri- Percy, Illinois, 62272. bate. It is often used by responsible for all open be published as a letter to the editor until two weeks vacy policies on the site before an election. Within that two weeks such pro- Periodicals postage paid at Percy, those with complex fi- dumping on the prop- motions will be published only as paid advertisement. Illinois.POSTMASTER: Send nancial and personal erty, even if the owner and get parental con- Anyone wishing to express thanks must do so in a address changes to County circumstances. A living didn’t do the dumping sent before collecting or paid advertisement. Thank you notes will not be in- Journal, Box 369, 1101 East Pine, trust is not for everyone. or had any knowledge of using a child’s personal cluded in news stories. Percy, Illinois 62272. The best decision comes who dumped the debris information. March 10, 2016 County Journal Page 5
Tuesday election...From Page 1______Langenstein. delegates to this sum- didates. approve raising the tax Sheila Simon is the mer’s conventions. Re- Perry County has one rate from $1.50 per $100 only Democrat candi- publicans will elect three race, which is on the Re- assessed valuation to date for state senator from delegates and three alter- publican ballot. Current $1.75 per $100. the 58th District. nates. Democrats will assessor John Batteau is If approved, the real es- Impeccable Democrats have three choose six delegates. running for the county tate tax in the district candidates for U.S. sena- The ballots also contain board seat being vacated would raise $469,306 as tor. They are Andrea Zopp, popularity contests for by Sam Robb. He is op- compared to $402,262 un- Tammy Duckworth and president, listing all of the posed by Michelle Rodely. der the current rate. It Napoleon Harris. candidates, even those Randolph County will would also raise the bud- Republicans have two who have dropped out. vote on a proposed $2.9 get to about $1.6 million. candidates, incumbent The parties will also elect million bond issue to make Anyone who does not Senator Mark Kirk is be- precinct committeemen. repairs to the courthouse. wish to declare a party af- ing challenged by James Randolph County has no In Perry County, there is filiation but wants to vote Marter. local contests on either a referendum in the 204 on a referendum can re- The parties will also elect ballot. In fact, Republi- School district. The school ceive a ballot for that ref- party officials, including cans still need some can- is asking voters if they will erendum only. Voting for president...From Page 1______Board of Elections, said nificantly. For Illinois Demo- delegates are assigned it is a rather compli- In Illinois, the Repub- crats, on the other proportionately to the cated matter. lican presidential pref- hand, the primary is vote.” Illinois has an indi- erence vote is com- binding. For example, in a dis- rect primary, meaning monly called a beauty “The number of pri- trict entitled to nine del- voters don’t vote di- contest. It is advisory mary votes a presiden- egates, where Candi- rectly for a presiden- in nature and has no tial candidate receives date A receives two- tial candidate. Instead, bearing on the assign- in a congressional dis- thirds of the vote and they vote for delegates ment of delegates, who trict will determine the Candidate B receives aligned with or pledged are directly elected by number of delegate po- one-third, Candidate A to a particular candi- primary voters. sitions he or she will be would receive six del- date. In the Republican awarded from that con- egates and Candidate B Each of the major po- contest for delegates, gressional district,” would receive three. litical party candidates the three delegate can- said Kimmons. “How- The winning Democrat runs delegates pledged didates with the high- ever, a presidential can- delegates are not nec- to vote for him or her at est number of votes in didate must get at least essarily the ones who the convention. The del- each of the state’s 18 15 percent of the vote get the most votes, how- egates are identified by congressional districts in the congressional ever, because the party candidate preference on are the winners, and district to gain any per- has placed a priority on the ballot. The rules they attend the Repub- centage of the delegates gender equality, and governing delegate se- lican National Conven- in that district. Once each congressional dis- 201520152015 trict sends an equal 2015 lection are established tion, where a candidate the threshold 15 per- by the two political par- is nominated to the cent of the vote is ob- number of male and fe- ties, and they differ sig- presidency. tained by a candidate, male delegates. ModelModelModel Young case...From Page 1______happened. Hyte also said that passed it. Stewart’s Young’s parents, Kim- “He was afraid he Young put the gun in his clothing was also tested berly and Tyrone Young, would be going to prison mouth, and that at one for gun powder, and were at the inquest. BlowoutBlowoutBlowout because it was his gun,” point, the magazine was there was none. “We believe that the said Kempfer. “His out of the gun. His ver- Barbour said Young man who owns the gun brother told him to take sion of the events were was extremely intoxi- shot Josh,” said Kim- the gun back and tell the same as Lanton’s cated that morning, berly Young. “Josh was 15 Jeep Renegade police what happened.” and Stewart’s. with a blood alcohol a very happy person.” Lanton basically told “Isaac said Josh had level of .333—legally Any charges that may MSRP $24,285 the same story and said been depressed,” said drunk is .08. be filed are up to State’s Rebate $1,500 that Young had “played Kempfer, “and he was Barbour said Young Attorney Jeremy Walk- with” the gun. The gun very emotional when he died from a single gun- er. Menard Disc. $852 had been passed around was drunk.” shot wound to the head, Walker said he is still Menard Price several times, and at one Kempfer said Stewart and the autopsy showed looking at all aspects of point, there was a scuffle carried his gun with him that the weapon had the case. $21,933 over it. much of the time. He been placed in his “But we have no evi- Kempfer said Hyte was said Stewart took a lie mouth, with the slug dence to support a mur- Stk. #35793 the most sober person in detector test about the going up and out the der charge,” said the apartment. incidents that night and back of the head. Walker. 15 Dodge Journey Perry board...From Page 1______MSRP $29,790 Menard Disc. $4,299 lighting what the board violated the OMA, accord- rary supervisor to take saying in the transcript. could have done. He said ing to the attorney gen- over. The transcript also Menard Price that other boards do that, eral. Otten, accompanied by a shows that, at one point, but he wishes to be trans- The transcript outlines sheriff’s deputy, informed one of the unnamed $25,491 parent. the discussion of how to go workers of that decision elected officials who was “If that had happened, about idling the workers when they showed up at in the room threatened Stk. #35655 there never would have and how to handle letting the county highway office that if they had to go over been a violation called,” them know. last November 6. to the highway office, he Robb said. “There would As has been reported by He was afraid that work- would take a swing at the have been no recording, the County Journal and ers might retaliate against workers. 15 Dodge and it would’ve been hush- other media outlets, Otten him with violence. Kelley had suggested Charger hush.” informed the workers that However, board Chair- that Otten wear a body The transcript shows they would not be work- man Bobby Kelley had ad- camera when he informed MSRP $33,480 that while the board did ing during the time that vised Otten against be- the workers of the idling Rebate $2,500 not make any decision, he would be on vacation in ing accompanied by a to protect himself from Menard Disc. $1,057 board members did help November due to a conflict deputy. any allegations tthe work- Menard Price make the plans with Otten within the workers that “I think that’ll just stir it ers might make against to idle the workers, which left Otten with no tempo- up,” Kelley is quoted as him. $29,923 GOP Senate race...From Page 1______Stk. #35627 him an AQ rating, of the 68 counties that Luechtefeld called said. “I ask you to trust which is the highest Schimpf won, despite him when he decided to me one more time as they can give a candi- losing the election to in- retire. state senator.” 15 Dodge Dart date, according to cumbent Lisa Madigan. “There is nothing I am Schimpf and his wife Schimpf. “We made the race more proud of than hav- have two sons. MSRP $23,025 Schimpf also worked close enough that ing Luechtefeld’s en- “I will work my hard- Rebate $2,500 the trial of Suddam Planned Parenthood felt dorsement,” Schimpf est. I will tell the truth. Menard Disc. $597 Hussein in Baghdad as they had to spend said. I will make you proud, an infantry officer. $50,000 on behalf of Schimpf said what and I will go on values, Menard Price “I came back to Illinois Lisa Madigan,” Schimpf makes him different is including limited gov- because it is our home,” said. “I’m pro-life, and I that people have already ernment, pro-Second $19,928 been trusting him for 24 Amendment, pro-life, Schimpf said. “It’s the feel like being attacked Stk. #35826 state we love and we by Planned Parenthood years, including his pro-coal and pro-fam- want our children to is a badge of honor.” years as an infantry of- ily,” Schimpf said. grow up in, as well.” Schimpf said there ficer and getting a good “When I took off my uni- In 2014, Schimpf rep- were two reasons he education in the U.S. form for the last time, 15 Dodge resented the Republican wants to run for this Naval Academy. that didn’t change who Durango party as a candidate for seat. One is so he could “You trusted me for 24 I am, which is to serve MSRP $37,780 Illinois attorney gen- see what is happening in years, and I’ve upheld your country, your state eral. Randolph was one Springfield. The other is that trust,” Schimpf and your community. “ Rebate $1,250 Menard Disc. $2,540 Menard Price Meacham... From Page 4______$33,990 featured a picture of Imagine a company of- Paladin man. boxes. Stk. #35461 Jingles on his horse, de- fering that to kids today. In 1955, the Quaker I had one of those scribed the contents as a Dad’s favorite cereal was Oats company gave away deeds—if only I could find rip-snortin’ cereal, a Puffed Wheat made by land in the Klondike as it now. rootin’-tootin’ snack that’s Quaker Oats. Puffed part of the Klondike Big By the way, did you re- 15 Jeep shot with sugar through Wheat sponsored “Ser- Inch Land Promotion tied alize that if you ate Trix Grand Cherokee and through and had a ste- geant Preston of the in with the television as a kid, you were obnox- MSRP $34,990 reo picture of the West on Yukon,” which was tele- show. Genuine deeds to ious, but if you ate Raisin Rebate $2,000 the back. cast on CBS from Septem- one square inch of a lot in Bran, you were mature? Another Sugar Pops pro- ber 29, 1955 to September Yukon Territory, issued by Check out Happy Na- Menard Disc. $1,998 motion was Special Offer! 25, 1958, but I don’t think Klondike Big Inch Land tional Cereal Day! Here’s Menard Price Authentic Colt Six- Sgt. Preston was one of Co. Inc., were inserted into What Your Favorite Child- Shooter! See Package Dad’s heroes. Dad was Quaker’s Puffed Wheat hood Cereal Choice Says $30,992 Back! more a Matt Dillon and and Puffed Rice cereal About You on eonline.com. Stk. #35823 Peebles... From Page 1______www.menardautosales.com thing), the right pair of The morning of the men’s and women’s re- The show was a great sandals came into view. show, it was time for a strooms to dress) were full success. All models looked They actually had small shower, shampoo and leg of excited chatter, half- beautiful in their pretty rhinestones that matched shaving. Modeling capris dressed women, clothes spring duds, and nobody the denim jacket. with legs like a werewolf hangers, accessories and fell on the runway. straight pins. Since 1958 • At The “Y” In Ruma • 618-282-2386 Feeling so good about would not go over well. The best part was the 40 3 154 Baldwin Coulterville It was too late to lose 20 Some women were pin- percent off coupon we got Red Bud my upcoming modeling Sparta MenardMenardMenard 154 gig, I pondered having my pounds or rise to the ning up their hemlines, from the store to return AutoAutoAuto 154 Evansville height of 5’9, so being others doing a nip and next Saturday so we could 4 ear pierced and getting a 3 tuck here and there. In all purchase the outfits we Ellis red velvet latte at Gloria clean and fresh would Grove Steeleville Jeans to celebrate. The have to do. the excitement, one modeled or anything else 150 WILLWILLWILL JANETJANETJANET RODNEY 3 N piercing could wait an- There were 14 women woman up-dumped her in the store. Chester modeling, and the bath- entire box of pins, not Maybe this modeling SIMPSON KUEKER MENARD other week or two, but the To Qualified Buyers With Approved Credit. Prices Exclude Tax, Title, License And Doc. Fees. See Dealer For Details. coffee could not. rooms (we used both the once, but twice. thing isn’t so bad after all. Page 6 County Journal March 10, 2016 No ordinance violation for Steely Sparta police officer and Vine streets blocked to ease halfway onto 4th violating the Sparta zon- Marissa sells Eric Steely, who was drivers’ view to 4th to see if any traffic was ing ordinance with his given a city ordinance Street. coming from the left bushes. violation ticket last Octo- O’Rear said he first ap- (westbound 4th) before “Mr. Steely said he did three properties ber, was found not guilty proached Steely about they could turn. calculations, and he com- in a brief bench trial in the bushes in May of O’Rear testified that plied with the ordi- By Mike Trotter those two properties Chester March 3. 2015 after he had com- one ordinance states that nance,” said Gross. “The The Marissa Village and the village hall The case was pros- plaints about the visual no vegetation is to be lo- city didn’t make any mea- Council has sold some and will make bids for ecuted by attorney Lucas obstruction at the inter- cated within a 15-foot tri- surements.” property owned by the potential renovations. Liefer of Red Bud rather section. angle on corner lots, but Gross told Steely, how- village. The council will open than city attorney Alan He said he talked to he said he did not mea- ever, that it might be a Three bids from Jack the bids and discuss Farris because Steely is Steely, who said he did sure the distance at good idea to take out Hulslander were options at the next a city employee, which not think there was an Steely’s location. some of the plants. opened at Monday council meeting. could have been a con- obstruction. Steely testified that he All of the plants were night’s council meet- Bingel discussed a flict for Farris. O’Rear said Steely told did measure the triangle, recently cut back to low ing. He offered $2,120 problem with a large The original ticket was him he would remove and the bushes meet the levels. for the 178 State Route section of Powers written solely based on two of the plants that fall, ordinance. He did cut This is the second high- 13 property, $820 for Drive that is sinking an obstruction issue. but he did not do that. down the far west bush profile zoning case in 104 South Hamilton and seems to be get- However, two other tick- O’Rear said he talked to closest to the intersec- which Gross has ruled Street and $820 for ting worse. The vil- ets were added based on Steely again in October, tion before the October against the city. The 210 East Mill Street. lage will explore its ordinances that state and Steely said he had ticket was issued. other was the chicken The council approved options for repairing there is to be no vegeta- changed his mind and “I feel that I complied case against Tim Page. the first sale by a vote the street. tion growing within a would not remove the with the ordinance when This is also the second of 5-0 and the second Councilman Patrick 15-foot triangle on the plants because he felt I cut back one bush,” said time Steely has been and third by votes of Miesner discussed an corner of any intersec- they did not create a vi- Steely when he testified. invoved in litigation. 3-2, with councilmen ongoing problem tion. sual obstruction. Under cross examina- He and another part- Paul Sinn and Bryan with speeding drivers Sparta code officer Bob Liefer called two other tion, Steely said he did time deputy filed a law- Bingel voting no both on South Euclid O’Rear issued Steely’s witnesses, Debbie and not agree with the Picker- suit against the county times. Street. Additional ticket because he had Lyndel Pickering. Both ings that it was difficult when they were dis- In other action, the stop signs may be complaints that grassy said that when traveling to see at the intersection. missed by Sheriff Mike council passed a mo- considered for some bushes on Steely’s prop- on Vine, before turning Judge Gene Gross said Hoelscher. That case was tion to lease a Case ex- of the intersections. erty (520 S. Vine) at 4th onto 4th Street, they had Steely was not guilty of settled out of court. cavator from Luby A building permit Equipment Services at for a pole barn has a cost of $2,250 a been approved for month for four Jerry and Mary Ori- months. naud at 9991 Risdon The council voted to School Road. hire Custom Remodel- A motion passed to ing to repair the vil- issue a business per- lage hall roof. Two mit to George Barton bids were received for for a secondhand the project. Custom store at 9 East Maris- Remodeling had the sa Street. lower of the two at Permission was $5,950. granted to the Maris- Mayor Moe Cross re- sa Girl Scouts to sell ported that the village Krispy Kreme donuts has closed on the at the four-way stop Ozzie’s Garage prop- March 26. erty and should close A liquor license was soon on the former issued to the Marissa Regions Bank build- Athletic Association ing. He also reported for its softball tourna- that 10 different con- ment September 23- tractors have looked at 25.
Markers • Monuments Mausoleums Nashville Memorial Co. Lincoln Day dinner The Randolph County Republicans held their Lincoln Day dinner March 5 at the Steeleville American (618) 443-5807 Legion. Local candidates running in the upcoming election spoke to the attendees. Outgoing 58th John & Madeline Bergfeld Or (618) 443-2988 District Senator Dave Luechtefeld, pictured, received two standing ovations, one before he spoke and one after. Luechtefeld will retire at the end of his current term, ending a tenure that began in 106 Fox Run • Sparta • Next To Hardee’s 1995. March into MEIER March into Mon - Fri Randy Reuter Ryan Spenner CHEVROLET BUICK 8am - 6pm; Tony Bennett Randy Wright M Nashville Nashville 477 E. St. Louis St. • Nashville, IL • 327-AUTO Sat 8am - 4pm Pinckneyville Centralia adness 2016 CHEVY MALIBU LT ess Convenience & Technology pkg M a n ALL d MSRP $27,185 NEW Everyone Qualifies $24,999 $335 ConQuest______$1,000 /3.9% SALE $23,999 72mo 2016 CHEVY 2016 CHEVY SILVERADO 1500 2016 CHEVY TRAVERSE LS 2016 CHEVY EQUINOX LS $309 P. seat COLORADO CREW $ LT CREW CAB 4X4, LT PLUS /3.9% 309 MyLink, bluetooth, 72mo MSRP $32,650 MyLink, PW, PK, Cruise, 84mo/4.9% All Star pkg, 5.3L rear camera, Alum whls Everyone Qualifies $28,999 keyless entry ConQuest $1,000 MSRP $47,280 MSRP $26,105 ______MSRP $28,380 Everyone Qualifies $37,999 Everyone Qualifies $23,499 SALE $27,999 Everyone Qualifies $25,999 ConQuest______$1,000 ConQuest $1,000 ConQuest______$1,000 ______SALE $36,999 SALE $22,499 SALE $24,999 2015 CHEVY 2015 CHEVY SILVERADO 2016 CHEVY SILVERADO TRAX LT $259 SPARK LS $ 2016 CHEVY /3.9% 179 2500 LT CREW CAB 4X4 2500 LT CREW CAB 4X4 Our last one at this price! 72mo Automatic, Mylink, bluetooth 72mo/3.9% “Custom Sport” LT Convenienceenience Pkg 2020”chrome chrome MSRP $23,320 rear camera, Apple carplay Diesel, 18”whls, LT Conveniencence pkgpkg MSRP $51,670 Everyone Qualifies $19,999 MSRP $14,635 39 mpg MSRP $58,345 ConQuest______$1,000 Everyone Qualifies $50,999 Everyone Qualifies $44,999 Everyone Qualifies $13,999 ConQuest $1,000 SALE $18,999 ConQuest______$1,000 ConQuest______$1,000 ______SALE $12,999 SALE $49,499 SALE $43,999
2016 CHEVY 2016 CHEVY IMPALA LTZ 2016 CHEVY 2016 CHEVY $ SONIC LS $199 CRUZE LT $249 Sunroof, advanced technology MALIBU LIMITED 275 /3.9% /3.9% 72mo/3.9% Automatic, bluetooth, 72mo Technology pkg 72mo 20” whls, navigation Power convenience pkg keyless entry, P locks Driver convenience pkg MSRP $40,5055 MSRP $26,085 MSRP $16,470 MSRP $22,300 Everyone Qualifies $35,9999 ConQuest $1,0000 Everyone Qualifies $20,999 Everyone Qualifies $15,599 Everyone Qualifies $18,999 ______ConQuest______$1,000 ConQuest______$1,000 ConQuest______$1,000 SALE $34,9999 SALE $19,999 SALE $14,599 SALE $17,999
See us at See us at www. MEIERCHEVROLETBUICK.COM www. MEIERCHEVROLETBUICK.COM
2016 BUICK VERANO 2016 BUICK ENCORE 2016 BUICK ENCLAVE 2016 BUICK REGAL
MSRP $24,800 MSRP $25,385 MSRP $40,385 MSRP $32,885 $199 mo $199 mo $331 mo $259 mo 39 mo Lease1 39 mo Lease1 39 mo Lease1 39 mo Lease1 $859 Cash Down $319 Cash Down $331 Cash Down $1,459 Cash Down A Powertrain Warranty offered on OUR NEW AND PRE-OWNED inventory, valid FOR THE LIFE OF YOUR CAR!
ASKSK US ABOUT OUR
VEHICLE SALE PMT MO RATE VEHICLE SALE PMT MO RATEE 2013 Buick Encore Leather, chrome $20,973 $299 72 3.9% 2012 Chevy Silverado LT Ext Cab 18k mi $25,973 $375 72 4.5% 2015 Buick Lacrosse Leather pkg $26,973 $379 72 3.9% 2014 Chevy Silverado LT Z71 Double Cab $29,473 $379 84 5.5% 2012 Buick Lacrosse Premium III $19,973 $289 72 4.5% 2010 BUICK 2014 CHEVY 2013 FORD 2015 Chevy Silverado LT 4x4 Double Cab $30,973 $399 84 5.5% 2015 Buick Regal Premium $22,973 $325 72 3.9% ENCLAVE CXL CRUZE 2LT RS ESCAPE SE 2012 Chevy Silverado LTZ Crew Cab 4x4 $31,973 $459 72 4.5% 2015 Buick Verano Convenience $19,473 $279 72 3.9% DVD, Bose, Heated Leather Sunroof, heated leather 39k miles, 2.0L Ecoboost 2014 Chevy Silverado 3500 LTZ diesel $50,973 ------2015 Chevy Captiva Sport LT $19,473 $279 72 3.9% $13,973 $14,97373 $16,973 2015 Chevy Sonic 5 LT $13,973 $199 72 3.9% 2015 Chevy Cruze LT $15,973 $229 72 3.9% 2015 Chevy Suburban LT 4x4 $48,973 ------2015 Chevy Equinox LT sunroof $23,973 $339 72 3.9% $229mo $209mo $245mo 63mo/ 4.9% 72mo /3.9% 72mo/4.9% 2015 Chevy Traverse 2LT Leather $14,973 $329 63 4.5% 2011 Chevy Equinox 2LT $15,973 $229 72 4.5% 2014 Chevy Volt $21,973 $309 72 3.9% 2015 Chevy Impala LT $23,973 $339 72 3.9% 2014 Dodge Durango AWD Limited $34,973 ------2010 Chevy Impala LT $8,973 $149 63 4.5% 2012 CHRYSLER 2014 CHEVY 2013 CHEVY 2011 Ford F150 FX4 Crew $27,973 $399 72 4.5% 2015 Chevy Malibu LT $19,973 $285 72 3.9% 300C CRUZE LT MALIBU LT 2012 Chevy Malibu 2 LT $13,973 $229 63 4.5% Chrome whls, sunroof, H&C leather All power, bluetooth 7k miles, one owner 2005 Hyundai Santa Fe $2,973 ------2002 Chevy S10 $2,973 ------$20,973 $13,97373 $16,973 2007 Pontiac G5 $4,973 $109 48 4.9% 2014 Chevy Silverado Reg Cab $21,473 $299 72 3.9% $299mo $195mo $239mo 2007 Pontiac G6 $5,973 $129 48 4.9% 2007 Chevy Silverado Reg Cab $9,973 $209 48 4.5% 72mo/ 4.9% 72mo /3.9% 72mo/3.9% 1999 Saturn S-Series Coupe $1,973 ------* All payments with 10% down of MSRP or on used cars sale price, plus tax, title & lic w/ approved credit. Lease1 payments are plus tax, title & licand customer must have a Conquest vehicle of 1999 or newer. All conquest rebates customers must have a 1999 or newer non GM, but does not have to trade it in. Dealer will not honor pricing errors in this ad. March 10, 2016 County Journal Page 7
Bryant speaks to Trico students Illinois Representative Terri Bryant was at Trico High School March 4. She spoke to freshman science students about a hydraulic fracturing project she helped the class with, then to the government class about politics and the process bills have to go through to become law. She pointed out that last year, as a freshman representative, she was able to get four bills signed into law while getting zero no votes. Bryant walked through a couple of examples of some experiences she had, keeping bills moving until they became law. “There’s a perception that nothing gets done in Springfield,” Bryant said. “That’s just not the case. There is constant work going on down on the floor.” Chester continues battling Fifth-place dog Glenn Sharrock of Campbell Hill is shown with Sharrock’s Bent Creek Annie, one of three dogs Sharrock took to the March 5 Deep South state over utility bills Beagle Gundog Federation National Championship AKC Licensed Trial in Pontotoc, Mississippi. Annie placed fifth NBQ out of 55 gundog By Dan Zobel cess to any equipment due in April. clubs and earned Sharrock a trophy, ribbon, tally-ho walking stick The ongoing saga con- and have to use their own James Brockmeyer and dog food. tinues between the state throw-down bases when will graduate from the and the city of Chester. they do. police academy April 1. Mayor Tom Page told An ordinance was the council at its March passed to increase the 7 meeting that the city utility reconnection recently received a let- charge from $10 to $25. ter from Governor Bruce The council agreed the Rauner, one that went purchase of half of the out to mayors and vil- summer’s natural gas, lage presidents in the from April to September, state, attempting to to lock in the current Elect sway those local repre- rates while they are still sentatives to see things at historical lows. his way in terms of the J&S Services was ap- budget. proved to again provide As the state budget re- mowing services at Cole mains unresolved, the Park and the Cohen Com- RANDY dollar amount in utility plex. bills owed by state facili- J&S will receive a 1 per- ties in Chester to the city cent raise from last year. has risen to $1,041,485. The company will re- In response, Page said ceive $389 per mow at he and Clerk Bethany Cole and $566 per mow BERTETTO Berner prepared and at Cohen. sent a letter to Randy Egyptian Asphalt and Pollard, Rauner’s south- Sealcoating will repave ern Illinois representa- the fire department lot tive, requesting the for $927. Fire Chief Democrat Candidate For money be paid. Marty Bert said it is “We’ve continued to done every year. The communicate our non- work will be done in Randolph County payment issues with the June or July so it is in state,” Page said. “I think next year’s budget. we’ve done a really good The Carson & Barnes job in that regard.” Circus will be back in Commissioner In other news, the coun- Chester July 10 with cil tabled any action on a shows at 2 and 5 p.m. at recommendation from the Cohen Complex. It ★ the park board to plant will be the same setup Member Of IBEW Local 51 For 41 Years grass seed on the ball dia- as two years ago. mond at Cole Park. Carter said the circus ★ “We want to preserve requires $295 in good Employee Of Baldwin Power Station the nature aspect of the faith money at this time. park but find a way to The town will receive 20 ★ 50-Year Sparta Resident make the park more us- percent of advanced able and accessible,” ticket sales and 10 per- said recreation director cent of sales on the day ★ Experienced & Dedicated Patti Carter. “We know of the shows. something eventually Carter’s activities and has to happen with the events schedule for 2016 pool, but we want to look was also approved. to make this kind of an The fire department event area.” will hold a mock two-car Carter said with accident scene April 1 bleachers and seating outside the high school. already in place, it could Police Chief Ryan be used for events like Coffey said there will be Tuesday, March 15, 2016 traveling or petting zoos a progress meeting and concerts. April 6 at 6:30 for the When asked why the strategic plan, which is Ad Paid For By Candidate. grass was necessary, Carter said it would take away the potential of a giant mud pit when it rains. “My understanding is NOW IS THE TIME TO GET YOUR MOWER READY the park board’s intent is to give Cole Park a purpose,” Page said. The 2016 Season Is Just Weeks Away! “It’s a beautiful park.” - WE SERVICE ALL BRANDS - It was pointed out that the ball diamond is the only good flat ground at the park. Carter suggested that LIFT WITH YOUR FINGER FINGER,, NOT YOUR BACK the Popeye Picnic could also move there some- time down the road. ® The cost to plant the Exclusive PowerFold option lifts seed will be $75 to $100, according to Carter. decks with the flip of a switch. While the council seemed generally inter- U Effortlessly raises FrontMount™ ested in the idea, the ® matter of when to plant DuraMax decks the seed was brought up. U Access to underside of deck Carter and Page said it was their understanding for easy maintenance it could happen right away, but Alderman U Shortens length to simplify Robert Platt pointed out that if it is done it the storage and trailering summer, it could burn out, depending on the weather. VisitVisit yyourour ddealerealer ttodayoday forfor a demonstration!demomonsnstrtraatation! “If it doesn’t work now, we could do it in the fall,” Carter said. COLEMAN LAWN EQUIPMENT The field is used only 5511Coleman STATE RT 150 Lawn 210 E WALNUT Equipment ST by teams that need it STEELEVILLE, IL 62288 CARBONDALE, IL 62901 when the Cohen Com- 618-965-39035511 State Rte. 150 618-529-0181 210 E. Walnut plex fields are full, Steeleville, IL 62288 Carbondale, IL 62901 which is rare, and by the Chester Stingers foot- 618-965-3903 618-529-0181 ball team for practices during the season. Carter also said teams GRASSHOPPERMOWER.COM that use it do not have ac- Page 8 County Journal March 10, 2016 Ava takes first step to condemn two homes The Ava City Council proved between the city all contractors perform- took the first step toward and Kinkaid-Reed’s ing work for the city that condemning two houses, Creek Conservancy Dis- they must pay the pre- both of which are located trict to allow radio equip- vailing wage. along heavily traveled ment to be placed on The council was also in- Route 4. Kinkaid’s water town formed that the fire de- One is owned by atop the Campbell Hill partment does not want Rodney Benson and is grade. the old police car the city located at 207 W. Knauer Ava Police Chief Curt gave it a few months ago. Street. The other is Ehlers said police, fire The village of Elkville is owned by Dennis Benson and ambulance units of- interested in it, and the and is located at 202 E. ten have radio issues fire department will sell Knauer Street. when trying to talk to it to Elkville for $500. Alderman Dustin Jackson County emer- The council extended Benscoter noted that gency dispatchers, and the tax charged to resi- both structures are in a placing signal-boosting dents who use natural state of major disrepair, equipment on the tower gas. The tax will remain to the extent that holes in would solve that prob- at 5 percent. one of the roofs can be lem. No action was taken on seen. Kinkaid is only allow- amending an ordinance The council agreed to ing use of the water to allow chickens in refer the matter to the tower, and the cost of the town. That will be revis- city’s attorney to begin equipment, installation ited next month. court proceedings to get and electricity used to The council also plans Head Start visits bank the properties repaired run it will be the respon- to meet with the director Percy Head Start classes recently visited the First National Bank of or torn down. sibility of those who use of the Jackson County Steeleville and explored its daily operations. Shown are from left are Neil Benscoter also recom- it. Ambulance Service at Knuston, Rebecca Neumann, Gabriella Laffoon, bank employee Paula mended that the council Trico teacher Cheryl the council’s April 4 Luthy, Elizabeth Vickery, Riley Aaron, Myia Lambert, Andrew Lambert, approve a mobile home Robertson was granted meeting. Shaylin McBride, employee Marilyn Wente, Joseph Kraft, Felicity Illig, permit requested by permission to place a Concerns were ex- Karinna Schnoeker, Hayley Predny, Serenity Bloomfield-Rodriguez and Allen Hoyt. Hoyt wants 22x28-foot kiosk outside pressed last month about Baylee Holder. to move the mobile city hall for use as a free an ambulance some- home, which is located library. Her program times not being at the off Little Kinkaid Road, Take A Book, Leave A Ava station when into town. Book is designed to al- needed. Sorority RE-ELECT The mobile home was low anyone to borrow a It was hoped the get-to- built in the 1980s but has book and bring it or an- gether with ambulance flower undergone major renova- other book back to the service representatives David M. tions, according to kiosk when the reader is could have been held at Benscoter, including in- finished with it. Monday night’s city sale to stallation of new wiring, Robertson said several council meeting, but that plumbing and skirting. people have already could not be worked out. “It’s in pristine condi- agreed to donate books. Mayor Shaun Reiman be held HOLDERHOLDERHOLDER tion,” Benscoter said. The initial supply will be said the April council The council followed aimed at children but meeting might be moved Benscoter’s recommen- will be expanded to older to the community build- in Sparta For Randolph County Commissioner dation and approved the readers after the pro- ing in Bower Park to ac- permit. gram gets off the ground. commodate more people Delta Theta Tau Soror- ity in Sparta is holding • Proven In other action, a li- A letter was reviewed interested in the ambu- Leadership cense agreement was ap- and approved, advising lance issue. a flower sale, the money to be used for philan- thropic projects in the • Financially community. Delta Theta Tau is a na- Responsible tional women’s organi- zation dedicated to the • Certified Public advancement of philan- Accountant thropy and the helping of others. It is a nonsec- tarian, nonacademic or- ganization promoting Served The People Of welfare for all and foster- ing the spirit of good fel- Randolph County lowship. Anyone interested in For Over 25 Years ordering should call Paid for by friends of Special Olympics donation 223-9341. Orders will be David M. Holder Representatives of Pinckneyville’s Church Women United recently taken until March 27. contributed $50 to Special Olympics for the competition coming up in May. From left are Shirley Bigham, Cathy Dawson, Mary Lou Portell, special Olympians Brandon Ferrari, Cheyenne Yocum and Michael Ellison, high school special education teacher Will Weatherford and Mary Etta Rabe. Greeting Card WEIRWEIR CLEARANCE WEIR Big on Sales...Bigger onn ServiceService The remodel at Tony’s MediCenter is about to begin and we must liquidate Wheel our entire greeting card inventory. Alignment $ 95 Special 79 Your IllinoisIlli i StateSt t IInspectionti n DDealerealer Meet our Service Team!
%LOO:LFNOHLQ Service Manager Evansville, IL
5RQ5LFKHVRQ Service Advisor Waterloo, IL
*WE SERVICE 6WHYH6SHUGXWR 50% OFF ALL MAKES Service Technician & Alignment & MODELS Specialist Waterloo, IL All Greeting Cards Over 500 Greeting Cards In-Stock -HII0HKULQJ Master Certified Technician Red Bud, IL
-DVRQ'HOO 9LVLW2XU1HZ/RFDWLRQDW Service Technician & Alignment 60DLQRED BUD Specialist 282-2375 Columbia, IL 324 West Broadway Steeleville • (618) 965-3511 +28560)DPWRSP 6$7DPWRQRRQ Mon.-Fri. 8am-6pm • Sat. 8am-2pm • Closed Sun. WWW.WEIRFORD.COM www.mymedicenterpharmacy.com March 10, 2016
E. Grove urges cleanup Ellis Grove is taking steps to clean up the town. At Monday night’s meeting, the town board discussed the problem and agreed to send let- ters to all residents ex- plaining several ordi- nance violations. Residents will be en- couraged to clean up their properties, or fines might be levied for viola- tions. The board also revised the water payment ordi- nance, changing the date payment is due. Customers will get a little more time to pay, as bills will be due by the 15th of the month in- stead of the 10th. The Ellis Grove Easter egg hunt will be March 26 on the town hall grounds starting at noon for children 10 and Eagle Fest success younger. A sunny, breezy day like Saturday was almost perfect weather for children’s activities and presentations on the physics of flight The next neighborhood the Eagle Fest, which drew a large crowd to the lock and dam and the World Bird Sanctuary, which included bald eagles watch meeting is March near Modoc. Activities included eagle spotting, flint knapping, like McGuire, the one shown above with his handler. 14 at 6 p.m. Steeleville purchases more property for parking lot Steeleville has pur- said the Dethrows ap- to construct the new Steeleville’s wells at a Recreation Committee cepted by the board. The chased more property in proached the town to parking lot. Empire cost of $42,000 a year. for this year’s Pony town will eventually tear connection with the new buy the lots. Earth and Concrete of Sutton said one well is League baseball and down that building. parking lot that will be One lot contains a Steeleville had the low- operating at half capac- softball programs. Project coordinator Lyn built just north of the building that the board est of three bids. The ity and needs to be reha- Jan Wolters resigned Thies reported that he is municipal building. plans to keep for town cost will be $268,000 bilitated soon. as a member of the zon- working on prices to At Monday night’s storage needs. plus $5.30 a cubic yard The price is guaran- ing board and was re- make repairs at Paradise town board meeting, a Sutton said the added if more soil must be re- teed for four years then placed by Nick Arm- Cemetery where an auto resolution was approved land will allow the park- moved. can be increased as strong. accident caused damage to buy three lots from ing lot to have a more The board also ap- much as 5 percent, while The board sold some to a tombstone and the Delbert and Barbara gentle slope, as it is ex- proved a water well the contract runs for a items from the former stone tablets at the en- Dethrow. The purchase tended farther north. maintenance agreement minimum of 10 years. Bockhorn building, trance. price is $35,000. “It will be easier for with Utility Service In other action, the which the town now He said fire hydrants The lots are on the hill maintenance and will Company of Atlanta. board approved a $300 owns. Jeremy Lohman will be flushed March 14- adjacent to land the town keep us away from The company already donation to the Steele- of Steeleville bid $3,107 16, and Illinois Depart- bought from the Eagles building some retain- maintains the town’s ville Chamber of Com- for the paint booth and ment of Corrections boot Club for the planned ing walls,” said Sutton. water towers. merce for its March 14 $250 for two overhead camp inmates will be do- parking lot. In a related matter, the Now Utility will also dinner meeting and doors that he must re- ing community projects Mayor Bob Sutton board approved the bid maintain all seven of $500 to the Steeleville move. Both were ac- in town March 16-18.
2015 Ford Taurus 2015 Ford Edge 2016 Ford Fusion PRE-OWNED MSRP $32,080,Stk. #67525 Stk. #86539 *Retail Customer Cash $4,350 Stk. #95355 Retail Customer Cash $2,000 SPECIALS Bening Discount $1,957 Bening Ford Discount $1,097 Ford Credit Retail Customer Cash $400 2013 Ford Focus
33K Miles Special $25,373 SPECIAL 0% Stk. #37700 $13,327 SPECIAL $19,888 2014 Nissan Rogue NEW VEHICLES *Financing Terms Offered Thru Ford Motor Credit For Qualified Buyers. PMTS based on 72 months financing at 4.99% with 15% cash down or trade. Tax, title & license not included in pmts.
Stk. #50890 One Owner 2012 Ford F350 2013 Ford 2013 Ford 2013 Ford 2014 Ford Escape SEL 36K Miles F150 F-150 Limited F150 FX4 Stk. #86092 Lariat Diesel 4x4 2012 Chevy Traverse
STX, 4X4 30K Miles 21K Miles AWD 29K Miles Stk. #58542 $21,950 Stk. #25404 Stk. #B98229 Stk#30418 Stk. #20957 2014 Ford Fusion WE FINANCE YOUR FUTURE, NOT YOUR PAST! Bankruptcy - Bad Checks - Divorce - Late Payment Laid-Off - Collections - Slow Payment - Medical Bills Stk. #23050 $12,905 EZ Online Credit Application At beningford.com Just Click And Send It In! Walmart 2015 Ford F150 55 Ponderosa Buchheit’s 573-547-8377 BENING FORD 800-649-8377 Old Ste. Maries 9K Miles To Illinois www.beningford.com 51 Stk. #52552 FX4, Lariat Page 10 County Journal March 10, 2016
Sparta downtown group will meet this month
The Downtown Pro- vided at MiCasa. The group plans to gress Group in Sparta At this meeting, the help the Neighborhood will hold an informa- group is seeking ideas, Center Thrift Store tional meeting Monday, input and potential con- freshen up its exterior March 21 at MiCasa Sub tributors, volunteers Saturday, April 9 by Shop at 7 p.m. and developers. cleaning the windows This meeting is in The group, designed to and awning and paint- place of the group’s revitalize Sparta’s down- ing the facade. usual 6 p.m. meeting at town business district, Anyone with questions city hall. will start by focusing on regarding these events Complimentary food Jackson, James, College should call Sharon and drink will be pro- and Washington streets. Blackwell at 443-8297. Nonviolent crisis
Whisper Vapes ribbon cutting Chester hospital staff trains The Chester Chamber of Commerce held a ribbon-cutting ceremony March 4 at Whisper Vapes Lounge and Gaming. From left are Nancy Crossland, in crisis intervention program Patti Carter, Mayor Tom Page, owners Virgil and Tonya Smith, Gwendy Garner, Linda Sympson and Steven Sympson. The Smiths were presented The staff at Memorial with a 2016 chamber membership plaque. The business, located at 2449 State Hospital in Chester re- Street, features eliquid, video machines, snacks, soft drinks and beer. Hours cently participated in are 11 a.m. to 7 p.m. Monday through Friday, 11 to 8 Saturday and 11 to 3 the Nonviolent Crisis In- Sunday. Adam Blake is the manager. For more information, call 201-4174. tervention training pro- gram. The training allows for staff from every job function to recognize es- calating behaviors that P’ville might arise in the hos- pital setting. It also teaches methods diabetes to defuse or address be- havior that could esca- late into a disruptive or program violent incident, to pro- Shown from left are RN Brandy Hagene, CNO vide a safe environment Susan Diddlebock, RN Deana Tudor, RN Adrienne Pinckneyville Commu- for patients and their Caby, RN Kristi Williams, RN Barb Lenard and nity Hospital will begin family members. RN Jeannette Decker. a diabetes self-manage- The program clarifies ment program Thursday, basic elements of violent vention by staff. class has been com- March 31. behavior then identifies The goal for 2016 is to pleted by nursing staff, The six-week program how a crisis could esca- provide this training to members from manage- meets Thursdays from 1 late and de-escalate the entire staff at Memo- ment, emergency de- p.m. to 3:30 p.m. How- through timely inter- rial Hospital. So far, the partment and surgery. ever, the schedule is sub- ject to change. Two registered nurses Locally Owned will conduct the sessions, Bank Janet Morrison of the Dependable Pinckneyville hospital raises Service QUIVEY and Sandy Timpner, St. Paul UCC parish nurse. Timely Pick-up Sanitation, Inc. Participants will learn funds appropriate exercise for 128C W. Main • Sparta improving and maintain- for CF Residential And ing strength and endur- The First State Bank of Commercial ance, how to eat healthy, Campbell Hill and its and appropriate use of New therapist branch locations held a medication. Trisha Foutch has joined the staff of Coulterville fundraising campaign TRASH Class size is limited. Rehab and Health Care Center as a massage for cystic fibrosis in Feb- Call Morrison at 357- therapist. Shown receiving a massage is Rita ruary. PICK-UP 5958 to reserve a spot. Stewart. Employees and cus- We Proudly Serve Jeff Quivey, Owner & Operator tomers could purchase a Sparta, Tilden, Percy, heart for $1, with all of Rockwood, Red Bud, Dumpster & Roll-Off the funds being donated Campbell Hill And SERVICE AVAILABLE to the Cystic Fibrosis Call For A Free Estimate! Foundation. Rural Steeleville A total of $250 was Local raised. Call (618) 317-6790
Servicing all makes and models of mowers, chainsaws, trimmers and blowers Blade & Chain Sharpening
Service & Sales New Ford home Weir Ford of Red Bud has moved from its old location on Route 3 north to Ruma Small Engine a new store, the former Alcoa building, on Route 3 south. The inventory was moved in January. Pictured above is general manager Larry Kinzell, 36 St. Leo’s Road • Ruma • (618) 282-6889 left, and Ford manager Brad Roy. BUSINESS DIRECTORY
ELECTRICIAN AUTO PARTS/SERVICE CLEANING KEN HALL FROEMLING DANBURY’S PROFESSIONAL CLEANING Electric, Inc. TIRE & SUPPLY “YOU’LL COME CLEAN WITH US!” Residential • Farm • Commercial 1089 Tanner Rd. EMERGENCY SERVICE AVAILABLE AVA 618-497-8849 CARPET • UPHOLSTERY (618) 443-3013 426-3661 SMOKE & WATER DAMAGE PAINTING HEATING/COOLING HEATING/COOLING WINTER SPECIAL Heartland WILLIAMS 1-2 Rooms* 5% OFF A/C & Heating, Inc. 3-4 Rooms* 10% OFF Heating & Cooling 4 Or More Rooms* 15% OFF Jason Brown *Must Be Complete Rooms 502 W. SHAWNEETOWN TRAIL (618) 826-HEAT STEELEVILLE JAN CAN PAINTING 965-2040 317-2037 Service Agreements CLOCK REPAIR PROPANE RESTORATION 30 Years PROVEN Customer Satisfaction DANIEL'S MAJESTIC Clock Repair RESTORATION Free Pick-Up & Delivery! FREE Accredited Member of BBB SERVICES Estimates Emergency Flood & Fire Restoration All Work Howard Miller & PARTA Ridgeway Warranty Center 443-4358 • S Guaranteed! Phone Toll Free 618-969-9444 Fire • Flood • Mold (573) 517-3387 1-800-477-4358 majesticrestoration.com COUNTY JOURNAL 1101 E. Pine • PO Box 369 • Percy • 618-497-8272 March 10, 2016 County Journal Page 11 Illinois Department of S’ville Natural Resources dates Easter The Illinois Depart- ment of Natural Re- sources has several key egg dates it wants people to Hunting dates, wildlife take note of. April 1 starts the 2016 hunt guides, workshops Easter is near, so year for fishing, hunt- the Steeleville Jay- ing and sportsman’s Registration is under photo images of live cees will hold its combination licenses way for hunter and boat- bobcats to be consid- Easter Egg Hunt in and stamps. They are ing safety education ered for use on the cover the city park across available from DNR Di- courses. The IDNR web- of the 2016-17 Illinois from St. Mark’s rect license and permit site has class dates and Digest of Hunting and Lutheran Church vendors, online at dnr. locations. Trapping Regulations. A Saturday, March 19 illinois.gov or by calling Registration is also photo contest is open to at 10 a.m. The rain 888-673-7648. open for the Becoming residents of Illinois. date is March 26. Licenses will be valid an Outdoors Woman The selected picture The age range is in- through March 31, 2017, workshop June 10-12 at will be placed on the fant to 10, and the unless otherwise noted. the Lorado Taft Field front cover of the digest, age groups will have Spring youth turkey Campus in Oregon, Illi- and the photographer’s staggered starting season county permits nois. name will be listed on times to allow par- are now available over- The workshops are Contest winner the inside page. The con- ents to take pictures the-counter from IDNR designed to provide in- Hope Goodman of Marissa was the Marissa test winner will be se- in multiple groups. state license/permit ven- troductory instruction library’s adult coloring contest winner. Goodman lected by IDNR wildlife There will be prizes dors. and experiences in received a book and assorted prizes for the fanci- biologists, and the win- given out for finding For more information many outdoor-related ful horse she colored. The library holds coloring ning photographer will special eggs, and about spring turkey activities and skills in contests for children and adults and monthly prize receive five copies of the each child receives a hunting, go to dnr.illinois. a fun, noncompetitive drawings for those who check out items and printed digest. goody bag and gift gov/hunting/turkey. and hands-on environ- register. Photo by Carol Mercer All photo entries must from First National The 2016 Illinois fish- ment. be submitted by March Bank of Steeleville ing information guide is The cost is $230 per 31. Send images, along while supplies last. available in pdf format person. The price in- with the photographer’s The Easter Bunny through the IDNR web- cludes the class, two- Jeanne Phillips’ name, address, phone will be in attendance site. nights’ lodging, meals, and email, and a state- for pictures. Illinois free fishing use of equipment/sup- ment that the IDNR has Easter is Sunday, work on display days for 2016 are June permission to use the plies, transportation March 27. 17-20. Artwork by Jeanne photo to dnr.digestpicture@ during the event and The IDNR is seeking Phillips of the Sparta- illinois.gov. giveaways. Marissa area is being displayed this month REPUBLICAN PRIMARY DEMOCRATIC PRIMARY through the Mississippi Valley Art Guild. SPECIMEN BALLOT SPECIMEN BALLOT Her work is at Buena Vista Bank in Chester Josh Gross, Perry County Clerk & Recorder Josh Gross, Perry County Clerk & Recorder MARCH 15, 2016 MARCH 15, 2016 and the Chester library. PERRY COUNTY, ILLINOIS PERRY COUNTY, ILLINOIS
Phillips’ work involves FEDERAL CONGRESSIONAL FEDERAL CONGRESSIONAL stained glass, including FOR PRESIDENT OF THE UNITED STATES FOR DELEGATE TO THE FOR PRESIDENT OF THE UNITED STATES FOR DELEGATE TO THE (Vote for one) NATIONAL NOMINATING CONVENTION (Vote for one) NATIONAL NOMINATING CONVENTION TWELFTH CONGRESSIONAL DISTRICT JEB BUSH TWELFTH CONGRESSIONAL DISTRICT small angels and birds. (PLEASE NOTE: Next to the name of each candidate for delegate appears HILLARY CLINTON (PLEASE NOTE: Next to the name of each candidate for delegate appears CHRIS CHRISTIE in parentheses the candidate's preference for President of the United States in parentheses the candidate's preference for President of the United States or the word "uncommitted".) WILLIE L. WILSON Phillips learned her art or the word "uncommitted".) DONALD J. TRUMP (Vote for not more than three) MARTIN J. O'MALLEY (Vote for not more than six) from a specialist in TED CRUZ GLORIA M. CAMPOS (BUSH) ROQUE "ROCKY" DE LA FUENTE CHRISTOPHER R. BELT (CLINTON) MARCO RUBIO GEORGE W. OBERNAGEL III (BUSH) 2000. She also paints in LARRY (LAWRENCE) COHEN DINA RENE BURCH (CLINTON) RAND PAUL AMY E. SHOLAR (BUSH) Jeanne Phillips BERNIE SANDERS EDDIE LEE JACKSON (CLINTON) CARLY FIORINA NATHAN CHANEY acrylic and is a seam- (TRUMP) JENNIFER GOMRIC MINTON Write-in (CLINTON) MIKE HUCKABEE STELLA KOZANECKI (TRUMP) stress. Ol’ Farmhouse restau- FOR UNITED STATES SENATOR KEVIN LYNN STARR (CLINTON) RICK SANTORUM HERB UNDERWOOD (TRUMP) (Vote for one) LaTOYA N. GREENWOOD (CLINTON) The Art Guild meets rant in Chester. JOHN R. KASICH ADAM DOHM (CHRISTIE) ANDREA ZOPP RAY COLEMAN (O'MALLEY) BEN CARSON JENNIFER DOHM (CHRISTIE) the last Tuesday of the Call 515-344-2448 for TAMMY DUCKWORTH CYNTHIA COLEMAN (O'MALLEY) FOR UNITED STATES SENATOR RICHARD KNIGHT (CHRISTIE) NAPOLEON HARRIS MATT HAWKINS (O'MALLEY) month at 6 p.m. at the more information. (Vote for one) MARK MINOR (CRUZ) STATE KIM IRVING HAYWOOD SR. (O'MALLEY) JAMES T. MARTER SHAREE LANGENSTEIN (CRUZ) FOR COMPTROLLER HANNAH AUTEN (SANDERS) MARK STEVEN KIRK CLIFFORD E. LINDEMANN (CRUZ) (For an unexpired two year term) CODY LUEKER (SANDERS) STATE JUANITA "SUE" HAMILTON (FIORINA) (Vote for one) KYLE HICKS (SANDERS) FOR COMPTROLLER SCOTT ALBERT (FIORINA) SUSANA MENDOZA KENNETH G. SHARKEY (SANDERS) (For an unexpired two year term) ROBERT FULK (FIORINA) (Vote for one) CONGRESSIONAL REBECCA WUEST (SANDERS) Marissa sorority DUSTIN THROGMORTON (PAUL) FOR REPRESENTATIVE IN CONGRESS KAREN SANDEFUR (SANDERS) LESLIE GEISSLER MUNGER JONATHAN CROTSER (PAUL) TWELFTH CONGRESSIONAL DISTRICT LYNNE SCHWARTZHOFF (SANDERS) CONGRESSIONAL DEVIN JOHNSON (PAUL) (Vote for one) LEGISLATIVE FOR REPRESENTATIVE IN CONGRESS MICHAEL EVANS (CARSON) CHARLES "C.J." BARICEVIC FOR STATE SENATOR TWELFTH CONGRESSIONAL DISTRICT BRANDI L. JEWELL (CARSON) seeks caps and lids (Vote for one) FIFTY-EIGHTH LEGISLATIVE DISTRICT GLORIA J. PITTMAN (CARSON) (Vote for one) MICHAEL BOST TERRI BRYANT (RUBIO) By Carol Mercer naise containers, tooth- SHEILA SIMON CHRIS SLUSSER (RUBIO) REPRESENTATIVE Members of Delta paste, medicine bottles, TRAVIS AKIN (RUBIO) THOMAS K. McRAE (KASICH) FOR REPRESENTATIVE IN THE GENERAL ASSEMBLY ONE HUNDRED AND FIFTEENTH Theta Tau Sorority saw milk jugs, detergent, MICHELLE RODELY (KASICH) REPRESENTATIVE DISTRICT a need for durable hair spray and sprout ALAN DALE HASTINGS (KASICH) (Vote for one)
CONGRESSIONAL COUNTY benches throughout caps that come on mus- MARSHA GRIFFIN FOR ALTERNATE DELEGATE TO THE FOR STATE'S ATTORNEY Marissa. They discov- tard and ketchup. NATIONAL NOMINATING CONVENTION (Vote for one) FOR REPRESENTATIVE IN THE GENERAL ASSEMBLY TWELFTH CONGRESSIONAL DISTRICT ONE HUNDRED AND SIXTEENTH REPRESENTATIVE ered A Bench for Caps Medicine bottles are ac- (PLEASE NOTE: Next to the name of each candidate for alternate appears DAVID H. SEARBY JR. DISTRICT in parentheses the candidate's preference for President of the United States FOR CORONER (Vote for one) project, where bottle ceptable as long as the or the word "uncommitted".) (Vote for not more than three) (Vote for one) JERRY COSTELLO II caps and lids are trans- labels have been re- ZACHARY S. DONAHUE (BUSH) PAUL D. SEARBY formed into benches moved and if they have BRUCE RODLEY (BUSH) FOR SUPERVISOR OF ASSESSMENTS COUNTY PRECINCT COMMITTEEMAN MAGEN BRUMLEVE (BUSH) (Vote for one) FOR CIRCUIT CLERK FOR PRECINCT COMMITTEEMAN that will last a lifetime. the number 2, 4 or 5 on LORI EVERS-MILLER No Candidate (Vote for one) DUQUOIN 3 (TRUMP) (Vote for one) KIMBERLY J. KELLERMAN Each bench takes 400 the bottom. CASSANDRA CRAWFORD (TRUMP) FOR COUNTY COMMISSIONER MARY SCHMIDT (TRUMP) (Vote for one) FOR STATE'S ATTORNEY CALEN J. CAMPANELLA (Vote for one) pounds of lids, and the Collections cannot in- PATTI L. HOWARD (CRUZ) JOHN BATTEAU FOR PRECINCT COMMITTEEMAN DUQUOIN 4 CRAWFORD MOSS (CRUZ) MICHELLE R. RODELY MATT BENSON goal is to put four clude metal of any kind, (Vote for one) DANIEL I. SMITH (CRUZ) JUDICIAL FOR CORONER soap and lotion pumps, (Vote for one) benches around town. JAMES KERLEY (CHRISTIE) FOR JUDGE OF THE APPELLATE COURT AUDREY DARLENE MERSEAL FIFTH JUDICIAL DISTRICT LINDSEY CADWELL BAKER The sorority received an trigger sprayers or fast- NANCY DOHM (CHRISTIE) FOR PRECINCT COMMITTEEMAN (To fill the vacancy of the Hon. Bruce D. Stewart) DUQUOIN 5 MICHAEL DOHM (CHRISTIE) (Vote for one) FOR SUPERVISOR OF ASSESSMENTS Alberta Hamilton grant food drink lids. (Vote for one) (Vote for one) JESSICA HOLTE (FIORINA) JOHN B. BARBERIS, JR. for $800 to be used for Collection sites include DONA BARBER (FIORINA) FOR JUDGE OF THE APPELLATE COURT No Candidate JASON VANZANDT FIFTH JUDICIAL DISTRICT HAROLD THOMPSON (FIORINA) FOR COUNTY COMMISSIONER FOR PRECINCT COMMITTEEMAN four benches. Village Bank, village (To fill the vacancy of the Hon. James M. Wexstten) (Vote for one) DUQUOIN 6 DAVID A. SCHILLINGER (CARSON) (Vote for one) (Vote for one) Plastic lids or caps are hall, Food Mart, elemen- GLORIA M. SHUPE (CARSON) JAMES R. "RANDY" MOORE DALLAS BIGHAM MARCELLA D. KRAMER (CARSON) FOR JUDGE OF THE CIRCUIT COURT JUDICIAL No Candidate being collected. tary and high schools TWENTIETH JUDICIAL CIRCUIT ROBERT L. "ROBBIE" MOORE (RUBIO) FOR JUDGE OF THE APPELLATE COURT FOR PRECINCT COMMITTEEMAN (To fill the vacancy of the Hon. C. John Baricevic) FIFTH JUDICIAL DISTRICT DUQUOIN 7 Acceptable clean lids and the library. BARBARA VIVIANO (RUBIO) (Vote for one) (To fill the vacancy of the Hon. Bruce D. Stewart) (Vote for one) can come from cottage For more information MATTHEW FLANIGAN (RUBIO) No Candidate (Vote for one) LISA BROWN (PAUL) FOR JUDGE OF THE CIRCUIT COURT BRAD K. BLEYER JANICE PYLE TWENTIETH JUDICIAL CIRCUIT cheese, yogurt, ice call Evonne Albert at NEIL A. PARRISH JR. (KASICH) FOR JUDGE OF THE APPELLATE COURT FOR PRECINCT COMMITTEEMAN (To fill the vacancy of the Hon. Robert Haida) FIFTH JUDICIAL DISTRICT PATRICK T. McRAE (KASICH) (Vote for one) DUQUOIN 8 cream, butter or mayon- 317-6352. (To fill the vacancy of the Hon. James M. Wexstten) (Vote for one) HUGH R. WILLIAMS (KASICH) RONALD R. DUEBBERT (Vote for one) LEGISLATIVE PRECINCT COMMITTEEMAN JO BETH WEBER No Candidate FOR STATE SENATOR FOR PRECINCT COMMITTEEMAN FOR JUDGE OF THE CIRCUIT COURT FOR PRECINCT COMMITTEEMAN FIFTY-EIGHTH LEGISLATIVE DISTRICT BEAUCOUP TWENTIETH JUDICIAL CIRCUIT DUQUOIN 9 (Vote for one) (Vote for one) (To fill the vacancy of the Hon. C. John Baricevic) (Vote for one) (Vote for one) PAUL SCHIMPF No Candidate ROBERT B. HAIDA JOHN C. STANHOUSE Chester library SHAREE LANGENSTEIN FOR PRECINCT COMMITTEEMAN FOR JUDGE OF THE CIRCUIT COURT FOR PRECINCT COMMITTEEMAN REPRESENTATIVE CUTLER TWENTIETH JUDICIAL CIRCUIT DUQUOIN 10 (Vote for one) (To fill the vacancy of the Hon. Robert Haida) (Vote for one) FOR REPRESENTATIVE IN THE GENERAL ASSEMBLY (Vote for one) ONE HUNDRED AND FIFTEENTH REPRESENTATIVE DISTRICT No Candidate JOHN BARICEVIC No Candidate (Vote for one) program updates FOR PRECINCT COMMITTEEMAN PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN TERRI BRYANT DUQUOIN 1 FOR PRECINCT COMMITTEEMAN DUQUOIN 11 (Vote for one) (Vote for one) FOR REPRESENTATIVE IN THE GENERAL ASSEMBLY BEAUCOUP (Vote for one) The Confederate Mon- boiled eggs. Dye and ONE HUNDRED AND SIXTEENTH REPRESENTATIVE No Candidate HEATHER BOOKSTAVER DISTRICT CECIL E. SCHMIDT ey of the Civil War Pro- decorating supplies will (Vote for one) FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN DUQUOIN 2 FOR PRECINCT COMMITTEEMAN DUQUOIN 12 (Vote for one) gram scheduled for be provided. All ages are No Candidate CUTLER (Vote for one) (Vote for one) March 8 has been post- welcome, but children COUNTY No Candidate JOHN REDNOUR JR. FOR CIRCUIT CLERK MARIO DOLCE FOR PRECINCT COMMITTEEMAN poned to late April. must be accompanied (Vote for one) FOR PRECINCT COMMITTEEMAN PINCKNEYVILLE 1 The library has some No Candidate DUQUOIN 1 (Vote for one) by someone 16 or older. (Vote for one) No Candidate PRECINCT COMMITTEEMAN PRECINCT COMMITTEEMAN events coming up, in- DONNA M. DAVISON A new session of yoga FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN cluding a March 15 DUQUOIN 3 PINCKNEYVILLE 3 FOR PRECINCT COMMITTEEMAN PINCKNEYVILLE 2 classes will begin March (Vote for one) (Vote for one) DUQUOIN 2 (Vote for one) movie. “In the Heart of (Vote for one) 24. No Candidate LOIS HEISNER RUBEN J. DAVIS the Sea” will play at 1 No Candidate A coloring event for FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN DUQUOIN 4 PINCKNEYVILLE 4 and 7 p.m. PRECINCT COMMITTEEMAN PROPOSITION adults and teens is (Vote for one) (Vote for one) On March 19 at 11, po- FOR PRECINCT COMMITTEEMAN PINCKNEYVILLE COMMUNITY CONSOLIDATED SCHOOL DISTRICT NO. 204 March 28 at 6:30. No Candidate No Candidate PINCKNEYVILLE 3 PROPOSITION TO INCREASE (Vote for one) MAXIMUM ANNUAL EDUCATION TAX RATE ets and would-be poets FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN Shall the maximum annual tax rate for educational purposes of Pinckneyville Friends of the Library DUQUOIN 5 PINCKNEYVILLE 5 DAVID GROSS Community Consolidated School District No. 204, Perry County, Illinois, be are invited for an infor- (Vote for one) (Vote for one) increased and established at 1.75 percent upon all the taxable property of will provide refresh- FOR PRECINCT COMMITTEEMAN said School District at the value, as equalized or assessed by the mal get-together to ex- No Candidate No Candidate Department of Revenue, instead of 1.50 percent, the present maximum rate PINCKNEYVILLE 4 otherwise applicable to the next taxes to be extended for said purpose? (Vote for one) plore and share poetry. ments. FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN YES DUQUOIN 6 PINCKNEYVILLE 6 SUSAN HEPP NO You can dye Easter For a complete list of (Vote for one) (Vote for one) FOR PRECINCT COMMITTEEMAN a. The approximate amount of taxes extendible for educational purposes under the events or more informa- No Candidate No Candidate PINCKNEYVILLE 5 maximum rate now in force in said School District is the sum of $402,262. eggs March 21 from 6 to b. The approximate amount of taxes extendible for educational purposes under the FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN (Vote for one) proposed increased rate is the sum of $469,306. 8. Attendees should tion, call 826-3711 or go c. The total dollar amount of the most recently approved annual budget of said School DUQUOIN 7 PINCKNEYVILLE 7 REBECCA TRACY District is the sum of $1,534,080; the total dollar amount of said annual budget, if (Vote for one) (Vote for one) increased by the amount of additional tax which may be levied if the proposition is bring their own hard- to chesterpublic library.com. FOR PRECINCT COMMITTEEMAN approved, is the sum of $1,601,124; the percentage of increase in the total dollar amount of the most recently approved annual budget of said School District if such CLIFF VANZANDT BRUCE MORGENSTERN PINCKNEYVILLE 6 total dollar amount were increased by the amount of additional tax which may be (Vote for one) levied if the proposition is approved, is 4.37 percent. FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN d. The percentage increase between the maximum rate at which such taxes for DUQUOIN 8 PINCKNEYVILLE 8 educational purposes may be levied if the proposition is approved and the annual rate BETH KELLERMAN LIPE (Vote for one) (Vote for one) at which such taxes for educational purposes is currently levied is 11.67 percent. FOR PRECINCT COMMITTEEMAN No Candidate PHILLIP O. BAKER PINCKNEYVILLE 7 Soil, water district (Vote for one) FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN DUQUOIN 9 SUNFIELD NATALIE BRAND (Vote for one) (Vote for one) FOR PRECINCT COMMITTEEMAN meeting date changed No Candidate BRUCE DOUGLAS RODELY PINCKNEYVILLE 8 FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN (Vote for one) DUQUOIN 10 SWANWICK The Randolph County The meeting will be at (Vote for one) (Vote for one) No Candidate FOR PRECINCT COMMITTEEMAN Soil and Water Conserva- the Randolph County No Candidate LAURA ANDERSON SUNFIELD FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN (Vote for one) tion District’s May 5 board Office Complex/USDA DUQUOIN 11 TAMAROA 1 meeting has been changed Building at 313 West (Vote for one) (Vote for one) No Candidate FOR PRECINCT COMMITTEEMAN to May 12 at 8 p.m. Belmont in Sparta. No Candidate No Candidate SWANWICK FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN (Vote for one) DUQUOIN 12 TAMAROA 2 (Vote for one) (Vote for one) No Candidate FOR PRECINCT COMMITTEEMAN No Candidate No Candidate TAMAROA 1 FOR PRECINCT COMMITTEEMAN FOR PRECINCT COMMITTEEMAN (Vote for one) PINCKNEYVILLE 1 WILLISVILLE (Vote for one) (Vote for one) BEN MAYVILLE FOR PRECINCT COMMITTEEMAN Quality Accounting RONALD E. DEEDRICK No Candidate TAMAROA 2 FOR PRECINCT COMMITTEEMAN (Vote for one) And Tax Service PINCKNEYVILLE 2 PROPOSITION (Vote for one) PINCKNEYVILLE COMMUNITY CONSOLIDATED SCHOOL DISTRICT NO. 204 No Candidate PROPOSITION TO INCREASE • Electronic Filing MAXIMUM ANNUAL EDUCATION TAX RATE FOR PRECINCT COMMITTEEMAN No Candidate Shall the maximum annual tax rate for educational purposes of Pinckneyville Community Consolidated School District No. 204, Perry County, Illinois, be WILLISVILLE increased and established at 1.75 percent upon all the taxable property of (Vote for one) • Convenient Evening & Saturday Hours Art Pontow said School District at the value, as equalized or assessed by the Department of Revenue, instead of 1.50 percent, the present maximum rate otherwise applicable to the next taxes to be extended for said purpose? NICK DOLCE • Individual & Business Tax Preparation Certified YES • Personal, Professional Service Public NO a. The approximate amount of taxes extendible for educational purposes under the Accountant maximum rate now in force in said School District is the sum of $402,262. b. The approximate amount of taxes extendible for educational purposes under the • Over 40 Years Of Experience proposed increased rate is the sum of $469,306. c. The total dollar amount of the most recently approved annual budget of said School District is the sum of $1,534,080; the total dollar amount of said annual budget, if increased by the amount of additional tax which may be levied if the proposition is Located East Of Chester On Route 150 approved, is the sum of $1,601,124; the percentage of increase in the total dollar amount of the most recently approved annual budget of said School District if such total dollar amount were increased by the amount of additional tax which may be levied if the proposition is approved, is 4.37 percent. 10397 Paradise Road • Bremen d. The percentage increase between the maximum rate at which such taxes for educational purposes may be levied if the proposition is approved and the annual rate email: [email protected] (618) 826-3305 at which such taxes for educational purposes is currently levied is 11.67 percent. Page 12 County Journal March 10, 2016
Grant will help Sparta kids prepare for college Sparta High School states where BL is ral schools to increase is one of 10 schools in working to improve the knowledge base the southern portion of college and career around educational Illinois that will ben- readiness as part of a best practices. efit from more than $3 $20 million Investing CEC and BL will de- million in federal grant in Innovation Scale-Up liver customized pro- funds that will take sig- Grant from the U.S. nificant steps, over a Department of Educa- fessional learning to three-year period, to tion that will include build the knowledge, improve graduation additional private in- skills and capabilities of rates and dual credit vestment. teachers and administra- offerings. The graant will sup- tors, provide design and Schools were se- port participating planning services to stra- lected to participate in schools by building the tegically leverage time Illinois Rural Innova- capacity of principals and financial resources tive Schools Effort and teachers to person- to transform schools and based on a variety of alize learning for stu- districts to personalize factors, including the dents, providing pro- learning for each student fessional development district’s commitment and identify and monitor to collaboration, loca- to principals and data to improve decision tion, poverty level and teachers on strategies Sticky fingers prior graduation rates. that have proven suc- making. Pinckneyville Head Start has been learning about things that are It is led by the Consor- cessful in other For more informa- sticky. Pictured is Reese Giacomo and Enzo Zubia, exploring goop, tium for Educational schools and offering tion, call Superinten- which is made of equal parts liquid starch and glue. Goop can be Change and Break- opportunities for the dent Larry Beattie at stretched, pulled apart, shaped and, as the kids found out, very very through Learning. IRISE schools to col- 443-5331 or email sticky. Illinois is one of five laborate with other ru- lbeattie@ sparta.k12.il.us. Academic Local students award do well
for Five college students from the area were re- Sparta cently named to hon- ors lists. Taylor Krause of golf Evansville, Julie Klein of Marissa and Katie teams Backs of Oakdale were named to the Univer- Both the boys and the sity of Illinois dean’s girls golf teams at list. Sparta High School have received the Team Daysha Wester-man Academic Achievement of Ellis Grove was Award for the 2015-16 named to the honor season. The girls team roll at University of had a grade point aver- Kansas. age of 3.57 and the Juliana Grace boys 3.23. Above are the members of the Sparta High School girls and boys golf teams. In front from left The awards were pre- are Sheri Douglas, Jarad Stefani, Jenny Yang, Skylar Mansker and Isabella Jones. Middle French of Sparta was sented by the Illinois row: coach Bobby Bohnert, Rachel Wilson, Chris Brooks, Jared Gallois, Brandon Kempfer, Ryan named to the dean’s High School Associa- Ramsey, Adam Krisby and coach Jim Jeffers. Back row: Justin Krisby, Jimmy Haynes, Matt list at University of tion. Kelley, Zack Thompson, Jacob Soderlund and Olivia Beattie. Wisconsin-Milwaukee.
Local school breakfast and lunch menus Competitive Rates –
WEDNESDAY: Sloppy WEDNESDAY: Country FDIC-Insured* TRICO Chili. joe, peas, cheese slice, fried steak, mashed March 14-18 THURSDAY: Corn dog, peaches. potatoes, gravy, pudding. Breakfast green beans, jello. MONDAY: Breakfast THURSDAY: Soft taco. THURSDAY: Corn dog, FRIDAY: Cheese pizza, green beans, jello. pizza. HS, bagels, sour garden salad, broccoli. STEELEVILLE FRIDAY: Fish sandwich, cream or breakfast pizza. HS, cookie. TUESDAY: French toast March 14-18 garden salad, sugar Breakfast cookie. or pancakes. COULTERVILLE MONDAY: Sausage pan- It’s a beautiful thing. WEDNESDAY: Coffee March 14-18 cake on a stick. ST. MARK’S cake or cinnamon roll, Breakfast Let me help you choose an FDIC-insured sausage. TUESDAY: Sausage bis- March 14-18 Certificate of Deposit from State Farm cuit. MONDAY: Sausage MONDAY: Salisbury Terrin Thies THURSDAY: Eggs. HS, pancake on a stick. State Farm Agent Bank® and watch your money grow. breakfast sundae. WEDNESDAY: Cereal. steak, mashed potatoes, THURSDAY: Waffles. TUESDAY: Sausage peaches. 311 W. Broadway Bank with a good neighbor®. FRIDAY: Biscuits, gravy. biscuit. Steeleville, IL 62288 Lunch FRIDAY: Biscuits, gravy, TUESDAY: Taco, corn, CALL ME TODAY WEDNESDAY: Breakfast (618) 965-9749 MONDAY: Cheese sausage. applesauce. FOR MORE INFORMATION. burrito. quesadilla, refried Lunch WEDNESDAY: Chili, THURSDAY: Waffles. beans, baby carrots, MONDAY: Ranch chick- cornbread, pineapple. mandarin oranges. en wrap, black beans. FRIDAY: Biscuits, gravy, THURSDAY: Chicken TUESDAY: Baked ziti, TUESDAY: Meatloaf, sausage. nuggets, green beans, *Up to FDIC insured limits. Annual Percentage Yields as of 03/02/16. Advertised mashed potatoes, gravy, Lunch green jello w/fruit. rates are subject to change at the Bank’s discretion. The minimum balance required salad, green beans. to earn the stated APY is $500 (rates apply to deposits less than $100,000). A WEDNESDAY: Chicken fruit, pudding. MONDAY: Beef/bean FRIDAY: Chicken/dump- penalty may be imposed for withdrawals prior to maturity. WEDNESDAY: Cheese- burrito, black beans. lings, carrots, strawber- patty, carrots w/dip, 1001287.3 State Farm Bank, F.S.B., Bloomington, Illinois Normandy blend. burger, carrots. HS, TUESDAY: Chili, carrots. ries. THURSDAY: Chili, Ital- ian dunker, carrots w/ dip. FRIDAY: Cheese pizza, corn, salad, applesauce. Spring Savings Time Is Ticking SPARTA HIGH 10% OFF Toward April 15 March 14-18 Breakfast Parts & Labor To Your There is still time to make your MONDAY: Waffles. Existing Duct Work When You TUESDAY: Breakfast Purchase A New Amana Air pizza. Conditioner Or Furnace IRA Contribution WEDNESDAY: Cinna- mon toast, sausage. Hurry Offer Ends March 31, 2016 THURSDAY: Oatmeal, breakfast bar. Michael Howell FRIDAY: Mini powdered CPA, CFP, JD donuts. ChesterChesterChesterChester Lunch ChesterChesterChester MONDAY: BBQ chicken, HEATING & carrots. AIR CONDITIONING TUESDAY: Cheesebur- Chris Mincheff ger, oven fries. 618-521-0598 You still have time to contribute for: PLEASE REMEMBER: WEDNESDAY: Tacos, • You must have earned income corn. • 2015: until 4/18/16 in order to make a contribution. THURSDAY: Country • 2016: between 1/1/16 and 4/15/17 fried steak, mashed • You can contribute to a potatoes, gravy, green 2016 Traditional IRA and Roth Contribution Limits traditional IRA only if you are beans. younger than age 70 1/2 by FRIDAY: Grilled cheese, Under age 50 Age 50 or older the end of the year. baked beans. By High Auto • Your deductible traditional IRA and non-deductible Roth IRA CHESTER GRADE SHOCKED Repair Bills? $5,500 $6,500 contributions may be limited. March 14-18 Oil Change • Transmission Limits include traditional IRA and Wheel Alignment • Consult your tax advisor for Breakfast Roth IRA contributions combined. complete IRS guidelines MONDAY: Sausage patty Tire Rotation & Balance on toast. Heating & Cooling • Batteries TUESDAY: Sausage ba- Brake System • Steering System gel. Air Conditioning • Starting System WEDNESDAY: Cinna- Fuel System • Charging System mon roll. MOST MAJOR BRAND TIRES THURSDAY: Breakfast pizza. SWITCH To Gerald’s! FRIDAY: No school. Lunch WEALTH MANAGEMENT GROUP MONDAY: Salisbury steak/gravy, mashed Gerald’s 1101 NORTH MARKET ST., SPARTA, ILLINOIS 62286 potatoes, pineapple. Radiator & TUESDAY: Mini corn (618) 443-2395 dogs, baked beans, www.HowellFinancialServices.com cheese stick, apple- Automotive Securities Offered Through LPL Financial Member FINRA/SIPC sauce. 14 Westwood Drive • Steeleville • 965-3323 March 10, 2016 County Journal Page 13
Trico spelling bee Trico held a spelling bee March 3 in the elementary gym. Volunteer judges were Aaron Nance and Laci Froemling. Winners were Silas Moore, first; Vanessa Aaron, second; Garrett Franklin, third; Katelyn Allen, fourth and Lilly Williams, fifth. Shown in the front row from left are participants Vanessa Aaron, Tess Nehrt, Tami Bramlet, Kendall Farris, Lilly Williams, Addysen Denault, Addyson McClaine, Katelyn Allen and Jocey Kalmas. Back row: Lydia Williams, Madi Rathert, Daniel Jones, Bailey Watson, Elizabeth Blessing, Silas Moore, Alexis Stroub, Avery Pierce, Aiden Blessing and Garrett Franklin. P’ville band earns medals The Pinckneyville sembles went to Hunter Walthall, clarinet choir, High School music de- Barnett, Miles Chandler, and Geary and Turney, partment performed Feltmeyer, Garavaglia, mixed vocal. well March 5 at the Ashley Harsy, Cale Second-excellent solos Pictured are Pinckneyville High School band members Sydney Wright, IHSA Solo and En- Jausel, Korey Klausing, were awarded to Ashley Stephen Wagner, Lindsay Feltmeyer, Sydney Stanton, Erica Crews, Madison semble Contest at Brady Louis, Mary Barber, Sarah Issler, Al- Carterville High School. Siefert and Blaise Garavaglia, Jon Gulley and Chad McDaniel. The eight represented the school exis Nowakowski, at the Quad-State Music Festival in Murray, Kentucky. Pinckneyville’s instru- Wyciskalla, mixed per- Maggie Sanders and mental and choral stu- cussion; Grant Bigham, Mallory Stein, vocal. dents earned 52 first-su- Chad McDaniel, Austin Pinckneyville’s sec- perior and 23 second-ex- Nehring and Libby ond-excellent en- cellent medals. P’ville high school band Ryterski, saxophone; sembles were Lexi The students were di- Wagner and Wright, Conner and McKee, rected by Stephen mixed vocal; Katelynn treble vocal; Mallory Cannedy and Amber attends quad-state festival Bardle, Gabe Cope, May- Stein and Michelle Nichols. Cathy Cunning- ci Doerflein, Garavaglia, The Pinckneyville in one of four bands. Woodside, treble vocal; french horn, Jon Gulley, ham and Barb Oney Jonathan Gulley, Grant Community High Over 350 instrumental Erica Crews, Chayenne trombone, and Chad helped with piano ac- Jausel, Jon Lee, Jacob School band was repre- students participated Furguson, Morgan McDaniel, alto sax, were companiments. Miller, Liam Oliver, sented by eight students in the 69th annual fes- in the fourth band. Pinckneyville’s first- Faleshia Quillman, Gleason, Kailey Greer, February 25-27 at the tival. Nicole Hankla, Pheebe The students partici- superior solos were Hunter Sizemore, Syd- Quad-State Music Festi- Sydney Wright, flute, pated in master classes Brianna Carle, Madison Kantor, Rachel Loos, ney Stanton, Marissa val on the Murray State and Stephen Wagner, on their instrument, at- Garavaglia, Taylor Kayce Morgan, Nowa- University campus in trumpet, were mem- Stowers, Hallie Wag- tended performances by Geary, Jamie McKee, goner and Wagner, kowski, Alexis Ruffino, Kentucky. bers of the second Murray State en- Bryan Turney, Stephen brass choir; Gabby Liz Bartnicki and Pinckneyville students band. Lindsay Felt- Wagner and Sydney Bartnicki, Cooper, Felt- Wright, flute choir, and were selected based on meyer and Sydney sembles, rehearsed with Wright, vocal, and meyer, Madison Hutch- Mason Hopp and Collin recommendations from Stanton, both clarinet, their bands and per- Hannah Cooper and ings, Haley Johnston, Woodside, saxophone director Stephen Cann- were in the third band. formed a concert from Lindsay Feltmeyer, Sydney Kelly, Kara duet. edy. The students were Erica Crews, flute, the historic Lovett Audi- clarinet. Lacy, Stanton, Claire Stowers earned a third- auditioned and placed Madison Garavaglia, torium stage. First superior en- Stotlar and Adrianna good solo in vocals. Chester kindergarten registration Trico class files to be destroyed The Chester Grade 17 from 3 to 7 p.m. and Screening for children Members of Trico’s Files that are not School will have kinder- March 18 from 8 to noon. entering kindergarten files March 16 or 17 be- graduating class of 2011 picked up on those garten registration Parents should bring a will take place at the be- tween 5 and 8 p.m. in the can pick up their school dates will be destroyed. March 17 and 18 for stu- certified copy of their ginning of the school school guidance office. dents living in the dis- child’s birth certificate, year in August. trict who will be 5 on or social security number, For more information, before September 1. proof of residency and a call the school at 826- Registration is March copy of immunizations. 2354. CHICKENCHICKENCHICKENCHICKENCHICKENCHICKENCHICKENCHICKENCHICKENCHICKENCHICKENCHICKEN $ 99 WINGSWINGSWINGSWINGSWINGSWINGSWINGSWINGSWINGSWINGSWINGSWINGS 6 20 Pieces Elect Honey BBQ CARLOS J. Or Buffalo BARBOUR Must Be Randolph County Coroner At Least 21 To Play 1775 N. Market 201 Minton Dr. Experience • Professionalism • Compassion SPARTA PERCY ★ Randolph County Deputy Coroner Since 1984 443-3500 497-2350 ★ Chief Deputy Coroner Since 2004 Daily 7am-8pm Mon.-Sat. 7am-8pm, Sun. 7am-2pm ★ Completion of Medicolegal Death Investigation - SLU ★ State Certified Lead Homicide Investigator ★ Graduate SIUC Mortuary Science ★ Steeleville Village Trustee SWITCH TO BLOCK & PAY HALF. PLEASE VOTE Tuesday, March 15 Paid For By Candidate
Tuesday, March 15 VOTE Democrat
Re-Elect SHERRY
Anthony Davis didn't file with Block last year, but this year he will. He can switch to Block and pay half what he paid someone else. JOHNSON You can switch to Block and pay half too.
720 Chester Center, Chester, IL 62233 618-826-4397 Randolph County 1805 N Market St. Ste B, Sparta, IL 62286 618-443-4108
118 S Main St., Red Bud, IL 62278 618-282-6882
Subject to $100 minimum charge. CIRCUIT CLERK Offer valid for income tax return preparation fees for new clients only. A new client is an individual who did not use H&R Block office services to prepare his or her 2014 tax return. Valid receipt for 2014 tax preparation fees from tax preparer other than H&R Block must be presented prior to completion of initial tax office interview. May not be combined with other offers. At participating offices only. Offer period Feb. 22 - Ad Paid For By Friends Of Sherry Johnson 16-0345 16-0345 March 31, 2016. To qualify, tax return must be paid for and filed during this period. OBTP# B13696 ©2016 HRB Tax Group, Inc. Page 14 County Journal March 10, 2016 Cutler Town Board meets privately with German Cutler apparently has German. The board discussed a problem relating to Ri- The board also agreed paving around the Mel- chard German. to a new one-year con- vin Carrothers bench in German met in closed tract for electricity at the park. No action was session with the board village-owned property, taken. for about 45 minutes pending a review of the It was agreed to pur- March 3. The meeting contract language. chase two floor mats for agenda stated that a Danny Ruppert of the community build- closed session would be Coulterville said the ing. They will have the held to discuss the pur- price per kilowatt would new Cutler logo imbed- chase or lease of prop- be 5.095, compared to ded in them. erty by the village and 4.340 in the previous The board approved Poetry Out Loud pending litigation. contract. the purchase of an ex- Area high school students recently took part in the Poetry Out Loud Following the closed The new contract is with tended warranty on a competition at SWIC in Belleville. The students memorized and recited session, the board took Constellation Energy and Kubota mower at $675 poems, with the winners moving on to state and possibly national no action pertaining to begins April 11. for one year. competition. At the event, front row from left, were Therese Beabout, Gibault Catholic High School; Tyler Figueroa, Sparta; Ali Mefford, Edwardsville; Molly Adams, Freeburg and Brooke Kordys, Sparta. Back row: Staci Clayborne, SWIC vice president for student development, Sarah Landsberger, Gibault; Jessica Erwin, Freeburg; Madelyn Foster, Edwardsville and Jeff Blue, SWIC coordinator of college activities and theatre operations. Photo by Kelly Turner Steeleville American Legion sponsors poster, essay contest
The Steeleville Ameri- contest. Winners from can Legion recently the sixth-grade class Steeleville library terrarium class sponsored the poppy were Saige Wittenborn, The Steeleville library terrarium students created their own terrariums poster and essay con- All of the first; Scotty Maxwell, March 3 with the help of Carol Meyer and Christie Howell, who donated tests for local schools. second; and Blaze Sher- plants, rocks, soil and time. Anyone interested in more information on Students from Steele- idan, third. Seventh creating a terrarium can stop by the library and check out the display. ville Grade School’s sev- winners grade: Ava Schwartz- enth and eighth-grade kopf, first; Nicholas language arts and social are listed Craig, second; and Lexi studies classes entered Renner, third. Eighth the essay contest. The grade: Haley Shrum, essay topic was whether Schwartzkopf, second; first; Allie Hinnerichs, or not U.S. senators and and Jordan Wilson, second; and Hunter congressmen should third. Smith, third. have term limits. Win- More than 50 students Special awards were ners were Allie Hinne- from Steeleville’s grades given to Jasmine Coch- richs, first place; Ava 6-8 entered the poster ran and Drake Hicks.
Shown are the winners from the essay and poster contests. Top It’s Time To Put Your awards Boat Back In The Water! In-Stock 9.9hp go to MERCURY Fourstroke P’ville Outboard Engines Junior Priced At High DEALER COST Let Us De-Winterize & Prep music Your Watercraft For The Pinckneyville Jun- Maximum Performance & ior High music depart- Enjoyment This Spring. ment participated in the ISGSMA solo and en- semble contest February 27 at Unity Point School. The group received five Authorized Dealer first superior and 24 first ratings. Students earning first superior were Noah Carter, Devin Kitchen and Dalton Kitchen, per- cussion trio; Daniel Garavaglia, David Wag- 1000 West Broadway • Sparta ner and Holden Hunt- ley, vocal bass ensem- 618-443-3358 ble; Zoey Brammeier Cell 618-443-7534 and Haley Ruffino, flute/ Monday-Friday 9am-6pm • Saturday 9am-Noon clarinet duet; Holden Huntley and Hayden PARTS • ACCESSORIES • SERVICE Robinson, snare drum duet, and David Wag- ner, snare drum solo. First ratings went to Chloe McKee and Kayla Alms, vocal duet; Kenzie David and Cameron Hepp, vocal duet; Sarah CAN YOU DIG IT? Copus and Kally Mayo, flute duet; Gabby NOT UNTIL YOU CALL 811 Sprague and Holden Huntley, saxophone duet; Chloe Yates, Kir- Stay safe while working outdoors. sten Bates, Zoey Bram- Always call JULIE at 811 before you dig. meier, Namen Schimpf, Cameron Hepp, Hunter If you smell an odor like rotten eggs in your home, Stevenson, Lauren Downard, Zoey Smith, leave immediately. Call Ameren Illinois at 1.800.755.5000 Emma Hanks, Alexis from a different location to report the gas odor. If you Degler, Maude Varnum, Kayla Alms, Emma smell gas outside, call Ameren Illinois to report. There is Rice and Cloe McKee, no charge for this service. vocal solos; Faith Smith, Sarah Copus and Emily Restoff, flute solos; Daisi Mucha, clarinet solo; Namen Schimpf, tuba solo, and Alexis Degler, oboe solo. The director is Amber Nichols. March 10, 2016 County Journal Page 15 Republicans Batteau and Rodely vie for Perry commissioner nomination in primary election By Travis Lott means she is in charge missioner will allow experience in govern- control government for Batteau believes he There is a primary of accounts payable, me to be involved and ment that sets him their own personal in- has the right experi- contest in Perry County purchasing, cost keep my career,” apart from his oppo- terests. ence in county govern- for the Republican records, etc. Rodely said. nent. “I’m not in this for per- ment to make these nomination to run “For a business that Both candidates feel He said that in his sonal gain,” Rodely things happen. against Democrat Dal- size, it’s a pretty broad their experience time as assessor, he’s said. “I think serving on a las Bigham for Sam base of responsibility,” makes them the best made sure that tax bills She said she wants county board is a posi- Robb’s soon-to-be-va- Rodely said. fit for the job. have been going out on to make sure that Perry tion that requires ser- cated county commis- She said she has Rodely said her ex- time so none of the tax- County is a place her vice and judgement— sioner seat. been involved with the perience in the busi- ing bodies, such as kids want to stay when good judgement,” The two hopefuls are Republican Party for ness world gives her schools, have needed they are older. Batteau said. “I want to John Batteau, 73, and some time now. insider privilege when to borrow money. Prior “The decisions we conserve tax dollars and Michelle Rodely, 48, Both candidates trying to attract busi- to his election, he said make today will affect provide the best services both of Du Quoin. have similar reasons ness to the area. those bills often went our kids 20 years from to taxpayers at the best Batteau has served as for running. “I deal with all of these out late. now,” Rodely said. price.” the supervisor of as- Batteau said he has entities on a daily ba- Batteau has a bach- Both candidates feel Rodely has a 7-year-old sessments in Perry always wanted to par- sis,” Rodely said. elor’s degree in govern- that it’s important to daughter and a 13-year- County for eight years ticipate in government She has a bachelor’s ment from SIU, and he be frugal and apply the old son and has been and, before that, as as- to make a difference. degree in science and serves as one of the only right funding to the married for 18 years. sessor in Williamson “I just want to try to management from SIU. three positions in right places, without “We’re not going any- County. He also sold advance Perry County She said she can help county government that wasteful spending. where,” Rodely said. corporate real estate as best as I can,” small businesses grow requires certification by “We have a limited “We’re fully en- for railroad companies Batteau said. to create a better cli- the state, the other two amount of money and trenched in Perry for 20 years. Similarly, Rodely, a mate for the future. being the state’s attor- a large amount of ser- County.” Rodely is an assistant freshman to politics, Batteau has years of ney and judge. vices that need to be Likewise, Batteau controller for E.T. wants to become in- experience in busi- Rodely said these are paid,” Rodely said. “Ev- has been married for 22 Simonds, a highway volved in the process ness, as well, having not good times in Perry erything needs to be years. They have two road construction com- while maintaining her averaged 200 sales a County, and there has taken into account, and grown children and one pany based in current work. year in corporate real been an issue with we should find areas who passed away a few Carbondale, which “Running for com- estate, but said it’s his county officials trying to we can save money.” years ago.
National Agriculture Day Agriculture is the NationalMARCH 18 Agriculture Day backbone of America March 15, 2016
First State National Ag Day is a day to Bank Of recognize and celebrate the Campbell Hill And Branches abundance provided by Member FDIC National Ag Day recognizes and celebrates the many contributions of American agriculture. agriculture. Every year, Join us on March 15 to show your appreciation to all those in the agriculture industry who keep producers, agricultural David Canning our country, and the world, going. associations, corporations, Auction Service Murphysboro universities, government 684-2331 agencies and countless MINTON DAVISDAVISDAVIS Insurance & Associates, LLC others across America join 326 W. Broadway • Steeleville • 965-3461 Farm Supplies Inc Monday - Friday 9am-5pm & Saturday 9am-Noon 110 N. Main Street • Marissa • 295-2542 together to recognize the 1200 N. Main • Perryville, Mo Monday - Friday 9:30am-4:30pm 573-547-4556 107 N. Market Street • Sparta • 443-2352 contributions of agriculture. Monday - Friday 9am-5pm www.davisfarmsupplies.com www.mintoninsurance.com Ralph’sRalph’sRalph’s Suchomski Small Engine Repair Equipment First National Bank 568-1707 North Of Of Ava Hwy 51 South Steeleville Pinckneyville Ava • 426-3303 Elkville 1-618-774-1000 336-5440 Member FDIC Randolph Mutual Bockhorn Perry County Insurance Ag, Inc. Farm Bureau Steeleville • Chester • McBride Company Sparta • 443-3905 Pinckneyville 826-2361 Steeleville • 965-3477 Chester • 826-2996 357-9355 Jackson County Action Lawrence Huseman Etzold Farm Bureau Delivering More Than Just Seed! Auction DEALER Packaging Murphysboro Red Bud Campbell Hill Perryville, Mo 684-3129 282-2682 426-3759 573-547-6815 Page 16 County Journal March 10, 2016 Pinckneyville FFA week filled with activities The Pinckneyville High School FFA cele- brated FFA week Feb- ruary 29 through Coach March 5. The students started the week wearing blue Ryan and gold or a farm shirt. They also had trivia questions about Bruns agriculture every morning, and the win- ‘wins’ ning class was treated to doughnuts. On Tuesday, students and handed out 400 ice cream sandwiches do- nated by Prairie Farms. kisses a FFA members went to the grade school Wednesday and read pig books about pigs and soybeans to third-grade pig belonging to April students and told them Nolan and Meghan about FFA. Carney. Thursday was drive a Five FFA members tractor to school day. competed Saturday in Friday finished the the livestock judging week with Kiss the Pig. contest at the Du Quoin FFA students col- State Fairgrounds. lected money all week during lunch, and coach Ryan Bruns was Ryan Bruns kissing a pig Rock ‘n Roll the winner. He kissed a Review Red Bud utility department reimburses city With SCOTT By Travis Lott no lost-time accidents. sented the council with fice to collect past due Some improvements to WATTLES & The Monday night Red Caverly said that in a check for $143.11, re- utility bills by taking it the bath house at the Bud City Council meet- years’ past, the utility de- imbursing the cost of out of the state tax re- city pool were approved. BLUE SUEDE ing was a strange one, partment employees the steaks. turns of those who owe The council approved to say the least. have been rewarded This expense was part money. painting the outside of CREW Mayor Tim Lowry and with a meal during of an overall question of No hold on tax return the building for $5,240, Performing Music Of The Aldermen Clem Esker, Christmas in apprecia- spending raised by Reed money may be made landscaping for $550, a ‘50s, ‘60s, ‘70s & ‘80s David Friess and Clar- tion for their lack of ac- during the finance com- without proper notifica- new awning for $1,875 ence Nail were all ab- cidents. mittee meeting. tion of the party respon- and new deck chairs for Saturday, sent, leaving the council However, during a re- Reed stressed the need sible for the debt. $2,300. March 12 for department heads to This is part of the The board approved by with barely enough cent finance committee At The members for a quorum. meeting, that expense follow purchasing pro- comptroller’s local debt a 3 to 2 vote to pay for Superintendent Josh was called into question cedures and to keep the recovery program. city officials to attend World Shooting Complex Eckart and Clerk Jo- by committee Chairman council informed as In other action, the the Regional Leaders “Seasons Event Center” anne Cowell were also Mike Reed. The city had items are needed. board approved the re- Breakfast. Reed ab- 1 Main Event Lane • Sparta placement of two win- stained from the vote, as absent. received a bill for the Other than the steak SHOW ONLY cost of steaks from money, Reed pointed out dows, with double-paned he has a conflict of in- $ Regardless, the coun- Tickets Available 20 cil moved forward with Miller’s Meat Market the purchase of a trailer windows, for $4,475 on terest, and Alderman several items of busi- that had been purchased for $1,500 without his the south side of the old Don Thompson passed Show Begins 7:30 ness. for the department’s knowlege and Lowry’s firehouse. This price in- on the vote. Cash Bar Available One point of interest party. purchase, with the city’s cludes removal of old The council approved Presented By was Tom Caverly, ad- During the committee credit card, of ball tick- panes. hiring April Cadwell for dressing the board on meeting, Reed ques- ets and alcohol at the Il- A representative of the the crossing guard po- The Gathering Place behalf of the utility de- tioned whether or not it linois Municipal League fire department said sition, pending drug Dinner Theatre partment. was appropriate for the conference. there was money in testing and a physical. TO VIEW UPCOMING SHOWS The council also ap- VISIT OUR WEBSITE AT This year marks the city to pay that cost. In other news, the their budget for the win- www.thegatheringplaceoffbroadway.com dows, and there would proved repairs to the third consecutive year After Caverly briefly council approved an For Tickets Call that the utility depart- addressed the board agreement with the be about $150 left over sewer plant, not to ex- (618) 965-3726 OR (618) 967-9926 ment has worked with Monday night, he pre- state comptroller’s of- after this project. ceed $11,100.
The Manor Family... Caring and loving is the best way to describe 94-year- old Audrey Nagel. Audrey said it also best describes the Manor family. “Everyone takes care of each other here. All of the residents have a genuine concern for one another, and the staff is wonderful,” said Audrey, who knows a lot about caring for others. “For nearly 30 years, I ran a daycare in my home in Chester, infants and up. I would tell the parents, ‘When you have them they’re yours, but they’re mine when I have them.’ They were all so precious, and I loved them all,” she said. “When I came to the Manor in May 2015, I came home. Some of the staff I had as kids in daycare. “I especially enjoy listening to the music they bring in. I’ve always liked to listen to bands. As a young girl, we danced a lot at Winkleman’s, every time they had a band. We didn’t care if they were in tune or not. We went and taught the boys to dance.”
To visit and take a tour of our facility call Shelley to set up an appointment. Shelley Bollman, R.N., Administrator www.manoratcraigfarms.com THE MANOR AT CRAIG FARMS 3030 State St. • Chester • 826-1400
DOOR PEOPLE
FRONT DOOR . BACK DOOR GARAGE DOOR . DOGGIE DOOR
YOU GET THE DRIFT
WWW.WRIGHTDOIT.COM March 10, 2016 County Journal Page 17 Podiatrist joins P’ville hospital Headquartered in Swansea Pinckneyville has a new podiatrist offering clinics at the hospital. Clinics begin Dr. Daniel Thouvenot, of Next Step Foot and March 18 Ankle Center in Swan- sea, will begin clinics in Pinckneyville March 18. of the American College Thouvenot received of Foot and Ankle Sur- his podiatric medical de- geons, the American gree at the Ohio College Podiatric Medical Asso- of Podiatric Medicine. ciation and the Missouri He completed his resi- Podiatric Medical Asso- dency at the Mineral ciation. Area Regional Medical For more information Center in Farmington, or to schedule an ap- Missouri. pointment, call Next Thouvenot is a member Step at 236-7444.
Sparta prom candidates The Sparta High School prom will be held April 9. The king and queen will be named at 10 p.m. Above are the candidates for the honors. Seated from left are Allison Ashbrook, Courtney Cissell, Brooke Kordys, Savannah Oliver, Haylee Shevlin and Paige Valleroy. Standing are Devin Brown, Trei Greer, Drew Kordys, Justin Kirby, Will Price and Gabe Yearian. Chester chicken dinner fundraiser
The Chester Knights Dr. Daniel Thouvenot of Columbus will host a fundraising fried chicken buffet for the Chester Senior Center Sunday, March 13 from 11 a.m. to 1:30 p.m. at 209 Church EasterEasterEasterEaster LiliesLiliesLiliesLilies Street in Chester. Churches – Carry-outs will be available. Order Your Proceeds will benefit the senior center’s Easter Lilies Now! meals on wheels and Plus All Other Easter Flowers! transportation fund. Call 475-2900 Marissa students in the greenhouse Due to the state budget In front from left are Marissa horticulture students Samantha Sweeney and impasse, the center Kaylei Conway working in the high school greenhouse, with Emily Wilkerson, isn’t receiving state Shirwin Farms 2411 State Route 13 • Lenzburg, IL Ian Hudson and Seth Carroll in the background. Students were planting starts funds for those pro- Look For The White Barns With Green Roofs 3 Miles South Of New Athens and seeds under the supervision of teacher Kim Portz. In late spring, they will grams and is only open (618) 475-2900 9:00am-6:00pm Seven Days A Week sell the flower and vegetable plants. Photo by Carol Mercer four days a week.
CJ Baricevic Sheila Simon Jerry Costello II 12th Congressional District 58th Senate 116th State Representative
Carlos Barbour Randy Bertetto Sherry Johnson Jeremy Walker Randolph County Randolph County Randolph County Randolph County Coroner Commissioner Circuit Clerk State’s Attorney
Brad K. Bleyer Jo Beth Weber C. John Baricevic Robert Haida Richard Brown 5th District Appellate Judge 5th District Appellate Judge 20th Judicial Circuit Judge 20th Judicial Circuit Judge 20th Judicial Circuit Judge
Free Lunch Sunday, March 13 | Noon-2pm Everyone Mostaccioli, Salad, Welcome! Dessert & Drink Sparta VFW, Sparta Illinois Ad paid for by Randolph County Democrat Central Committee. A copy of our report filed with the State Board of Elections is (or will be) available on the Board’s official website, www.elections.il.gov, or for purchase from the State Board of Elections, Springfield, Illinois. Page 18 County Journal March 10, 2016
The theme is Grossol- test the week of April 4. Thummel. A daughter, ogy: the (impolite) sci- Students are busy pre- Elizabeth Pautler pre- Hayer senior site vansville ence of the human paring for this, and par- ceded her in death. E body. While their par- ents need to be sure Mr. and Mrs. Louis H. ents are at the Turkey your students get plenty Hanebutt celebrated activities, menu NEWS Bowl, the kids can enjoy of rest and a nutritious their 15th wedding anni- a movie, crafts, snacks, breakfast on those days versary with relatives sage, whipped potatoes, By Eloise Kueker, 449-2043 Activities Legos, games and a sup- of testing. and friends. March 14-18 sauerkaut, sliced peach- per of hot dogs, chips, The end of the third William Stamm, 79, MONDAY: Relax w/Max es. Happy Birthday to drink and dessert. quarter is March 11. Re- died at the home of his at 9. Exercise at 10. Bin- TUESDAY: BBQ brats, Trenton Kiefer, Lyla This is for kids pre-K- port cards will go home daughter, Mrs. R. L. go/Bonnie Douglas card scalloped potatoes, Wilson, Marge Abell, 12. Preregistration is re- with students March 18. Moll. Survivors in- club at 12:30. baked beans, chocolate Brent Jones, Sara Long quired by calling 853- Students will be dis- cluded his wife, son TUESDAY: Bingo at cake. and Garry Monroney. 4649 or stopping by the missed at 2 March 23 for Charles, sister Dora 12:30. Art class at 1. WEDNESDAY: Meat- We extend our sympa- library. the Easter break. Class- Kueker and brother Sweatin’ to the oldies at loaf, lima beans or corn, thy to the family of Ger- The fee is $15 for the es will resume March 29. Henry Stamm. 5. peach half w/cottage ald Stork. first child and $10 for Evansville Enterprise Viola Liefer became WEDNESDAY: Exercise cheese, lettuce salad. It’s that time again to each child after that, or March 5, 1937 the bride of Arthur Alt- at 10. Gary, Bob and THURSDAY: Boiled po- change our clocks. This you may donate two Emil Biesterfeld and hoff. Attendants were Scott music at 10:30. tatoes, steamed cab- is spring, so it means new or gently used James Early were in- Anita Liefer, Leonna Birthday celebration. bage, green jello cake w/ we set our clocks one adult nonfiction books jured in an auto acci- Althoff, Elmer Liefer Bunco at 12:30. pineapple. hour ahead this Satur- with the date of 2000 to dent. and Henry Althoff. THURSDAY: St. Patrick’s FRIDAY: Fish, butter day before going to bed. the present. Mary Thummel passed O.H. Tittle purchased a Day celebration at 9:30. beans, peas/carrots, The library will host EAC News away. Survivors were light delivery truck to Chorus at 10. Kay Bivens apricots. a parents night out All students in grades daughter Mayme Wit- give his customers more card club. Chorus to Hours: Monday-Thurs- March 12 from 6 to 10. 3-8 will take the PARCC tenbrink and son John satisfactory service. Pinckneyville. Bingo at day 8-3, Friday 8-2. 12:30. Sweatin’ to the old- Meal: 11:30-noon. weekend with her par- ies at 5. Prices: Seniors $4; oulterville ents Melba and Morris FRIDAY: Exercise at 10. Others and carry-outs C Voges. Chad Voges of St. S’ville senior site Bingo w/Tracy at 12:30. $6; Home-delivered $4.25 Swanwick Peters, Missouri visited Menu Clothing store: 9-3 Saturday. MONDAY: Polish sau- More info: 443-4020 NEWS Joyce Burns and I went activities, menu By Diana Cole, 758-2880 shopping in Fairview rice casserole, iceberg Heights Wednesday. We Activities salad, Tex-Mex beans, had lunch at Longhorn. March 14-18 The UMC Thrift Store applesauce. Elodie was an over- MONDAY: Bingo at 10. Perry Gold Plate will have a free day WEDNESDAY: Spa- night guest Thursday. TUESDAY: Craig Manor March 12 from 9 to ghetti, lettuce salad, berry shortcake. On Friday, Matthew and bingo, blood pressure Activities noon. All items are free, mandarin oranges, gar- THURSDAY: Corned Nicole came to the VFW and sugar checks at 10. March 14-18 and the building fix- lic bread. beef/cabbage, parsley for dinner, along with WEDNESDAY: Exer- MONDAY: Bingo. tures will be sold on a THURSDAY: Corned potatoes, carrots, fruit. their friends Lindsay cise at 9:15. Bingo at 10. TUESDAY: Prize bingo. first come, first served beef stew, pears, corn- FRIDAY: Fish squares, and Andrew Oetjen. THURSDAY: Relax with WEDNESDAY: Bingo. basis. We are downsiz- bread, lime jello. macaroni salad, peas, Saturday, David and I Max at 9:30. ing our inventory for FRIDAY: Catfish, sweet fruit pie. met with Matthew, Ni- FRIDAY: Exercise at future relocation. potatoes, slaw, peaches, Menu Suggested donation: cole and Elodie at Gre- 9:15. Bingo at 10. The VFW Auxiliary is 4-layer pudding dessert. MONDAY: Lasagna, gar- $3 cian restaurant in serving fish and shrimp Menu Hours: 8:30 a.m. to 2 lic bread, broccoli, fruit. Meal sites and home- Pinckneyville, along dinners until Good Fri- MONDAY: Pulled pork p.m. Monday-Friday. TUESDAY: Ham/beans, delivered meals: Du with Nicole’s mom Terie day. The VFW will host sandwich, baked beans, Call 965-3134, exten- spinach, cornbread, Quoin, Cutler and Will- Brewer. the district meeting German potato salad, sion 5 to make a reser- beets, fruit crisp. isville Pastor John Hack- March 13. The auxiliary pineapple chunks, lem- vation. Call by 9:30 a.m. WEDNESDAY: Pot Call 542-3511 for more mann of the Coulterville will meet March 14 at 7 on bars. to make a reservation roast/carrots/potatoes/ information (by 8 a.m. to UMC announced last p.m. TUESDAY: Chicken/ for that day. onions, hot roll, straw- make a reservation). Amber Billingsley and Sunday that he and his daughters Ruby, Aud- family will be moving to rey and Myra of Mt. Marion. They will be Township Mutual Zion, Illinois visited last missed. In Memory Of Insurance Company SPARTA Pat Korando Celebrating 135 Years! Gone 2 years the 11th of March Call For A Quote... Chester senior Farm | Home | Auto | Commercial The one I love went to heaven too soon. Carolyn J. Holder, Agent activities, menu I miss him every day, in a thousand different ways. In the morning, in the night, when I look at the stars. (618) 785-2653 Activities cheese, vegetable soup, March 14-18 romaine lettuce salad, A date... a song... a place... a smell. MONDAY: Closed. gelatin w/fruit. A touch of a hand I can no longer hold. TUESDAY: Relax with WEDNESDAY: BBQ Max at 9:30. chicken, baked potato, WEDNESDAY: Exercise mama’s beans, apple Gospel Music at 10. Bingo, B/P B/S pie. INCOME TAX PREPARATION check by Craig Farms. THURSDAY: Corned Fast, Accurate Returns • Electronic Filing Nickel bingo after beef, potatoes/carrots, The Krepps Family lunch. cabbage, Watergate Walk-Ins Welcome THURSDAY: Quilting. cake. Saturday, March 12 Easter crafts with Lisa FRIDAY: Fish sandwich, baked beans, slaw, cin- 2pm-4pm from Chester library at BuckBuckBuck REAL ESTATE namon apples. 10. St. Patrick’s Day par- Enterprises INCOME TAX SERVICE ty. Open for walking: 8 ooo First Apostolic FRIDAY: Bean bag toss a.m. Lunch: 11:30 a.m. Prices: At center: $4; 1101 N. Main St. • Marissa at 10. 50/50 drawing. For More Penecostal Church Home-delivered: $4.25 618-295-2242 or 1-800-292-2096 Information Call 1701 High St. • Chester Menu Call 826-5108 by 9 a.m. 618-826-0080 TUESDAY: Grilled to make a reservation.
27 Randolph marriages Years Card Of Thanks Phillip Stephen Saale, Richard J. Nelan, The family and many friends of the late Lacie Nicole Steibel, Michelle D. Fortman, both of Waterloo both of Chester Lorene E. Dickerson Landscaping & wish to extend our sincere thanks for your Dave’s Tree Service, Inc. kindness, condolences and support that we have Randolph divorces received. We also send our gratitude and Now Since 1989 & appreciation to Pastor Paul Hahn, Rev. Dennis Jaime N. Schmeiderer, tion of marriage was Hauling Still Growing! 965-9110 Hamilton, the staffs at McDaniel & Lee petitioner, Derek W. granted February 18, ROCKROCKROCK Serving The Tri-County Area Funeral Home, Hospice of Southern Illinois and Schmeiderer. Dissolu- 2016. Tilden Fire Department. Also, thanks to Judy & Brett Etling, Naomi Owens and to all of the churches in the community for the wonderful luncheon. )DPLO\0HGLFDO&HQWHU Thank you to the staff, nurses and doctors at Sparta Community Hospital for treating our mother like family. We would also like to give a special thanks to everyone who donated to the Murfin Tilden Scholarship Fund in her memory. Scott and Jamie Mur- fin of Pinckneyville are The Dickerson Family proud to announce the birth of a daughter. Nora Lynn Murfin was born Sunday, Jan- uary 3, 2016 at Good Samaritan Hospital in Mt. Vernon. /HIW0DULDK&KDUOHV)13 GIFTS She weighed 7 0LGGOH6DOYD%LODO0' pounds 13 ounces and 5LJKW$QJLH(XEDQNV3$& was 20.75 inches long. For Everyone Maternal grandpar- In Your Life ents are Steve and Dorothy Weaver of 0RQGD\WKUX)ULGD\ Steeleville. Collectibles Paternal grand-par- 6DWXUGD\ Home Decor ents are Steve and Wreaths • Garlands Susan Murfin of Ver- non, Illinois. $UDQJHRIVHUYLFHVWRPHHWWKHQHHGV Purses • Jewelry 6DPH'D\ Much More RALPH’S $SSRLQWPHQWV$YDLODEOH RIZRPHQDWHYHU\VWDJHRIOLIH SMALL ENGINE REPAIR &DOO)RU$SSRLQWPHQWV “We’re more than just a pharmacy” HUSTLER • TORO ECHO • INGERSOLL ARIENS • GRAVELY 568-1707 • Hwy. 51 South • Elkville KEIL 3LQFNQH\YLOOH 6WDWH5RXWH Pharmacy & Gifts County &RPPXQLW\+RVSLWDO 3LQFNQH\YLOOH,/ 1375 S. Main Journal /HDGLQJWKHZD\WRDKHDOWKLHUWRPRUURZ ZZZSYLOOHKRVSRUJ Red Bud • 282-2870 March 10, 2016 County Journal Page 19
RONALD R. KUHNERT LENA BEHNKEN WANDA LEE JEFFERS Ronald R. “Ronnie” Lena Behnken, 102, of Chester, died Friday, Wanda Lee Jeffers, Kuhnert, 58, of Pinck- March 4, 2016 at 7:43 p.m. at Three Springs Lodge 77, of Sparta, entered neyville, died Thurs- Nursing Home in Chester. heaven at 3:06 p.m. Fri- day, March 3, 2016 at She was born December 7, 1913 in St. Clair day, March 4, 2016 at 3:28 p.m. at his home. County to Ferdinand and Emilie Luebkemann St. Elizabeth’s Hospi- He was born April 10, Sommer. tal in Belleville. 1957 in Du Quoin to She married Carl Fred Behnken August 18, She was born July Ronald G. and Joan 1940 in Baldwin. He preceded her in death No- 31, 1938 in Riley Lake, (Beckam) Kuhnert. vember 13, 1993. Illinois to Willis and Lena was a member of St. John Lutheran Ronnie was a self-em- Rose Danis Snider. Church in Chester. She was a retired teacher and ployed commercial Wanda married painter for over 30 a member of the Randolph County Retired Teach- ers, the Illinois Retired Teachers Association, Merle J. Jeffers March years, having worked 26, 1966 at the First with Kellerman Con- Randolph County Farm Bureau and SIU Alumni. She is survived by daughter Wanda Dethrow Baptist Church. He struction and Thomas Home Improvement, both in preceded her in death Pinckneyville, among others. He was a member of of Chester, daughter-in-law Sharon Behnken of March 20, 2004. the International Painters and Allied Trades Union Prairie du Rocher, siblings Ella Falkenheim, She worked at Central School in the library and the Fraternal Order of Eagles in Pinckneyville. Mathilda Sommer, Emilie Sommer, Frieda He enjoyed fishing, hunting, gardening, being out- Sommer, all of Marissa, and Leona (Joe) Braun and in the kitchen, and the kids loved her. If she doors, football and was an avid St. Louis Cardinal of Freeburg; grandsons Shawn, Joel, Nick and was out and about and one of the kids saw her, fan. Christopher (Jennifer) Behnken; step-grandsons she could count on a “Hi, Miss Wanda” and a Survivors include son Colten Kuhnert, daughters Mike (Rose) and Bill (Cheryl) Dethrow; great- hug. She was also the first courier for the Sparta Sabrina (Sean) Carter and Mattie Kuhnert, four grandchildren Amanda and Michael Behnken, hospital, where she met a lot of nice people, who grandchildren Torrie, Amelia, Landen and Aiden godchild Erna Sieber, eight step-great-grandchil- still remember her. Carter and his father, all of Pinckneyville; brother dren and 11 step-great-great-grandchildren. Wanda liked to read, do embroidery and work Jeff (Kristi) Kuhnert of Washington and his beloved She was also preceded in death by her parents, puzzle books. She loved being outside, wood- dog Jenny. son Wayne Behnken, son-in-law Richard working, painting and using her artistic skills He was preceded in death by his mother, broth- Dethrow, sisters Goldie Bollmeier and Augusta to make things. ers Johnny and Michael Kuhnert and sister Julie Ohm, brothers Fred, Louie, Ferd and Rudolph Wanda is survived by children who were her Kuhnert. Sommer, sister-in-law Helen Sommer and broth- world: Tracy (John) York and Robert Jeffers of ers-in-law Arkell Bollmeier, Leonard Ohm and A memorial service was held at Pyatt Funeral Sparta, Jerry Jeffers of Festus, Missouri, sister Adolph Falkenheim. Home in Pinckneyville Tuesday, March 8, 2016 at Jane (Ron) Hudson of Sparta, brother-in-law Paul Services were held 11:00 am Tuesday, March 10 a.m., with Brother Collin Hirsch officiating. (Nug) Jeffers of Glen Carbon and sister-in-law Memorials may be made to the Perry County 8, 2016 at 11 a.m. at Pechacek-McClure Funeral Home in Chester, with Rev. Tim Sims officiating. Pat Snider of New Carlisle, Indiana. Humane Society. Wanda was preceded in death by her parents Sign the guest book at pyattfuneralhome.com. Burial was at Paradise Cemetery in Steeleville. Memorials may be made to the St. John and brothers Michael and Sheridan Snider. Services were at 11 a.m. Wednesday, March 9, FLOYD E. Lutheran Church debt fund., St. John Lutheran 2016 at McDaniel & Lee Funeral Home in Sparta. LINDERS School new facility fund or Three Springs Lodge Floyd E. Linders, 94, activity fund. Burial was at Evergreen Cemetery in Chester. of Baldwin, died Satur- Sign the guest book at pmfh.net. Memorials may be given to Randolph County day, March 5, 2016 at his Relay For Life. home. Sign the guest book at mcdanielfh.com. He was born Decem- RONALD JUENGER ber 19, 1921 in Willis- Ronald “Ronnie D” ville to Edwin and Tillie Juenger, 57, of Neoga, INEZ RAMSEY Hecke Linders. Illinois, formerly of Inez “Faye” Ramsey, Floyd married Elda M. Tilden, died Sunday, 93, of Pinckneyville Linders September 26, February 28, 2016 at died Monday, March 7, 1964 in Chester. She 4:34 a.m. at Sarah Bush 2016 at 6:06 p.m. at preceded him in death Hospital in Mattoon. Pinckneyville Commu- April 4, 1998. He was born April 10, nity Hospital. He served in the United States Army during 1958 in Red Bud to She was born No- World War II. Katherine and Hubert vember 4, 1922 in Floyd worked for the state of Illinois as an equip- Juenger. Pinckneyville to James ment operator for 25 years. He also farmed and He married Ginger Louis and Nellie Mae raised cattle and mink. He was a former town board Easton April 9, 1998. Robbins Flare. member and fireman, and he was a private airplane She survives. On May 9, 1939, she pilot. Floyd, in the past, attended St. John Lutheran Ronnie was a pastor married Edward Church in Baldwin. at Clear Creek Baptist Kujawa in Perryville. He is survived by sister Mildred Schumacher of Church in Greenup, Il- He preceded her in Spanish Lake, Missouri, nieces and nephews. linois. He loved to play music, fish and camp. death September 29, 1983. After that marriage Floyd was also preceded in death by his parents, Ronnie is also survived by his parents ended, she married Lovell L. Ramsey August 19, brothers Ralph, Clyde and Vernon and sister Katherine and Hubert Juenger of Tilden, daugh- 1945. He preceded her in death June 24, 1980. Luella. ters Belicia (fiancée Nathan Knop) Shubert of Faye was a member of Beaucoup Baptist Services were held at noon Monday, March 7, Sparta and Breck Howard of Tilden, son Bran- Church in Pinckneyville. She enjoyed crochet- 2016 at Trinity Lutheran Church in Red Bud. Burial don (Abby) Juenger of Castle Rock, Colorado, ing, quilting and genealogy and loved watching was in Baldwin City Cemetery. grandchildren Alyssa, Taylor, Alex, Braydon and her grandchildren play sports. Memorials may be made to Trinity Lutheran Alaina, brother Randy (Jane) Juenger of Pinck- Survivors include sons Randy (Debbie) Ramsey Church in Red Bud. neyville, sisters Rhonda (Miles) Kesler of Tilden and Raymond (Connie) Ramsey of Pinckneyville, McDaniel & Lee Funeral Home in Sparta was in and Diana (Phillip) Behiter of Coulterville. Grover (Shirley) Ramsey of Du Quoin; daughters, charge of arrangements. He was preceded in death by his grandparents Shirley (Don) Wylie of Washington, Illinois, Lois Sign the guest book at mcdanielfh.com. Annie and Phillip Juenger and Alice and Harvey Folden of Pinckneyville and Glenda (Steve Risley. Rodley) Gilter of Oakdale; 14 grandchildren, 21 JAMES Visitation is Saturday, March 12, 2016 from 3 great-grandchildren and five great-great-grand- MAHON to 5 p.m. at First Baptist Church in Tilden. A cel- children. James “Jim” Mahon, ebration of life service will immediately follow, She was also preceded in death by her parents 83, of Longview, Texas, with Pastor Paul Hahn officiating. and siblings Alice, Mae, Lois, Junior, Arthur and died Tuesday, March 1, There will be a meal at the church after the Charles Flare and Grace Magdeline Randall. 2016, after a short battle service. Visitation is Thursday, March 10 from 6 to 8 with lung cancer. He McDaniel & Lee Funeral home in Tilden is in p.m. and Friday from 8 to 10 a.m. at Beaucoup had been a resident of charge of arrangements. Baptist Church in Pinckneyville. Services will Longview for 12 years. In lieu of flowers, donations may be made to immediately follow, with Brother Mark Lee offi- He was born Septem- the family. ciating. Burial will be in Oak Grove Cemetery in ber 4, 1932 in St. Peter, Sign the guest book at mcdanielfh.com. Pinckneyville. Illinois to Harold and Memorials may be made to Oak Grove Cem- Edith Ahlman Mahon. etery Association. Jim served in the U. S. Army during the Korean JENNIFER ANN Pyatt Funeral Home in Pinckneyville is in Conflict, stationed in Germany. MASTERSON charge of arrangements. He was a soil conservationist with the USDA in Jennifer Ann Sign the guest book at pyattfuneralhome.com. Sparta. He graduated from Farina High School in Masterson, 30, of Prai- Illinois and from U of I in Champaign. rie du Rocher, died at Those left to cherish his memory are his wife Sara 10:22 a.m., Tuesday, LELAND “LEE” Mahon of Longview; sons Daniel Mahon and fam- March 8, 2016 at her PAUL KOCH ily, Mary, Devin and Marcy of Houston; Timothy home. Leland Paul Koch, Mahon and family, Becky, Jonathon, Jalyn and She was born March 80, of Chester, Illinois, Jayce of Pflugerville; Jeffrey Mahon and family, 29, 1985 in Chester. died peacefully after a Sandy, Emily and Nick of Lafayette, Indiana; and Jennifer was a home- long illness Saturday, brothers David and Charles Mahon of Illinois. maker. March 5, 2016 at 8:20 She is survived by He was preceded in death by his parents, sister p.m. at Memorial Hos- her parents Kim and Mary Mahon and brother Dean Mahon. pital in Chester. Memorials may be made to the American Can- Dale Lindner of He was born April 3, cer Society, 1301 S. Broadway, Tyler, TX 75701 or Chester and Jeff and Terri Young of Hillsboro, 1935 in Steeleville to Texas Oncology, 1400 N. 4th Street, Longview, TX Missouri, children Hunter, Holten and Haylhn, 75601. grandparents Elmer and Mary Conder and Alfred Henry and Welch Funeral Home in Longview was in charge Bonita Jacoby, brother Robbie Lindner, half-sis- Malinda Sophie Cas- of cremation arrangements. ter Danielle and step-siblings Tabatha, Matthew tens Koch. Sign the guest book at welchfuneral.com. and Nate. He married Edith She was preceded in death by daughter Falkenberry May 22, 1965 in Chicago. She sur- LUELLA LENA Harper, grandparents Wilbert and Verna vives. “TOOTS” SAHRHAGE Lindner and uncle Don Lindner. Lee was retired from a career serving in the Luella Lena “Toots” Visitation is Friday, March 11, 2016 from 5 to U.S. Coast Guard. After retirement, he studied Sahrhage, 100, of Evans- 8 p.m. and Saturday from 7:30 to 10 a.m. at aviation mechanics at SIUC. ville, died Friday, March Pechacek-McClure Funeral Home in Chester. Lee was a member of St. John Lutheran Church 4, 2016 at 7:45 p.m. at Services will immediately follow, with Rev. Chet in Chester, American Legion Alva Courier Post Red Bud Regional Care. Bogus officiating. Burial will be in Ellis Grove #487, a life member of the National Rifle Asso- She was born January Cemetery. ciation, an associate member of the Illinois 16, 1916 in Evansville to Memorials may be made to Jennifer’s Sheriff’s Association and the Chief Petty Officer Henry and Lulu Jung children’s college education accounts, c/o Dale Association of the U.S. Coast Guard. He was an Ronnenberg. & Kim Lindner. avid St. Louis Cardinal fan. Sign the guest book at pmfh.net. She married John A. Also surviving are sister Delphine Girard of Sahrhage June 19, 1937 Chester and several nieces and nephews. in East St. Louis. He pre- He was preceded in death by his parents, ceded her in death July LACEENA STROUB brother E. Earl Koch and two nephews. 8, 2004. LaCeena Stroub, 75, of St. Albans, West Vir- Services were held at 11 a.m. Wednesday, Toots was a homemaker. She was of the Protes- ginia, died February 27, 2016. March 9, 2016 at Pechacek-McClure Funeral tant faith and was a member of the Eastern Star She is survived by children John (Paula), Larry Home in Chester, with Rev. Tim Landskroener for over 50 years. (Sherry), Billy (Lori) and JoAnna Stroub; grand- officiating. Burial was in Immanuel Lutheran She is survived by sons John (Barbara) Sahrhage children April (Matt) Major, John Shane (Sarah) of Baldwin and Morris H. Sahrhage of Sun City, Cemetery, West Point in Campbell Hill, Illinois. Corey and Dusty and Larry Joe Stroub; step- Pechacek-McClure Funeral Home in Chester Arizona, sister Zola Hellmeyer of East Carondelet, grandchildren Will (Gwen) Woolsey and Kendall Illinois, grandchildren Heather (Mark) Schoenherr was in charge of arrangements. (Daniel) Call; great-grandchildren Mykol, and Aaron (Anna) Sahrhage and four great-grand- Memorials may be made to the St. John Makayla and Maria Major and Alexis and Wyatt children Joshua, Emily, Elijah and Megan. Lutheran Church radio fund. She was also preceded in death by her parents Stroub; step-great-grandchildren William, Eliza- Sign the guest book at pmfh.net. and sisters Helen Karbon and Juanita Gallager. beth and Jack Woolsey and Austin, Brayden, Eva, A graveside service will be held Thursday, March Caleb and Jayden Call. 10, 2016 at 11 a.m. at the Evansville City Cemetery, LaCeena was proceded in death by her hus- Your #1 Local News with Rev. Bud Bennett officiating. band Billy and daughter Debra Stroub. Memorials may be made to Shriners Hospitals There will be a celebration of life Saturday, LEADER for Children. March 12, 2016 from noon to 2 p.m. at Pleasant Sign the guest book at wpfh.net. Hill Church on the Ava blacktop. County Journal • Percy • 497-8272 Page 20 County Journal March 10, 2016
2)),&,$/5(38%/,&$1%$//27 2)),&,$/'(02&5$7,&%$//27 *(1(5$/35,0$5< *(1(5$/35,0$5< Bryant says 0$5&+ 0$5&+ PUBLICATION PUBLICATION 3DW/DUDPRUH&RXQW\&OHUN 5HFRUGHU 3DW/DUDPRUH&RXQW\&OHUN 5HFRUGHU politics are -XGJHV,QLWLDOVBBBBBBBBBB -XGJHV,QLWLDOVBBBBBBBBBB 5$1'2/3+&2817<,//,12,6 5$1'2/3+&2817<,//,12,6 7RYRWHGDUNHQWKHRYDOWRWKH/()7RI\RXUFKRLFHOLNHWKLV 7RFDVWDZULWHLQYRWHGDUNHQWKHRYDOWRWKH/()7RIWKH 7RYRWHGDUNHQWKHRYDOWRWKH/()7RI\RXUFKRLFHOLNHWKLV 7RFDVWDZULWHLQYRWHGDUNHQWKHRYDOWRWKH/()7RIWKH EODQNVSDFHSURYLGHGDQGZULWHWKHFDQGLGDWHVQDPHLQWKDWVSDFH)RUVSHFLILFLQIRUPDWLRQUHIHUWRWKHFDUGRILQVWUXFWLRQ EODQNVSDFHSURYLGHGDQGZULWHWKHFDQGLGDWHVQDPHLQWKDWVSDFH)RUVSHFLILFLQIRUPDWLRQUHIHUWRWKHFDUGRILQVWUXFWLRQ SRVWHGLQWKHYRWLQJERRWK,I\RXWHDUVSRLOGHIDFHRUHUURQHRXVO\PDUNWKLVEDOORWUHWXUQLWWRWKHHOHFWLRQMXGJHDQGREWDLQ SRVWHGLQWKHYRWLQJERRWK,I\RXWHDUVSRLOGHIDFHRUHUURQHRXVO\PDUNWKLVEDOORWUHWXUQLWWRWKHHOHFWLRQMXGJHDQGREWDLQ DQRWKHU DQRWKHU stifling progress )('(5$/ &21*5(66,21$/ )('(5$/ &21*5(66,21$/ )2535(6,'(172)7+(81,7('67$7(6 )25'(/(*$7(727+(1$7,21$/ )2535(6,'(172)7+(81,7('67$7(6 )25'(/(*$7(727+(1$7,21$/ 9RWHIRU21( 120,1$7,1*&219(17,21 9RWHIRU21( 120,1$7,1*&219(17,21 7:(/)7+&21*5(66,21$/',675,&7 The Illinois House of nately, my bill has never -(%%86+ +,//$5<&/,1721 7:(/)7+&21*5(66,21$/',675,&7 3/($6(127(1H[WWRWKHQDPHRIHDFKFDQGLGDWH 3/($6(127(1H[WWRWKHQDPHRIHDFKFDQGLGDWH &+5,6&+5,67,( IRUGHOHJDWHDSSHDUVLQSDUHQWKHVHVWKHFDQGLGDWH V :,//,(/:,/621 Representatives failed seen the light of day due IRUGHOHJDWHDSSHDUVLQSDUHQWKHVHVWKHFDQGLGDWH V '21$/'-75803 SUHIHUHQFHIRU3UHVLGHQWRIWKH8QLWHG6WDWHVRUWKH 0$57,1-2 0$//(< ZRUGXQFRPPLWWHG SUHIHUHQFHIRU3UHVLGHQWRIWKH8QLWHG6WDWHVRUWKH March 2 to override the to petty partisan poli- 7('&58= 9RWHIRUQRWPRUHWKDQ7+5(( 5248(52&.<'(/$)8(17( ZRUGXQFRPPLWWHG veto of an unbalanced tics. I was not elected to 0$5&258%,2 */25,$0&$0326 %86+ /$55< /$:5(1&( &2+(1 9RWHIRUQRWPRUHWKDQ6,; 5$1'3$8/ *(25*(:2%(51$*(/,,, %86+ %(51,(6$1'(56 &+5,6723+(55%(/7 &/,1721 and unfunded MAP be another rubber ',1$5(1(%85&+ &/,1721 &$5/<),25,1$ $0<(6+2/$5 %86+ :ULWHLQ grants and community stamp for Mike 0,.(+8&.$%(( 1$7+$1&+$1(< 75803 )2581,7('67$7(66(1$725 ('',(/((-$&.621 &/,1721 5,&.6$172580 67(//$.2=$1(&., 75803 9RWHIRU21( -(11,)(5*205,&0,1721 &/,1721 colleges bill. Madigan, and I will not -2+15.$6,&+ +(5%81'(5:22' 75803 $1'5($=233 .(9,1/<1167$55 &/,1721 State Representative vote to increase our debt %(1&$5621 $'$0'2+0 &+5,67,( 7$00<'8&.:257+ /D72<$1*5((1:22' &/,1721 Terri Bryant again re- and make promises that )2581,7('67$7(66(1$725 -(11,)(5'2+0 &+5,67,( 1$32/(21+$55,6 5$<&2/(0$1 2 0$//(< 9RWHIRU21( 5,&+$5'.1,*+7 &+5,67,( 67$7( &<17+,$&2/(0$1 2 0$//(< jected an attempt by will never come true.” -$0(670$57(5 0$5.0,125 &58= )25&203752//(5 0$77+$:.,16 2 0$//(< 0$5.67(9(1.,5. 6+$5((/$1*(167(,1 &58= 726(59($181(;3,5('<($57(50 .,0,59,1*+$<:22'65 2 0$//(< majority Democrats that When a delay in state 9RWHIRU21( 67$7( &/,))25'(/,1'(0$11 &58= +$11$+$87(1 6$1'(56 would have added bil- funding for school con- )25&203752//(5 -8$1,7$68(+$0,/721 ),25,1$ 686$1$0(1'2=$ &2'</8(.(5 6$1'(56 726(59($181(;3,5('<($57(50 6&277$/%(57 ),25,1$ &21*5(66,21$/ .
:ULWHLQ 35(&,1&7&200,77((0$1 35(&,1&7&200,77((0$1 35(&,1&7&200,77((0$1 )2535(&,1&7&200,77((0$1 )2535(&,1&7&200,77((0$1 )2535(&,1&7&200,77((0$1 67((/(9,//( 52&.:22' :$/6+ 9RWHIRU21( 9RWHIRU21( 9RWHIRU21( -21$7+$1%$5%285 '(%25$++2(/6&+(5 12&$1','$7( )2535(&,1&7&200,77((0$1 )2535(&,1&7&200,77((0$1 )2535(&,1&7&200,77((0$1 7,/'(1 580$ :,1(+,// 9RWHIRU21( 9RWHIRU21( 9RWHIRU21( 521&+$1'/(5 12&$1','$7( 5,&.$60,7+ )2535(&,1&7&200,77((0$1 )2535(&,1&7&200,77((0$1 352326,7,21 :$/6+ 9RWHIRU21( 63$57$ &2817<2)5$1'2/3+ 9RWHIRU21( -2+15(,&+/,1* 6+$//7+(&2817<2)5$1'2/3+,//,12,6 52%(57:02552: ,668(%21'6,17+($028172)72 )2535(&,1&7&200,77((0$1 )2535(&,1&7&200,77((0$1 5(3$,5$1'5(129$7(7+(&2817< :,1(+,// &2857+286(" 63$57$ 9RWHIRU21( 9RWHIRU21( <(6 0$57+$5,&.(1%(5*
6&277$:,/621 12 352326,7,21 )2535(&,1&7&200,77((0$1 &2817<2)5$1'2/3+ 63$57$ 9RWHIRU21( 6+$//7+(&2817<2)5$1'2/3+,//,12,6 ,668(%21'6,17+($028172)72 5(3$,5$1'5(129$7(7+(&2817< :ULWHLQ &2857+286(" )2535(&,1&7&200,77((0$1 63$57$ <(6 9RWHIRU21( 12 12&$1','$7( )2535(&,1&7&200,77((0$1 63$57$ 2)),&,$/*5((1%$//27 9RWHIRU21( *(1(5$/35,0$5< &/<'(%2<' 0$5&+ )2535(&,1&7&200,77((0$1 63$57$ PUBLICATION 9RWHIRU21( 0(/$1,(-2+1621 3DW/DUDPRUH&RXQW\&OHUN 5HFRUGHU -XGJHV,QLWLDOVBBBBBBBBBB )2535(&,1&7&200,77((0$1 67((/(9,//( 5$1'2/3+&2817<,//,12,6 9RWHIRU21( 7RYRWHGDUNHQWKHRYDOWRWKH/()7RI\RXUFKRLFHOLNHWKLV 7RFDVWDZULWHLQYRWHGDUNHQWKHRYDOWRWKH/()7RIWKH EODQNVSDFHSURYLGHGDQGZULWHWKHFDQGLGDWHVQDPHLQWKDWVSDFH)RUVSHFLILFLQIRUPDWLRQUHIHUWRWKHFDUGRILQVWUXFWLRQ 12&$1','$7( SRVWHGLQWKHYRWLQJERRWK,I\RXWHDUVSRLOGHIDFHRUHUURQHRXVO\PDUNWKLVEDOORWUHWXUQLWWRWKHHOHFWLRQMXGJHDQGREWDLQ DQRWKHU )2535(&,1&7&200,77((0$1 67((/(9,//( &21*5(66,21$/ 9RWHIRU21( )255(35(6(17$7,9(,1&21*5(66 7:(/)7+&21*5(66,21$/',675,&7 12&$1','$7( 9RWHIRU21( )2535(&,1&7&200,77((0$1 3$8/$%5$'6+$: Emge speaks at SHS 67((/(9,//( 9RWHIRU21( 6$'21$0)2/.1(5
Sparta Community Hospital CEO Joanne Emge %58&($/$1'0$11 352326,7,21 &2817<2)5$1'2/3+ was the guest speaker recently at the Sparta )2535(&,1&7&200,77((0$1 7,/'(1 6+$//7+(&2817<2)5$1'2/3+,//,12,6 Rotary STRIVE program at Sparta High School. 9RWHIRU21( ,668(%21'6,17+($028172)72 5(3$,5$1'5(129$7(7+(&2817< Emge spoke to the students about opportunities 12&$1','$7( &2857+286(" in the healthcare field. <(6 12 2)),&,$/1213$57,6$1%$//27 *(1(5$/35,0$5< 0$5&+ 2)),&,$/ 1213$57,6$1 %$//27 Dirt For Sale PUBLICATION Make A Wise Decision, 3DW/DUDPRUH&RXQW\&OHUN 5HFRUGHU Road & Driveway Rock -XGJHV,QLWLDOVBBBBBBBBBB Order Your 5$1'2/3+&2817<,//,12,6 7RYRWHGDUNHQWKHRYDOWRWKH/()7RI\RXUFKRLFHOLNHWKLV 7RFDVWDZULWHLQYRWHGDUNHQWKHRYDOWRWKH/()7RIWKH Subscription All Sizes Rock • Tailgate Spread EODQNVSDFHSURYLGHGDQGZULWHWKHFDQGLGDWHVQDPHLQWKDWVSDFH)RUVSHFLILFLQIRUPDWLRQUHIHUWRWKHFDUGRILQVWUXFWLRQ SRVWHGLQWKHYRWLQJERRWK,I\RXWHDUVSRLOGHIDFHRUHUURQHRXVO\PDUNWKLVEDOORWUHWXUQLWWRWKHHOHFWLRQMXGJHDQGREWDLQ DQRWKHU To The County Journal REDREDRED 352326,7,21 DOTDOTDOT RED DOT &2817<2)5$1'2/3+ 6+$//7+(&2817<2)5$1'2/3+,//,12,6 Call Today ,668(%21'6,17+($028172)72 5(3$,5$1'5(129$7(7+(&2817< CONSTRUCTION 30-Yard &2857+286(" Trash Dumpsters County Journal Available <(6 826-4045 12 Percy • 497-8272 2)),&,$/ 1213$57,6$1 %$//27 March 20, 2016 County Journal Page 21
RANDOLPH COUNTY NOTICE Evansville Knights Of Columbus St. John Lutheran Church 303 Broad Street • Evansville • 853-2616 GENERAL ELECTION In BALDWIN Complete Schedule At www.evansvillekc.org EARLY VOTING DATES All-You-Can-Eat Public notice is hereby given, pursuant to Article 19A of the Election Code, that Early Voting in CHICKEN DINNER FISH FRY Randolph County will be conducted at the Randolph County Courthouse, Chester, Illinois BuffetBuffetBuffetBuffetBuffetBuffetBuffet prior to the MARCH 15, 2016 GENERAL Sunday, March 13 PRIMARY Election. 11:00am - 1:30pm EVERY FRIDAY BAKE Menu Includes: Fried Chicken, THROUGH MARCH 18 Mashed Potatoes W/Gravy, Corn, DATES SALE Green Beans, Slaw, Drinks & Dessert Serving 4:30pm - 8:00pm Mon., March 7 - Fri., March 11 Sponsored By St. John Lutheran ALL-YOU-CAN-EAT DINE-IN ONLY 4 Kinds Of Fish, Chicken Strips & 7 Sides 8 a.m. – 4 p.m. Ladies Aid Proceeds From ONLY 1/2 CHICKEN DINNERS Bake Sale Will Go AVAILABLE AS CARRY-OUTS BUFFET DINE-IN ONLY Adults $11 To Concordia Thrivent Is Matching Funds Carry-outs available by the plate, $ Seminary Adopt A sandwich or by the pound Kids 5-12 5 Fried Student Program 312 S. 5th Street • Baldwin PUBLIC NOTICE – GENERAL PRIMARY ELECTION FISH FRY EARLY VOTING DATES Public notice is hereby given, pursuant to Article 19A of the Illinois Election Code, that Early Voting in Perry County will be conducted on the following dates and locations prior to Featuring Just For You Catering Dinner EVERY FRIDAY the March 15, 2016 General Consolidated Election: Through April 29 Dates Location Hours Thur. Feb. 4 to Mon March 14 Perry County Clerk’s Office 8 a.m. – 4 p.m. Sunday, March 12 4:00-7:30pm County Government Building, Pinckneyville Tues. March 8 Du Quoin City Hall 4 p.m. – 7 p.m. 11:00am-1:30pm PUBLIC WELCOME 28 S. Washington Street, Du Quoin Choice of 3, 2 or 1-Piece Chicken Dinner Sat. March 12 Perry County Clerk’s Office 8 a.m. – Noon Catfish • Cod • Tilapia • Shrimp County Government Building, Pinckneyville With 2 Sides: 3-Piece Dinner EARLY VOTING INFORMATION Mashed Potatoes & DINNERS Early Voting allows all registered voters to cast their ballot prior to Election Day between Thursday, Feb. 4, 2016 and Monday, March 14, 20156 by voting at pre-designated sites Gravy, Corn, Slaw Choice of Two Sides named by the County Clerk. No excuse or reason is necessary to take advantage of Early $ 50 Voting. Any vote cast during the Early Voting period is final and may not be revoked. Early Or Green Beans And Per Plate Now Serving Voters are not eligible to vote on Election Day. The last day to apply for a mailed ballot is 8 Dine In Or Thursday, March 10, 2016. Any registered voter may apply for a ballot without specifying a Chicken & Dumplings Buffalo reason. In Person voting will take place at the County Clerk’s office before and after Early Kid’s Plates $5 Carry-Out Voting period until Monday, March 14. Fish ______Comes With Water, Iced Tea Or Coffee Fish Available By The Pound FOR ADDITIONAL INFORMATION CONTACT: Other Drinks Available For An Extra Charge Aerie Sparta Eagles 3059 Dine-In Or For To-Go Orders Call 618-443-2334 JOSH GROSS 112 E. MAIN • SPARTA • 443-4011 Perry County Clerk Proceeds To Benefit The Lions Building Fund P. O. Box 438 (618) 357-5116 SPARTA LIONS CLUB Pinckneyville, IL 62274 www.perrycountyclerk.com 510 WEST BELMONT • SPARTA - REMINDER NOTICE - SEMI-ANNUAL WASHINGTON COUNTY FISH FARM MACHINERY AUCTION Saturday, March 12 • 9:00am FRY Washington County Fairgrounds, Nashville INSPECTION WEEK PRIOR TO AUCTION! Friday, March 11 Saturday, March 12 8:30pm-12:30am 4-8pm PINCKNEYVILLE Large Inventory Of $11/Person SMALL HALL EAGLES Equipment Dine In Or Carry-Out Also Serving Saturday, March 26 More Coming Every Day OPEN JUKEBOX Chicken Strips! PRIVATE (WEDDING RECEPTION) Still Accepting Machinery. Call Now! Time is approximate and subject to change Chuck Funke 618.599.3418 or Jeff May 618.237.5428 Check out Fertile Soil on Facebook Saturday, March 12 or at www.fertilesoil.yolasite.com Visit Our Website For All Our Listings & Color Photos For booking information call (618) 317-4409 www.schallerauctionservice.com & www.auctionzip.com 7pm-Midnight • SMALL HALL or email [email protected] Unfrozen Caveman Lawyer Schaller Auction Service Millstadt, Illinois Classic Rock Brad (618) 476-1864 ~ Kevin (618) 476-9977 Lic. #440.000223 American Legion 303 S. CHESTER • STEELEVILLE • 965-3362 NOTICE TO VOTERS The County Clerk’s Office will be FISHER ABSOLUTE Open Saturday, ForForForFor TheTheTheThe ParkParkParkPark March 12, 2016 AUCTION From 8:00am Until Noon 684.30 Acres Farmland For Early & Grace Voting 13 Farmland Tracts Plus Grain Bins Spaghetti Dinner Saturday, March 12 • 1pm Saturday, March 19 The final date for St. Anthony’s Hall In Lively Grove EARLY VOTING IN THE 6101 St. Anthony Church Road, Oakdale SPARTA VFW $10 Adults 1911 North Market • Sparta $5 Kids GENERAL PRIMARY ELECTION Land Situated NE Of Marissa, Along The County Line Road Of Serving Starts 6pm (12 & Under) will be Washington & St. Clair Counties. Open Land - No Improvements Fun & Games For Everyone - Contiguous Tracts From 32-80 Acres Each With Good Road Monday, March 14, 2016 Frontage. Open Tenancy For 2016. Magic Show Photo Booth & Workshop (5) 18’ & 30’ Grain Bins Situated On Property From Silent Grace Period voting will be in To Be Moved By Sept. 30. Abra-Kid-Abra Auction our office through March 15 Owner: Charles Fisher Estate Lottery Tree Raffle Rosemary Fulton, Executor, Marissa, Illinois Pat Laramore Attorneys For Seller: Binsbacher & Griffithe, LLC Proceeds Will Go Toward Mascoutah, Illinois (618) 566-4300 A New Swing Set, Including Randolph County Clerk A Mommy/Daddy Photos & More Info At www.krauszauctions.com And Me Swing Auction Conducted By rd MARK KRAUSZ 23 Annual AUCTION SERVICE OAKDALE Illinois Auction Lic. #440000142 New Baden, Illinois (618) 588-4917 EASTER Saturday, March 12 • 9:00am Eggstravaganza Benefit For Monroe County Fairgrounds, Waterloo GUNS, COINS, ANTIQUES & COLLECTIBLES, HOUSEHOLD, TOYS & TOOLS Saturday, March 19 Winchester Model 74 22 Cal. Rifle, Marlin 1888 Model 38 Cal. Johnnie Robison Rifle, Stevens Marksman 22 Long Rifle, 1886 Hopkins & Allen Fellowship Service ~ 9am 12 Ga. Single Shot, Gold: 1908 $20 Graded MS-63, 1901-S $5 United Presbyterian Church Liberty, 1908 $5 IND, 1914-D $2 1/2 IND, 1925 $2 /2 IND, 1928 Saturday, March 19 $2 1/2 IND, Silver Dollars:, 1884-CC UNC, 1845 Seated, 1882- CC, 1883-CC, (2x) 1890-CC, 1903-S, Half Dollars: 1900-S 10am-4pm Sparta Eagles Barber Half (Very Nice) MS60, 1923-S Monroe Doctrine, 1892 Easter Egg Factory Tours 112. E. Main • Sparta Columbian Expedition, 1915-S Barber, Misc. Coins & Sets, 2 Stroll The Wood-Chipped Path Through M.L. Wolff Milk Bottles (1 Pint & 1/2 Pint), Van Briggle Vase, Woods, Across Bridges, Past Jellybean Crock Bowls, Quilts, Square Table, Oak Dry Sink, Dresser, & Marshmallow Trees...See Where INDOOR Dinner & Dance Library Desk, Old Judge Jars, Washstand, Hoosier Cabinet, Oil The Easter Bunny Creates His Magic! YARD SALE 5pm - ? Can, Wooden Chairs, Treadle Sewing Machine, Primitive Bench, $2 Admission 8am - Noon Table & 6 Chairs, Rocking Chair, Electric Lift Chair (New), Kiddie Train Rides FREE Petting Zoo Chicken Dinner Chrome Table & 3 Chairs, Girls 3-Pc. Bedroom Set (Nice), Compliments Of NC Pries Implements, Inc. $2 Admission AUCTION $ Refrigerator, Kenmore Electric Range, Gas Range, Wooden Starts 2pm W/Sides 10 High Chairs, Recliner, Couches, Love Seat, Chairs, Trunk, Food Crafts Prize Wheel Al Sweet, Auctioneer Pyrex Bowls, Crocks, Steam Whistle, Lots of Advertising Items, Chili, Sandwiches, Sponsored In Memory W/All The Draft Beer Pevely Cream Can, Hooter’s Lunch Box, Cracker Jack Poster, Homemade Pies, Cakes & More Of Wilma Wisely Donations You Can Drink $20 Flatware, Lots Of Forest Green Glassware, Lots Of Ruby Red Music Fox Glove Pickers, Zimmerman Telegram Band, WELCOME Glassware, Lots Of Sandwich Glassware, Avon Items, J. D. Rosie & Marion Konkel, Ted Stern & Bob Niedbalski For Yard Sale Pedal Tractor, Little Tykes Wagon, Motorized Monster Truck, And Madonna & Ron Williams & Auction 50/50 Raffle & Dolls, Easy Bake Oven, McDonald’s Toys, Old Comic Books, Egg Toss New Radio-Controled Car, Baseball Cards, Exercise Equipment, Free 20-Acre Egg Hunt Please Call 2pm ~ Ages 3-8 12:30 (618) 317-7006 Or Silent Auction Lawn Ornaments, Picnic Table, Patio Set, Aluminum Ramp, Hand & Garden Tools, Car Hood, Air Compressor, Rods & Drop Items Off During Dance 3:30pm Reels, Upright Freezer, Lots Of Misc. Bicycle Drawing At T&J’s Gift Shop Must Be Present To Win at Northtown Center Barrel Of Booze AUCTIONEER’S NOTE: Lots of interesting items. This in Sparta auction is getting large. We will be selling in 3 rings. We have Rain Or Shine ~ Not Responsible For Accidents Raffle Drawing 8pm items from the Clara Heller Estate at this auction. No Pets Please ~ Shuttles Run All Day Music By Website: vossauctions.com Our Major Sponsors Are Oakdale State Bank, Pyatt Funeral Home, Egyptian Telephone Co-Op, Plum Hill Consultancy Group, Action Auction Associates Coulterville Dairy Queen & Oelze Production Co. LLC SOUTHERN THUNDER Wayne Voss Mark Voss Tim Voss For More Info, Call Cathy (618) 329-5520 Or Kitty (618) 329-5572 All Proceeds To Help Offset Medical Expenses (618) 282-2682 / 910-9569 (618) 282-6864 (618) 473-2302 or visit our website at oakdaleeggstravaganza.weebly.com Lic. #040.000641 Lic. #040.000410 Lic. #040.000704 About Craft Spaces: MaryAnn (618) 329-5717 Page 22 County Journal March 10, 2016
STEELEVILLE Sparta Lincoln 8th Grade Trip Purses for a Purpose FLUSHING HYDRANTS BRUNCH The Village of Steeleville will be flushing hydrants Monday, Tuesday Saturday, March 12 Saturday, March 19 and Wednesday, March 14-16 Doors Open 5:30pm • Trivia 6:30pm • Sparta VFW 9:00am 50/50 ~ Heads Or Tails For Cardinal Tickets & Yeti Cooler Davis McCann Center, Murphysboro Residents may experience low water Handbag Auction Silent Auction ~ Raffles ~ Lots Of Fun! Brunch Admission pressure during the flushing. It is suggested Reserve Your Table By Emailing $10/Person (8-10/Table) $15 Plus Gently Used Or New Handbag that residents not wash whites on those [email protected] Snacks Welcome/Beverages Must Be Purchased Or Table of 8-$100, Table of 6-$75 PLUS Handbags days as they may become discolored. Event to support 8th grade students visiting Washington, D.C. this June. For Tickets Or More Info Charlotte Goetz, Trico - 618-426-1111, Rasheeda Love, Elverado 618-568-1104 Sponsored by Trico & Elverado FCCLA All proceeds will be donated to Illinois Foundation For FCCLA Spring Fling Easter Egg Hunt Aerie Sparta Eagles 3059 112 E. MAIN • SPARTA • 443-4011 Friday Saturday Saturday, March 19 4-7pm MarchMarchMarch 181818 &&& 191919 7am-2pm March 18 & 19 Cohen Recreation Complex St. Peter’s Lutheran Church Chester ST. PATRICK’S PARTY 900 Church St. • Evansville • Just Off Rte. 3 10am - 1pm Saturday For More Information Call 618-528-2395 Tattooing Games March 12 Sponsored By Starts 7pm BV Bank Inflatable Fun TRICO TRAP TEAM Including 18’ Inflatable Corned Beef Benefit Slide, Bounce House & And Cabbage! Jump ‘n Slide Free, While It Lasts BB GUN Easter Egg Music by Hunt Times Bill Kennedy & Luckan SHOOTING For Ages THURSDAY MARCH 10 Infant - 10 Years OPEN MIC NIGHT MATCH 500 Filled Eggs In Each Hunt Bring Your Talent...Play Guitar, Sing, Saturday, March 12 Infant - 2 Years 10:30am Read Poems, Tell Jokes, Etc. 3-5 Years 10:45am MEAT 5:00pm 6-8 Years 11:00am WHEEL Shiloh Hill Tavern 9-10 Years 11:15am For More Info Call Chris Doener 534-6963 UCHTMANN-WELGE FARM EQUIPMENT PUBLICPUBLICPUBLIC 15TH ANNUAL NOTICENOTICENOTICE FARM MACHINERY Saturday, March 12 • 9:30am The regular CONSIGNMENT AUCTION 5512 Chester Road, Chester meeting of the Directions: 3/4 Mile South Of Shawneetown Trail Road On Chester Road At The Earl & Lardean Welge Farm Marissa C.U.S.D. SATURDAY, MARCH 12, 2016 David & Sarah Uchtmann #40 Board of Rain or Shine Combine & Tractors: 2004 9560 JD Combine, JD 620F 20’ Education has SALE LOCATION: Hwy. 51 bypass in Perryville, MO. From I-55 at the Perryville exit, Hydra Flex Grain Head Poly Ends, JD 693 Poly Corn Head been rescheduled go north on Hwy. 51 bypass about 1 1/2 miles to sale site. From Hwy. 61, take Hwy. Retro To Fit Combine; Kilbros 20’ Header Carrier; JD 3 Pt. 51 bypass south about 1/2 mile to sale site. Watch for sale markers. Header Carrier; 1990 4755 JD Diesel Tractor MFWD W/Cab, for Monday, 3 Remotes; 1988 4650 JD Diesel Tractor, Dual Remotes; March 14, 2016, TRACTORS 1974 4230 JD Diesel Tractor; 310 (756) Diesel Engine; 1961 6300 John Deere tractor, 4 wheel drive, cab, air, 4 new tires, dual remotes, power quad trans, 404 Farmall Gas Tractor; 1959 35 Ferguson Special (Red) beginning at 7:00 7,200 hours, 1994 model; 4840 John Deere tractor w/ 6,636 hours, powershift trans, 18.4-42” Gas Tractor rubber w/ duals (rubber only 10-15%), 3,000# rear wheel weights, 3 hyd outlets; 2840 John Grain Cart, Trucks & Wagons: UFT 700 Bu. Grain Cart W/ P.M. The Shur-Lok Roll Over Tarp; 1983 8000 Ford Diesel Tandem meeting will be Deere tractor, open station; IHC 504 diesel tractor w/ wide front; IHC 826 tractor w/ German Truck; 1979 800 Ford Gas Tandem Truck; 1974 F-600 Ford diesel motor, about 1,100 hours on overhaul, 595 Allied loader w/ 6’ bucket & bale spear, new Gas Grain Truck; 1972 600 Ford Gas Grain Truck; 150 Bu. held in the TA & clutch, tires about 90%; 4020 John Deere diesel tractor, looks & runs good; 3020 John Kilbros Gravity Wagon; 200 Bu. & 150 Bu. Gravity Wagon; Superintendent’s Deere, gas, nice original tractor; IHC M Farmall w/ new clutch & radiator, avg paint, metal 7’x14’ Hay Wagon W/20” Sides On JD Gear & tires; Allis Chalmers WD45 tractor w/ loader; John Deere B tractor, 1943 model, in very Planters, Drill & Equipment: Kinze 3600 12-30” Row Planter; Office, located at good condition, w/new tires; IHC Cub tractor, good rear rubber & metal, w/ 42” Woods belly Kinze 3600 12-23 15 Row Planter, No-Till Drill; 10”x61’ Wheat 1 East Marissa mower, 1948 model; 4010 John Deere diesel tractor w/wide front, 48 loader, in good condition Heart Grain Auger W/Swing-Away 8”x56’ Kewanee Transport Auger; 10”x61’ Mayrath Auger W/Swing-Away; HX 20 JD 20’ St., Marissa, COMBINE – HAY & FIELD EQUIPMENT Batwing Spinner Mower; 1000 PTO 3 Pt. Ditcher; 6630 Sunflower Illinois. 6620 John Deere combine w/diesel motor, hydrostat trans, 3,284 hours, comes w/ 444 4-row 27’ Saber Blade Vertical Till Disk, RH 45040 3 Pt. Lely Roterra; corn head, 543 low-tin 4-row corn head & 216 flex head grain platform w/ header trailer, 24.5- 12’ 3 Pt. Wak-A-Trak; 16’ Bin Sweep; 5’ 3 Pt. Spinner Mower; 3” rubber; Great Plains TC 5315 18’ Turbo Chisel w/paddle levelers, 23” blades, walking 2-12” 3 Pt. Plow; Caldwell 8’ 3 Pt. Blade; Craftsman 6 Spd. 42” tandems, 2015 model, only used on about 400 acres; Frontier WR1010 hay rake w/kicker Cut Riding Mower; 20.5 Turbo Twin Cylinder wheel, like new condition; JD 1219 mower conditioner, in very good condition; Hesston Earl (Sonnie) & Lardean Welge model 5500 round baler; Woods 3180 15’ brush hog w/airplane tires, in good condition, small Combine, Heads, Tractors & Truck: 1981 4420 JD Diesel 1,000 rpm PTO; Frontier 1010 wheel rake, like brand new; IHC 2306 8’ disk mower, in very Combine, 213 JD 13’ Grain Platform; 444 JD 4-Row Side Corn good condition; 430 IHC small square baler, in very good condition New Holland 472 7’ Head; 3 Pt. Hitch Header Mower; 1979 2840 JD Diesel Tractor; Friday, hay bind; BR760 New Holland round baler, in very good condition, 4’x6’ bale; 535 JD net 966 2510 JD Gas Tractor; 1979 C60 Chevrolet Grain Truck wrap round baler, in good condition, 5’x6’ bale; Hardi 800 gallon, 2 axle pull-type sprayer w/ Equipment: Landoll 3 Pt. 7-Shank Chisel Plow; JD Semi Mt. 4- 60’ booms & foam markers 6000 JD sprayer w/cab, fenders, shock absorber front end, w/ 60’ 14” Plow; JD 3 Pt. 3-14” Plow; JD 630 12’ Wheel Disk W/Harrow: March 11 8:00pm - 12:00am booms; Rossi 12 x 3 hay rake, in very good condition; 702 JD side delivery rake w/front dolly Brillon 12’ Mulcher; JD 7000 4-38” Heavy Duty No-Till Planter wheel; Vermeer 505 Super I 5x5 bale, 1 owner, in very good condition, 1995 model; Kinze W/Fert.; JD 8300 Grain Drill; Flickin 300 Bu. Gravity Wagon On MUSIC BY: 8 Lug 1075 JD Gear; JD #68 175 Bu. Auger Wagon; 7’x14’ 2000 4-row planter, 36” row w/ bean cups, 1 owner, low acreage, in very good condition; Frame Wagon; 8’ 3 Pt. Heavy Duty Blade; JD 4-Row 3 Pt. CHRIS Hiniker 1120, 20’ fold-up field cultivator w/ harrow; 490 IHC 20’ hydraulic fold disk w/good Cultivator; JD 350 9’ 3 Pt. Bar Mower; Ferguson 3 Pt. 2-Row bearings & blades; 2415 Bush Hog brand 15’ fold-up brush hog w/540 PTO, in good condition; Cultivator; 3 Pt. Box; 6” 42’ Speedster Auger; 4” 16’ Utility 7’ bush hog w/ 3 pt hitch; 8’ drag disk Ford 7’ sickle mower w/3 pt hitch, belt driven; 7000 Auger; 4 Hyd. Cylinders, 1 JD Black 1 JD Green; Clipper Fan JD 4 row planter w/dry fertilizer & finger pickup 8’ x 24’ JD flatbed hay wagon; 14’ Mill; Concrete Mixer MURRY homemade bumper hitch flatbed; 12’ wagon w/ hoist; Owatona 83 grinder mixer w/swing-out Boat, Collectibles, Tools & Misc.: 2 JD Tractor Umbrellas (1 hopper, used recently; Hutchison 8” x 50” grain auger; 8300 JD 18 hole 8” spacing, double New); 2 Block & Tackles; 12’ Jon Boat; Klondike Chairs; 4- disk offset disk w/ rubber press wheels; 2- Gehl silage wagons; 4600 IHC 25’ field cultivator; Wheel Cart; Forney Mod. C-6BT Welder; Tools & Wrenches; DUO Ford 2 bottom plow w/3 pt hitch; 5’ spring tooth harrow; John Deere 940 S-Tine Cultivator, License Plates; Torch Hoses & Gauges; Cable Come-Along; Log Chains; 55-Gal. Barrels; Double Dog Box For Pickup; 25' Wing fold; John Deere 235 Disk 23' Wing fold; Stoltzfus 5 bale portable round bale feeder Lumber & More (BRAND NEW); A & L 500 bushel grain cart w/ side auger; Case International 1300 sickle mower, 3 pt hitch, 7’; New Idea disk mower; JD 7000 3 row, 3 pt hitch food plot planter OWNERS: David & Sarah Uchtmann 6902 Chester Road, Sparta • 618-443-2772 990 International mower conditioner, in very good condition Earl & Lardean Welge WINDMILL - BUGGYS – VEHICLES - LIVESTOCK - MISC. 5512 Chester Road, Chester • 618-353-7528 Aermotor windmill w/30’ tower & 8’ fan, complete, in excellent condition; 1977 GMC 2 ton Auctioneer’s Note: Not Much Wagon Items. Please Be On Time. Hope To See truck w/366 motor, 5 & 2 transmission, 16’ bed & hoist, like new rubber; Amish made buggy You There – Col. Dale w/rubber tires, in very good condition; Buggy, in good condition; NEW* JD 6’ quick-tach Terms: Cash Or Good Check W/Proper ID ~ Lunch Stand loader bucket, bucket only; My-D-Han-D cake feeder, 1 1/2 ton, brand new/never used; Cattle Website: head gates; Schwartz wide front end that will fit 3010/3020/4010/4020; 1994 Ford F-100 2wd, Burmester www.burmesterauction.com Shiloh Hill 100,xxx+ miles, NO TITLE; 14’ fishing boat w/ inboard/outboard motor; 1975 Dodge Auction Service Red Bud • (618) 282-3931 motorhome, sleeps 4, w/460 engine, automatic trans, new radiator & generator; 10’ x 6’ 2-axle AUCTIONEERS: Col. Dale A. Burmester Lic. #440000613 Tavern, Inc. bumper hitch trailer w/hoist; Portable livestock chute w/head gate; 200 gallon fuel tank; Table Col. Kent Miller Lic. #441000575 saw (NEW); Chop saw (NEW); 250 gallon gas tank w/pump; 2- 2 wheel lawn trailers; Cub Cadet riding mower, 48” cut; 2- 4’ box fans; Pair of Oliver 1600 rear wheels & tires; NEW oak lumber; Stainless steel upright cooler; Hand tools; 8 wheel V lawn rake; Wire cages; Chain hoist; Electric motors; Paddle boat; Chainsaws; 2- truck tool boxes (1- NEW); NEW: black BENEFIT For drain tile 2- rolls 24” dual wall, 20’ long; NEW: black drain tile: 2- rolls 10” dual wall, 20’ long; NEW: black drain tile 44” dual wall, 20’ long; NEW: black drain tile: 8- rolls 6”, 100’ long; NEW: black drain tile 12- rolls 4”, 100’ long; 6- mineral feeders; 3- wooden 15’ bunk Gaven Simpson-Goddard feeders; 10’ wooden bunk feeder; 6- Old Scratch cattle oilers; Various new & used gates, panels & posts; 2- 3 pt hitch post hole diggers; 1983 Ford 2 ton truck w/cheater axle, Midwest bed & hoist, 5&2, in good condition; Cedar post; 2- John Deere FTX 38 riding lawn mowers; Saturday, March 12 EZ Trail 8 ton wagon running gears 1:00pm - 12:30am GUNS Winchester model 12, 12 gauge pump; Winchester model 12, 20 gauge pump; Winchester Evansville American Legion model 37 Red Letter 12 gauge pump; emington model 11, 12 gauge, automatic; there will be more guns by sale date
NOT RESPONSIBLE FOR ACCIDENTS - TERMS: CASH OR APPROVED CHECK Chicken Dinner LUNCH PROVIDED BY PERRYVILLE FFA $8 Adult • $6 Child 1pm - ? AUCTIONEER’S NOTE: Consigned items may be delivered to the auction site starting on March 5 . We will accept deliveries up through Thursday, March 10. Silent Auction, Bake Sale & 50/50 NO CONSIGNMENTS WILL BE ACCEPTED ALL START 1PM FRIDAY OR SATURDAY, MARCH 11 & 12. Raffle Tickets Available For Live Music By We will post additions/changes frequently to our website. Announcements made day of sale take precedence over printed material. Manche Auction Service is not responsible for BARREL OF BOOZE any errors, omissions or no shows. The auction may sell in 2 rings at times if necessary. SCATTERGUN JACK $1 Each Or 6 For $5 SALE CONDUCTED BY: 8:30pm-12:30am Silent Auction & Raffle End At 7pm $5 / Person, $8 Couple 50/50 Drawing 10pm MANCHE AUCTION SERVICE On January 14, Gaven and his mother, Jamie, were involved in a car COL. RODNEY MANCHE (573) 547-1818 or (573) 513-1212 accident that required Gaven to have emergency brain surgery. All proceeds SINCE 1982 - “LET OUR EXPERIENCE SELL YOUR NEXT AUCTION!!!” go to the family for expenses incurred following the accident. VISIT US ONLINE AT: www.mancheauctionservice.com March 10, 2016 County Journal Page 23
Sparta High School Presents While The Lights Discover the health benefits to Were Out karaoke and singing in general March 18-20 After a long a stressful Fri./Sat. 7:30pm work week, one way to rest and recharge is to Sun. 2:00pm head out with friends to SPARTA COMMUNITY Directed By: the nearest karaoke bar. Britney Mayo Whether a person PLAYHOUSE chooses to grab the mi- crophone or just sit back and listen, participating --- HOURS --- in this amateur talent Open Wednesday 4-9 showcase can be an en- Open Wednesday 4-9 tertaining way to spend Friday & Saturday 4-10 an evening. Karaoke traces its ori- Wednesday Specials Smoked Meat gins to Japan. The word $ 50 $ “karaoke” is a combina- 50¢ Wings • 1 Tacos • 1 Beer On Saturdays tion of “kara,” meaning “empty,” and “oke,” Crazy Joe’s Fish House Bar & Grill short for “orchestra.” The concept is simple: A FOR DIRECTIONS Ava • 763-4417 OR 559-7226 person fills in the empty OR INFO CALL vocals to an accompany- ing musical track. While karaoke became especially popular as a Singing can be a healthy, enjoyable pastime. Saturday, March 12 gimmick in the 1970s, it really took off in the According to Chorus released while singing. leases endorphins and 1980s. Although America, a national or- ● Singing can be a so- is usually done in a so- karaoke can still be en- ganization to develop cial activity, which helps cial setting. In some joyed in public venues, and promote profes- people feel part of a group studies, singers were it has expanded to in- sional, volunteer and and part of a larger pur- found to have lower lev- clude digital apps that youth choruses, 32.5 pose. Those who nor- els of cortisol, indicat- allow people from all million adults sing in mally feel isolated can ing lower stress. around the world to choirs. That’s an in- use karaoke or other ● Learning to sing has share their songs and crease of nearly 10 mil- forms of singing as a way mental benefits as well even perform duets with lion singers over the last to meet new people. and could help to im- others, all from the com- six years. Here’s a look ● Singing can have prove cognition. Learn- Live Music By... forts of home. at some of the reasons to physical benefits, too. ing to sing songs from Although fun is a ma- belt out a tune. Singing is an aerobic beginning to end im- BREACH OF PEACE jor draw for many ● Singing can both be exercise that can work proves reading skills karaoke singers, kara- a tranquilizer and a way major muscle groups in and motor skills by de- 8:30pm - 12:30am oke is more than fun. to elevate the spirits. the upper body. Singing veloping the coordina- No Cover Charge • Open To The Public The benefits of singing Studies reveal that en- also increases oxygen- tion between the brain are just as prevalent dorphins associated ation in the blood. and body. Saturday, March 26 whether singers sing with feelings of pleasure ● Thanks to its psycho- The next time you want Jaycees Bunny Hop Benefit For Barb Heck their own songs or may be released when logical and physical to try your hand at someone else’s. singing. Oxytocin, benefits, singing may karaoke, consider its The benefits of singing which can reduce feel- help prolong one’s life. potential impact on your Steeleville Eagles no doubt contribute to ings of depression and Singing exercises the overall health and grab its rise in popularity. loneliness, also may be lungs and heart, re- the nearest microphone. 201 W. Broadway • Steeleville Prom Benefit For pointers Chester Senior Center and FriedFriedFried ChickenChickenChicken DinnerDinnerDinner BuffetBuffetBuffet safety W/Dessert tips Sunday,Sunday, MarchMarch 1313 Sunday,Sunday, MarchMarch 1313 For high school stu- 11am11am -- 1:30pm1:30pm dents, excitement is in the air come the end of Knights Of Columbus the school year. While 209 Church St. • Chester graduation might be $10 Per Person just over the horizon, prom is foremost on the Carry-Outs Children Available $5 Ages 6-9 minds of many students. Under 6 - FREE Many schools cel- Parental involvement is key to keeping prom night safe and secure. Proceeds to benefit the Chester ebrate prom with a Senior Center Meals on Wheels dance and dinner on ground rules. Too often ing while intoxicated. vision. The prom and af- and transportation fund. Help the campus or at a rented parents contribute to But studies have shown ter-parties should be su- center continue to serve the home venue. Prom is a chance poor prom decisions, these tactics do not have pervised by responsible bound senior citizens in Chester for students to socialize such as setting the tone long-term benefits. adults. Although it may and the surrounding area. and reminisce before for the night with toasts The U.S. Department of not eliminate all oppor- graduating from high or encouraging poten- Health and Human Ser- tunities for risky behav- school. tially dangerous behav- vices’ National Insti- ior, adequate supervi- Prom can be a celebra- ior by organizing hotel tutes of Health found sion will serve as a de- tion of past friendships stays or large parties. that programs relying terrent. and a way to make new Parents should have a on scare tactics to pre- ● Encourage students memories, but it should detailed itinerary of vent children and ado- to think before acting. be remembered for all of their children’s prom lescents from engaging Many students view the right reasons. By night plans, including in certain behaviors are prom as a deadline for playing it safe, prom can schedules, who will be not only ineffective, but certain perceived rites be an experience stu- accompanying kids to also may have adverse of passage. They may effects. dents cherish for the the prom and any post- believe prom is the time Rockin rest of their lives. Both Being open and honest Come Have A Sham Time! prom activities. Request to drink or try drugs for students and parents check-in calls or text with students and treat- the first time or to go can take steps to ensure messages, and set a cur- ing them like adults SATURDAY, MARCH 12 further intimately with a prom night is as safe as few. may be a more effective Kitchen Open 4pm - 7pm Featuring boyfriend or girlfriend. it is fun. ● Avoid scare tactics. way to get through to CORNED BEEF & CABBAGE Parents should encour- AND RUBEN SANDWICHES ● Be an involved par- In the weeks leading up them. Let them know ent. Involved parenting to prom, school districts you are available at all age kids to think before Mary’s river Band is the best way to make and police departments hours if they do not feel acting, letting them Starts At 7pm prom night safe. Parents often stage mock auto- comfortable in a situa- know that prom is not a should take an active mobile crashes to illus- tion or need a ride night to throw caution KILLIAN’S & BLUEMOON roll in understanding trate the dangers of dis- home. to the wind and experi- -- ON TAP -- prom plans and set tracted driving or driv- ● Provide adult super- ment. $1 PUDDING SHOTS Free Beads Fun facts regarding St. Patrick's Day COME PLAY VIDEO POKER & SLOTS Each March 17th, a million spectators drals named for St. people the world over each year. Patrick in Ireland. One Kaskaskia VFW slip into something 3. Thirteen million of the most famous is St. - Post 3553 - green, take in a neigh- pints of Guinness are Thirteen Patrick's Cathedral in 939 State St • CHESTER • 826-3411 borhood parade and en- consumed on St. Dublin. joy St. Patrick's Day fes- Patrick's Day. That's million pints 11. Each year, mem- tivities. A day to honor double the amount con- bers of the Shamrock Ireland's patron saint, sumed on other days. of Guinness Club in New London, St. Patrick's Day is ripe 4. Although many Wisconsin, change with traditions and his- people wear some form are highway signs so the tory, much of which is of green in honor of St. town name reads New ST. PATRICK’S largely unknown to the Patrick's Day, green was consumed Dublin. celebrating masses. once considered an un- 12. St. Patrick's Day is PARTY In honor of St. lucky color in Ireland. on a national holiday in the Saturday Patrick's Day, the follow- 5. The city of Chicago Caribbean nation of MARCH 12 ing are some handy really gets into the fes- St. Patrick's Montserrat. pieces of trivia to im- tivities, going so far as 13. Some lore regard- Food And Drink Specials press friends and family to dye the Chicago River Day ing St. Patrick says he each day of March lead- green, which the city raised people from the GET LUCKY! ing up to the big day. has been doing since dead. 1. St. Patrick was not 1962. 8. St. Patrick was not 14. Soda bread is a va- Video Poker & Slots Irish. He was born in 6. Evidence suggests the first person to bring riety of quick breads Britain to an aristocratic there never were any Christianity to Ireland, where baking soda, and Players Card DOUBLE PUNCH All Day family. His early life was actual snakes for St. as monasteries had not yeast, is used as the not particularly reli- Patrick to drive out of been built long before leavening agent. Entertainment After 9pm gious, but he had a reli- Ireland. It stands to rea- St. Patrick's arrival. 15. Three-hundred spe- Bar • Billiards • Food • Gaming gious conversion in his son snakes were a meta- 9. In Ireland, St. cies of plants are consid- teenage years. phor for the evil of pa- Patrick's Day has tradi- ered clover. orner 110 S. Randolph St. 2. The largest St. ganism. tionally been a religious 16. Blue was the origi- Coulterville Patrick's Day Parade is 7. There are roughly 33 occasion. Until the nal color associated C 618-758-3141 not held in Ireland. That million U.S. residents of 1970s, many stores and with St. Patrick. afe honor belongs to New Irish ancestry. That pubs were closed. Laws 17. The city of Bar & Gaming Open ‘Til 1am York City, where the an- number is nearly 9 were changed in 1995. Montreal, Canada, uses nual St. Patrick's Day times the population of 10. There are about 60 a shamrock in its city COpen Daily 11am-1am • Kitchen Open 11am-9pm Parade draws more than Ireland. churches and cathe- flag. Page 24 County Journal March 10, 2016 Sewing class at Sparta library
The Sparta library re- Hannah Stine, Nora cently offered a two-day Kloos, Alice and Clara sewing program for Odom, Daira Sang- girls who had previ- urima, Laya Kampfl and ously attended one of Emily Howell. the other sewing camps The girls made person- at the library. alized tote bags and Girls attending were pocket pouches.
Contest winners for Black History Month are, from left, Me’Yaurra Rowell, first; Savannah Delgado, second; David Cedillo, second and Bethany Huhman, third. IMPACK director Geanette Wilson is seen in the background. IMPACK names contest winners Essays were written on Black History Month Marissa FFA breakfast For the sixth straight says on African Ameri- Judy Bennett and Jalyn Penny presented A huge crowd came out to enjoy the pancakes year, Sparta IMPACK can history. Audrey Tillman were the origin of black his- and sausage at the Marissa FFA pancake sponsored the Celebrat- Nine finalists were se- two of four judges. High tory. breakfast March 5. Shown are Matt Espenschied, ing Black History stu- lected to give an oral school students Tyler IMPACK workers in- a coach and PE teacher at Marissa Elementary dent contest at Sparta presentation. Awards Figueroa, Jalyn Penny cluded photographer School, and his 2-year-old son Dallon. Photo by Lincoln. were then given, includ- and Rachel Wilson Lynette Jalivay, pro- Carol Mercer Superintendent Larry ing $50 for first place, judged K-5 artwork. gram editor Bevey Beattie, Lincoln Princi- $25 for second and $15 Cathy Oliver was coor- Louden, greeter Carly pal Amy Price and Lin- for third. dinator for K-5 partici- Townsend and Luvenia coln teachers encour- Me’Yaurra Rowell took pation. Beverly Holmes Nance, Michele Walker aged students to take home first place, Savan- was guest speaker, and and Ron Penny, who DECORATIVE & ROAD ROCK part in the contest, nah Delgado and David Vanessa Ward sang were in charge of re- which was open to sixth Cedillo shared second, “Who You Are.” Sha- freshments. Just through eighth-grade and Bethany Huhman niece Penny was mis- IMPACK director is Spring Mulch students who wrote es- was third. tress of ceremonies. Geanette Wilson. Arrived! Red-Dyed • Cedar Rep. Costello Hardwood meets with Quality Service & FFA State Represent- Prompt Delivery! ative Jerry Costello Call For Appointment, 965-9050 II met with local FFA groups March Tailgate Spread 1 as a part of Illin- ois Agricultural Legislative Day in STEELEVILLE Springfield. Shown is Costello with STONE, INC. Marissa FFA stu- dents at the capitol Terry & Misty Conway, Owners/Operators building. 965-9050
White Frost, Leather Pkg., Stk. #413960 MSRP ...... 46,970.00 16% Discount...... 7,515.00 *
Ruby Red, Convenience Pkg., Stk. #426423 MSRP ...... 27,980.00 16% Discount...... 4,477.00
*
NEWNEWNEW NEWNEWNEW Crew Cab, SLE, Factory Program - 3 To Choose Z-71 *
ON REMAINING INVENTORY SVANDASVANDASVANDA CHEVROLET • BUICK • GMC
“Your Dollar Goes Further At Stearns Furniture” STEARNS * Price does not includes tax, title, license or doc fees. All offers end 3/31/16. Vehicle selection may change. FURNITURE CO. On stock vehicles only while vehicle selection lasts. All discounts based on 16% off MSRP. 155 Stevenson Dr. • Sparta • (618) 443-3494 1200 NORTH MARKET • SPARTA • 443-2111 Located Behind Pizza Hut *Financing Offers To Qualified Buyers With Approved Credit. See Store For Details. www.svandachevy.com March 10, 2016 County Journal Page 25
By Dan Zobel Trico softball has state aspirations All-conference Softball preview basketball Girls Basketball SIRR Mississippi capsules Pinckneyville’s Sophie Keith and Sparta’s Kera Kiner were recently selected to the SIRR Mississippi all-conference girls basketball By Dan Zobel team. The majority of area This was Keith’s second straight selection to softball teams will start to the team. take the field for game ac- Keith, a senior, finished her career for the tion late next week. Lady Panthers as the career record holder in When the Trico Lady rebounds in the program, corralling a total of Pioneers make that step 875, which is 202 more than the previous onto the diamond, it will record. This season, she averaged 10 per game. be with one goal in mind— Kiner, a junior, averaged a double-double for returning to Class 1A state the Lady Bulldogs, scoring over 15 points and tournament, where Trico grabbing 10 rebounds per game. She also led placed second in 2014. the team in blocks. “I think they definitely Other players named to the squad were Karly all want to go back,” said Stanowski, Mackenzie McFeron and Paige Trico coach Drew Frank- Kasten of Nashville, Avery English, Megan lin. “Some of these girls Barrett and Madison Meyer of Carterville, Trico coach Drew Franklin helps freshman Katie Gale with her swing were at the state tourna- Tarynn Mays of Du Quoin and Elle Basler of Tuesday during practice. ment, but they weren’t Anna-Jonesboro. apart of it. They left there Black Diamond Conference saying they wanted to go that expectation. We’ll try Two Chester Lady Yellow Jacket basketball back in the next four our best.” players were recently selected to the Black Dia- years. I think that’s been The Lady Pioneers will mond Conference West Division all-conference their goal, and I think again have a young three- second team. that’s what they’re work- headed monster in the Representing the Lady Yellow Jackets are ing for.” pitcher’s circle, led by jun- juniors Kaitlyn Dillow and Alexis McMath, who Last season, the Lady ior Sydney Levan and were key cogs for a young Chester team that Pioneers finished a game sophomore Jade Krana- finished 12-12, the team’s best record since go- away, falling to Wayne wetter. ing 13-13 during the 1998 season. City in extra innings, 3-2, Danyelle Eilers, an- The Lady Yellow Jackets’ conference mark in the Du Quoin Super- other sophomore, will of 5-5 was also its best showing in conference sectional. It was a game also still throw on occa- play since the 1992 campaign. that could have easily sion, according to Frank- First team selections for the BDC West were gone the other way, even lin. Autumn Gunter (MVP) and Maddie Gossett of down to the final out of the “Jade is coming along Christopher, Hannah Garascia and Jaylin Ha- game. very well,” Franklin said. ley of Sesser-Valier and Ashlyn Darnell of “We just couldn’t catch “She has a verbal (com- Goreville. Joining Dillow and McMath on the a break in the super-sec- mitment) to SIU Edwards- second team were Taylor Frank and Karson tional game,” Franklin ville to be a pitcher. We Severs of S-V and Brenni Tripp of Goreville. said. “I thought we hit the just have to fine tune her Boys Basketball ball extremely well, but we skills and work on her Black Diamond Conference just hit it right at people. ability to not be her worst Two Chester Yellow Jackets and one Trico Even Emily’s (Bauersa- enemy inside the circle. Pioneer were recently selected to represent chs) last out, she drove it She’s been getting better their teams on the Black Diamond Conference to center field, and it just at that. Once she masters boys basketball all-conference team. happened to be right at that, it’s lights out for her.” Chester selections were senior Jason the (defender). If it’s 10 Franklin said Levan is Schwartz to the West Division first team and feet to the right or left, also coming along well, junior Jack Weir to the second team. we’re on our way back to improving her control and The duo helped lead the Yellow Jackets to a Peoria.” hitting her spots better. 20-9 mark, including a 8-2 conference record, Trico finished last year “I think they’ve both Trico’s Jade Kranawetter starts her swing good enough for second. It was Chester’s sec- 27-7, including a Black matured, and I think Tuesday during batting practice. ond season of at least 20 wins in the last four Diamond Conference title. they’ll be very good in the years. Peoria remains the num- circle,” Franklin said. don’t think she’ll miss a lin said. “Danyelle re- For Trico, senior Trent Koch was named to ber one goal for Franklin Those three will have to beat. turns, and she’ll be on the the first team. The Pioneers finished 14-17 and and his squad, which has get used to a different bat- “The only thing right infield. She played a lot of 5-5 in conference play. grown into a solid and sus- tery mate this year, now is for her to prove she third base last year. Syd- After defeating Chester in the Class 2A tained program. though, as catcher and is a leader and to gain that ney and Jade played short- Sparta Regional semifinals, Trico was elimi- “I think the girls look leader Jessica Prange respect from the team Jes- stop. (Sophomore) Jaelin nated from the postseason by Pinckneyville in pretty good right now,” graduated. Her sister sica had. She definitely King could take over at the title game. Franklin said. “They Juhle will look to make has all the tools back second base, and fresh- The rest of the West Division first team was worked hard in the offsea- that transition a smooth there that we need.” man Katie Gale will have made up of sophomore Braden Webb of son, getting stronger and one. The other two holes that to play on the infield. Goreville and sophomore Bradley Young, jun- working at their indi- “Juhle Prange will move will need to be filled are “There are three or four ior Kaleb Pedigo and senior Hunter Wheeler, vidual skill level. We kind from right field to behind on the right side of the in- people who could play all of Christopher. of expect to make a little the plate,” Franklin said. field, as second baseman first base. We just have to The second team included junior Brant run in the postseason. “She’s very good defen- Morgan Vogt and first find that right groove to go Glidewell of Goreville, junior Zane Wilson of “You know your pro- sively back there and has baseman Brooke Higger- with.” Sesser-Valier and junior Isaac McPhail of gram is going in the right a very strong arm. I think son also graduated. The outfield will be led Christopher. direction when people put she’ll be the key if she can “We have so many kids by experienced seniors Young was named the most valuable player that expectation on you. become the leader Jessica who can play so many dif- and Schwartz the captain. We just have to live up to was behind the plate. I ferent positions,” Frank- Continued on Page 27 Newman, Hornets eliminate Panthers at home student sections, the either get a high per- Hornets had posses- centage shot or get to Newman sion of the ball coming the free throw line. out of a timeout with 36 “Time was running seconds to play after down, and I came close scores 32 Pinckneyville’s Sam to calling another Simpson missed the timeout, but Jaris got points front end of a one-and- it at the top of the key, one opportunity at the looked and fortunately, free throw line. he was able to lob over By Dan Zobel Nashville bled the the top to Royce. At Royce Newman and clock down to under 10 that point, they pretty the Nashville Hornets seconds before Jaris much had to play us had the last laugh this Dalman lobbed a pass one-on-one, and he season in one of the over Simpson to New- powered it in and areas biggest and most man on the right block. scored.” storied rivalries. “If we help, then they The Panthers quickly Pitted March 2 have an opportunity to called a timeout with against Pinckneyville get to the line because 2.8 seconds remaining. in the semifinals of the they’re going to drive Pinckneyville then Class 2A Pinckneyville the ball, and they’re in made one pass to half Sectional, Newman the bonus,” said Pinck- court before calling racked up 32 points, neyville coach Bob another timeout at the including the go-ahead Waggoner. “The reality 2-second mark. basket with under five of it is, they made a per- With Clayton Hough- seconds left, and Nash- fect pass over our 6’5 land taking the ball out ville took down the player to get him the of bounds, Nashville’s Panthers, 47-45, in ball. If (the pass is) one defense covered the what could be de- inch lower or three ensuing play well, forc- Nashville’s Royce Newman lets the game-winning shot out of his hands scribed as an instant inches higher, it goes ing Houghland to pass March 2 as Pinckneyville’s Sam Simpson attempts to defend him. classic. out of bounds. into the back court be- “I thought we played “We’re not going to fore getting called on a lot of things correctly under three minutes but it just leaves a sour with great intensity give them lay-ups. five-second call. The tonight. There were to remaining, when J.C. taste in your mouth to from start to finish,” They’re a great back Panthers were then un- many silly turnovers Moll stripped Newman think you should still said Nashville coach door cutting team. able to get a shot off and not enough shot in the post and was in- be playing.” Brad Weathers. “Pinck- That’s how they live. before the buzzer attempts.” tentionally fouled Pinckneyville looked neyville is an awfully We’re going to make sounded. One of those turn- when he went up for a like it was going to dis- good ball club, and them make a play. “We didn’t have any overs came about a layup on the other end tance itself from Nash- they keep coming at They just beat us.” timeouts left, but we minute before of the floor. ville in the third quar- you with their team The 6’7 Newman ran a play we always Newman’s game-win- Moll split the inten- ter when Houghland speed and defense. hauled in the Dalman run,” Waggoner said. ning bucket, when tional foul free throws. scored back-to-back “I thought there were feed and finished “The kids didn’t ex- Pinckneyville was The Panthers were buckets in the lane to two or three times we strong at the rim, giv- ecute the play prop- called for over-and- then awarded the ball, give the Panthers a 32- could have folded, but ing the Hornets the 47- erly. That’s how you back when a pass got and Houghland scored 24 advantage two min- credit to our kids char- 45 advantage. lose a ball game. They away from the them on a drive from the left utes into the second acter wise; they “I would think every- did great on the play near the top of the key base line, knotting the half. stepped it up and got a body knew what was before and got the ball as the Panthers were contest up at 45. The eight-point lead big basket or turnover going on,” Weathers to half court like we attempting to hold for “Those are just was the largest for ei- every time we needed said about the game- wanted it to try to the last shot in the things you can’t do if ther team all night, but it.” winning play. “The shorten the distance game. you’re going to win,” Pinckneyville saw it With the score tied at main thing was, we and get the shot we Pinckneyville also Waggoner said. “Give dwindle away when the 45 in front of a packed were in the double-bo- wanted. had an opportunity to Nashville credit, they house and two roaring nus, so we wanted to “We didn’t execute a take the lead with just have a nice ball club, Continued on Page 26 Page 26 County Journal March 10, 2016 Bowling St. John Chester boys hoops sixth at Lutheran State standings St. John’s Red Bud Lutheran girls knocked out in two games Steeleville Won Lost The St. John Chester The next day, St. John outscored by an aver- field was third, St. Pe- Forest March 5, falling Monday Early grade school boys bas- battled eventual tour- age of 48.5 to 35. ter Arlington Heights 23-22 in overtime. Crashettes 122 67 ketball team finished in nament champion Andrew Schwarting fourth, East Dundee Immanuel Palatine Mixed Nuts 96 93 U Iron Workers 94 95 sixth place at the Rockford. The Hornets represented St. John’s seventh and St. John’s won the tournament County Journal 93 96 March 4-6 Lutheran lost 78-30, sending on the 15-player all- Lombard eighth. Be- with a 42-20 victory over Reids’ Chickletts 85 104 State Tournament in them to the semifinals tournament team. thany Naperville de- Trinity St. John’s Nash- 1st Natl. Bank 77 112 the Chicago area, while of the fifth-place brack- Schwarting averaged feated Trinity Centralia ville/Immanuel Luth- High Team Game the St. John’s Red Bud et. 16 points per game, sec- in the consolation eran Okawville. Crashettes 894 girls team was elimi- In St. John’s second ond most out of any- championship. Immanuel East Dun- High Team Series nated in two games. game of the day March body in the tourna- Girls Tournament dee earned third, Crashettes 2319 The Hornets were up 5, the team was able to ment. He made 20 two- St. John’s Red Bud Mount Prospect fourth, High Ind. Game Katie Wedemeyer 249 against St. Paul Mount scrape past Immanuel point field goals and six Lutheran lost a pair of Christ Peoria fifth, Trin- High Ind. Series Prospect March 6 in the East Dundee, 48-43, three-point field goals. close games in the girls ity Edwardsville sixth, Katie Wedemeyer 619 fifth-place game, but St. awarding the Hornets The Hornets were Lutheran State Tourna- Our Savior’s Spring- John fell by the score a spot in the fifth-place also given the sports- ment, eliminating the field seventh and Im- Tuesday Early Pistol City 91.5 58.5 of 44-31. contest. manship award. team in quick fashion. manuel Belvidere Glory Bowl 91.5 58.5 The Hornets opened St. John shot 62 per- Rockford won the St. John’s opened eighth. St. Peter Arling- Insurable 78.5 71.5 the tournament March cent from the free tournament with a 54- with a 32-26 loss to St. ton Heights knocked Shiloh Hill 74 76 4 against Yorkville, de- throw line in the tour- 50 victory over Christ Paul Mount Prospect off Zion Belleville in NAPA 74 76 Farm Bureau 71 79 feating the team by two, nament. Peoria. March 4. St. John’s then the consolation cham- Victor’s 69 81 31-29. The Hornets were Our Savior Spring- took on Grace River pionship. Andy’s Auto Body 50.5 99.5
High Team Game NAPA 1344 High Team Series Steeleville hoops NAPA 3901 High Ind. Game Bruce Mathis 279 High Ind. Series split on final day Kyle Hinnerichs 743
Thursday Early utes. Strokerz Saloon 115.5 59.5 In Steeleville’s first Chester Eagles 110.5 64.5 Murphy game of the day, the Pocket Ponders 106 69 Eaton Ins. 105 70 Warriors made it to the Hillside Auto 92 83 consolation champion- 1st Natl. Bank 89 86 sophomore ship game by defeating Mevert’s Auto 86 89 Thompsonville, 39-27. B&B Const. 81 94 Windy Hill Farms 79 96 tourney Eli Wittenborn paced Peace Lutheran 69 106 Steeleville in scoring Pistol City 64.5 110.5 during that game, fin- Broadway Tavern 52.5 122.5 The Steeleville High ishing with eight High Team Game School sophomore points. Mel Mulholland Strokerz Saloon 1349 boys basketball team and Ethan Schatte each High Team Series wrapped up play March chipped in six. Strokerz Saloon 3821 5 at the 39th annual Eight different War- High Ind. Game Larry Moore 267 Murphysboro High riors scored. High Ind. Series School Sophomore Bas- Steeleville led 27-12 Cale Young 758 ketball Tournament at the half and 33-16 af- with a 49-47 loss to ter three quarters. Marion. Other Scores Nashville won the March 3 Turkey tournament, defeating Nashville 54, Pinck- Sesser-Valier in the title neyville 43 game. West Frankfort West Frankfort 46, seasons was third and Herrin Breese Central 43 fourth. For the Hornets, Herrin 49, Hamilton it was the first time they County 40 Youth season were crowned champi- Sesser-Valier 50, Mur- ons since the 2007-08 physboro 46 Two turkey seasons season. March 5 are set to begin right Against the Wildcats, Nashville 48, West around the corner in Kaleb Diercks scored 19 Frankfort 33 Hagel advances the area. points for the Warriors, Sesser-Valier 61, Her- Steeleville’s Nic Hagel The youth turkey sea- including five 3-point- rin 55 will represent the area son will take place ers. Nick Ebers added Marion 47, Du Quoin this weekend at the Class March 26 and 27. Dur- 11 Steeleville points. 42 1A Country Financial ing this season, one Steeleville led 26-20 West Frankfort 52, state three-point shooting gobbler or bearded hen at the half before Mar- Herrin 50 competition in Peoria. counts toward the max- ion took a 37-35 lead Nashville 43, Sesser- Hagel made nine trifectas imum of three spring into the final eight min- Valier 40 March 4 in the Gallatin permits. County Section-al, good The spring shotgun enough to tie for second. or archery turkey sea- Baseball preview The preliminaries of the son will take place state competition will April 4 through May 5. A prep baseball pre- Okawville. begin March 10 at 5 p.m. The season will be view focused on teams At the 2A level, Rock- Above are advancers from divided up into five sea- throughout the area is ford Christian was the the Gallatin County sons. The dates are planned to run in next last team standing, Sectional, from left, John April 4-8, 9-14, 15-20, 21- week’s edition of the defeating Williams- Russell of Cobden, Hagel, 27 and April 28 through County Journal. ville 6-2 in the champi- and Luke Winget and May 5. The preview will fea- onship. Caleb Pedigo of Christo- As during the youth ture team capsules for Highland won the 3A pher. At right, Hagel is season, one gobbler or Chester, Marissa-Coul- tournament over La shown with two of his bearded hen permit terville, Pinckneyville, Grange Park Nazareth youngest fans, Grayson will count toward the Red Bud, Sparta, Steele- Academy, and New Len- and Emerson Mohr, who maximum of three. ville and Trico. ox Providence Catholic made the trip to Gallatin Both seasons will run Last season, Cobden took top honors in 4A, County to watch him from 30 minutes before won the Class 1A title defeating Chicago Mt. shoot. sunrise to 1 p.m. with a 9-3 victory over Carmel.
Pinckneyville High School boys basketball eliminated...From Page 25______team turned the ball over Still, the Panthers were Nashville within two, 22- on three of its next four never able to get the ball 20, with two minutes left possessions. into the open floor like in the half before the “We just didn’t ex- they wanted to. Nashville teams traded baskets ecute,” Waggoner said. also held Grant Jausel, down the stretch, leading “We had a silly turnover who scored 29 points in to a 28-24 Panther advan- and took a quick shot one the Pinckneyville blow- tage at the break. time. I feel we didn’t do out win over the Hornets Bultman added 10 enough executing offen- February 13, to just four Nashville points. New- sively and playing sound points. man collected five re- basketball.” “The difference tonight bounds. The Hornets The Hornets used those was pace of play,” were 12-of-19 on free Panther miscues to fin- Waggoner said. “We had throws. ish the quarter on an 11-5 a chance there where we Houghland finished run, getting seven points were extending it and get- with 20 Pinckneyville from Newman, including ting the ball up and down, points on 8-of-14 shoot- a baby right hook and a but in the second half, we ing. Simpson chipped in conventional three-point didn’t play with enough 10 points, all in the first play, and four from Brady pace. Our guard play half. The Panthers shot Bultman. wasn’t good enough to 18-of-37 from the floor, in- “I thought we got a push the ball. (Nashville) cluding 5-of-16 from 3- couple of key turnovers slowed it down.” point land, and 4-of-7 on there,” Weathers said. The score was tied at 14 free throws. “We were pressuring the after one. Houghland Pinckneyville out-re- passer. I thought Hayden quickly made it 20-16 to bounded Nashville 18-11, Heggemeier caused one open the second, hitting but the Panthers commit- or two of them defen- a pair of trifectas. ted 13 turnovers to the sively. I thought we Newman brought Hornets’ seven. guarded well in the man, considering I think (the Panthers) are quicker than us on most spots on Pinckneyville’s Clayton Houghland slashes to the basket late in the the floor.” game March 4 against Nashville. Houghland scored on this drive, tying Pinckneyville’s saving the game at 45. grace came on a Hough- land 3-ball from the top of the game and scored 18 said. “Really, if you give shooting from the field, the key during the stretch of his points in the first up 47 points, you should including a 1-of-6 perfor- and a Hayden Carter put- half. He finished 12-of-18 have an opportunity to mance from behind the $$$ back with two seconds left from the field and 8-of-13 win. We took the 3-pointer arc. in the quarter, leaving the at the charity stripe. away, which was the The Panthers grabbed 70 REBATEREBATEREBATE ® Panthers ahead, 37-35. Newman’s complete game plan. Looking at an 11-9 with 2:02 remain- On 4 New Michelin Tires At the beginning of the domination of the lane is their percentages, we ing in the first quarter game, Newman estab- something Waggoner did weren’t going to let them when Simpson scored on lished himself from the not worry about. Instead, get 3s. We were going to a stick-back. get-go, scoring 10 of the it was part of the game let (Newman) get what he The game became tied Hornets’ 14 first-quarter plan. gets.” seven more times after Best Price Around On Michelin Tires! points. “We let Newman get In essence, that strat- that, but Pinckneyville The University of Mis- what he was going to get, egy worked, as Pinckney- never surrendered the www.MevertAuto.com/Michelin-Tire-Sale See redemption form at Mevert Automotive & Tire for complete offer sissippi recruit made his but we held the rest of the ville held the rest of the lead until the 5:21 mark details. Offer expires 04/10/16. Void where prohibited. first six shot attempts in guys down,” Waggoner Nashville team to 5-of-15 of the fourth quarter. March 10, 2016 County Journal Page 27 Local athletes participated at large SIU Indoor Track Meet Local prep athletes par- Stefani (38.61), RB, 57th. 4x200 Relay Maddie Hoffman (32’6), 800 meter 60-meter hurdles ticipated in the SIU High 400 meter Chester (1:56.83), 9th; CH, 16th; Hannah Dustin Lohman Vincent Gonzalez School Indoor Track and Jessica Kattenbraker Red Bud (2:10.96), 19th. Schweizer (27’1), CH, 30th; (2:22.19), SP, 37th; Garrett (10.34), RB, 30th; Eric Field Invitational last (1:06.9), CH, 12th. 4x400 Relay Katelyn Rader (26’3), CH, Johnson (2:24.09), PV, Prange (11.96), RB, 38th. weekend. 800 meter Chester (4:35.38), 8th; 31st; Stefani (21’9), RB, 39th; Grant Batteau 4x200 relay The girls meet was Taylor Dunning Sparta (5:04.11), 18th; Red 43rd; Neumeyer (16’9), RB, (2:26.04), PV, 43rd; Seth Sparta (1:44), 15th; Red March 4 and the boys (2:43.13), CH, 12th; Ashley Bud (5:04.87), 21st. 50th. Becker (2:27.34), SP, 44th; Bud (1:48.39), 21st. March 5. Brenning (2:50.12), SP, 4x800 Relay Local Boys Results Alex Lohlenberger 4x400 relay Local Girls Results 20th; Shawna Smith Sparta (11:54.37), 10th There were 41 schools (2:28.35), RB, 48th; Garrett Sparta (3:49.87), 13th; There were 33 schools (2:51.47), SP, 27th; Brooke 60-meter hurdles who brought athletes. Headen (2:29.03), RB, 50th. Red Bud (4:06.76), 22nd. who brought competitors. Supancic (2:55.74), RB, Morgan Atchison (9.79), 60-meter dash 1600 meter 4x800 relay 60-meter dash 31st; Carly Carril (3:06.43), CH, 9th; Molly Jokerst Caleb Logan (7.3), Pinck- Paul Mueller (5:16.9), Sparta (9:35.23), 17th; Daisha Dunn (8.59), SP, 49th; Heather Junge (11.91), RB, 24th; Becca neyville, 10th; Davion Jor- RB, 34th; Johnson Red Bud (9:51.82), 23rd. Sparta, 21st; Nicole (3:08.57), RB, 51st; Sarah Chausse (12.16), RB, 25th; dan (7.57), SP, 27th. (5:28.55), PV, 48th; Chase Long jump Chastain (8.97), Red Bud, Hecht (3:23.95), CH, 56th; Jett Kennedy (12.79), RB, 200 meter Headen (5:23.03), RB, 43rd; Austin DeRousse 35th; Alli Kennon (9.37), Emma Neumeyer 28th. Logan (24.17), PV, 9th; Trevor Buckner (5:30.35), (18’7.5), RB, 23rd; Chester, 43rd; Emma (3:44.47), RB, 58th. High jump Ethan Gwinn (26.12), SP, SP, 50th. Gonzalez (18’7), RB, 24th; Salger (9.44), RB, 44th. 1600 meter Brooke Craig (4’8), SP, 32nd; Dustin Rednour 3200 meter Jordan (18’4), SP 31st; Will 200 meter Keri Burmester 6th; Kaitlyn Hoffman (4’4), (26.97), RB, 39th. Alex Becker (11:13.66), Monroe (17’5.75), SP, 39th. Danielle Dodson (29.88), (5:54.36), RB, 13th; Dun- CH, 23rd. 400 meter RB, 15th; Batteau Triple jump SP, 22nd; Chastain (30.02), ning (5:59.43), CH, 16th; Long jump Micah Bradshaw (56.5), (11:16.77), PV, 16th; Alyze Nesbit (39’0), SP, RB, 24th; Dunn (30.74), SP, Carril (6:54.85), SP, 41st. Kaleigh Brown (13’0), SP, 20th; Rednour Hunter Fedderke 12th; Gonzalez (35’4.25), 31st; Kaylah Hasemeyer 3200 meter SP, 29th; Kennedy (12’2), (1:00.67), RB, 42nd; Parker (11:25.66), ST, 18th; Buck- RB, 18th; Dakota Zeiger (31.73), CH, 35th; Salger Burmester (12:15.73), RB, 34th; Amari Gunn Sondag (1:01.68), STE, ner (11:31.81), SP, 19th; (34’2), RB, 23rd. (32.3), RB, 38th; Kennon RB, 4th; Brenning (12’0.5), SP, 36th. 45th; Patrick Rohlfing Wyatt DuClos (12:11.2), Shot put (32.75), CH, 40th; Sadie (12:29.47), SP, 6th. Shot put (1:03.04), Steeleville, 50th. RB, 22nd. Monroe (50’10), SP, 4th. High school softball preview team capsules...From Page 25______Makayla Major, with strong pitching, but finals, when the Lady Pan- fense,” Zimmermann said. Bauersachs and Bailey the team will need a solid thers lost 5-0 to eventual “We will be fundamentally Witthoft are expected all-around attack. state champion Nashville. sound on defense, but we cover those spots. “Pitching is always a big Pinckneyville finished are going to have to pro- The aforementioned factor in softball,” Colvis with a record of 24-11. duce runs to win games.” Gale could be a big key, as said. “Besides pitching, I In his third year leading Steeleville Franklin said she could am a firm believer that de- the Lady Panthers, coach (Cahokia) break into the lineup right fense wins you ball games. Alan Engelhardt will bring The Lady Warriors had away. Franklin also sees Offensively, we need to back all-state pitcher/first just one senior graduate good potential in fresh- execute in situations. For baseman senior Brooklyn from last year’s team that man Haylee Wolters. example, we need to get Morrow, who blasted 16 went 14-12 but saw its sea- “(Gale) has a very good the bunt down when we home runs last year. son come to an abrupt halt bat and has a lot of experi- need it and be smart, dis- Sophomores infielder when they could not keep ence,” Franklin said. “She ciplined base runners.” Emma Banach and pace with Trico in the plays a lot of travel ball. I Marissa-Coulterville pitcher/third baseman semifinals of the Class 1A could maybe see her start- (Cahokia) Mariah Clark return as all- Trico Regional, falling 15- ing at second or first base This year’s Lady Mete- conference selections. 6 to the eventual regional and being in the lineup on ors roster has nearly Other key returners will and Goreville Sectional an everyday basis. doubled in size compared be sophomores second champion Lady Pioneers. “(Wolters) lacks some to last year. baseman Kylee Kling and Coach Andy Gerlach, experience and needs to M-C had just 14 players catcher/right fielder Josie entering his fourth year play more, but has a very last year, but with the help Gleason, junior left fielder/ with the club, will have strong arm. I can see her of 10 freshmen, the squad second baseman Mayci the task of replacing being a very solid player has grown to 23. John Doerflein and senior cen- Allanah Renner, who was by the time she’s a junior Childers, in his second ter fielder/catcher Andrea Steeleville’s cleanup hit- and senior.” season as the Lady Me- Morgan. ter a year ago. Overall, Franklin likes teor coach, said this has “We need to continually Working in Gerlach’s fa- what he sees thus far, say- allowed the team to also get better as the season vor will be the fact he has ing he might have an even play a junior varsity sched- progresses,” Engelhardt all-state shortstop sopho- better offense one through ule. said. “We return several more Lexi Middendorf nine in the lineup than M-C has six returning players who played a lot of Steeleville’s Lexi Middendorf fires across the back. Middendorf, one of last year with added power starters from a team that innings for us last year, so diamond from her shortstop position Tuesday eight Lady Warrior sopho- and the ability to get on went 6-17 a year ago, fin- we are no longer in just during a Lady Warrior practice. mores on the team, sent base more often. ishing with a 12-2 loss to the learning process as we eight shots over the fence “I’m extremely proud of Okawville in the Class 1A were many times last year. host and eventual state to minimize our mistakes, last year and drove in 33 the way they’ve worked New Athens Regional. I would like to see a con- champion Hornettes. put the ball in play and runs. hard so far,” Franklin said. Three of those return- siderable improvement Coach Dave Lucht en- throw strikes.” “Hopefully she can keep “We’ll have basically 13 ers are seniors pitcher/ from March to May.” ters his eighth campaign Sparta doing what she’s been do- girls to rotate in and out of catcher Taylor Schreiber, Besides his returning at the top of the pecking (SIRR Mississippi) ing,” Gerlach said. “Hope- the lineup. Everybody is shortstop Katelyn Weis athletes, Engelhardt also order for Red Bud. When Waterloo Gibault fully she can have that going to get to play, and it and center fielder Jamee mentioned there are a The returners he has in- defeated the Lady Bull- same confidence.” makes us better down the Houchins. That trio will handful of players who clude team leader and se- dogs, 4-3, in the opening Gerlach said he is also road. I’m looking forward again be counted on to have had a good spring nior catcher Olivia Biev- round of the Class 2A looking at returners to it.” anchor the middle of the who could contribute. enue. Lexus Carner will Nashville Regional last sophomore infielder Chester field. Those players are in- again cover the ground in year, it marked the end of Mackenzie Pim and jun- (Black Diamond) Schreiber and Weis are fielders sophomore centerfield, putting her a season that saw Sparta ior outfielder Sydnie Fur- In her first year at the three-year starters who Megan Mayo and fresh- speed in the outfield on stumble to a 5-23 mark. man to step into a bigger helm of the Lady Yellow were strong at the dish last men Lynlee Linder and full display. One thing the Lady Bull- offensive role. Jackets, coach Tracy year. Houchins provides Hannah Dascotte and out- Senior shortstop Clau- dogs will have going for Other key returning Colvis has her sights set quickness in the field. fielders freshman Kiya dia Mehring brings a con- them this year is they have starters include sopho- high. Top hitter catcher/third Hagene and sophomore stant positive attitude to all nine starters returning mores catcher AnnaBeth Coming off of an 8-18 baseman Chelsea Hill, a Lydia Pestka. the team, and the athletic to the diamond. Batson and pitcher Syd- season, including a 4-3 junior, returns to also pro- Engelhardt said one of and versatile pitcher Last year, coach April ney Hood. Junior Haley loss to Red Bud in the vide strong defense be- the keys this season will Mackenzie Harbaugh is Zimmermann, who is en- Troue will supply some Class 2A Nashville Re- hind the dish. Sopho- be playing with a little bit back after finishing 5-0 last tering her fifth year in pitching depth. gional, Colvis wants this mores second baseman of swagger and doing ev- year. charge of the Sparta pro- “Hood has gotten stron- year’s version of the Lady Kenzie Kern and third erything with an exclama- “Our strength this year gram, had no seniors to ger and looked like she’s Yellow Jackets to top the baseman/outfielder Ree- tion point instead of a looks to be athleticism and work with. This year, she picked up a couple of program’s record win to- sha Bievenue will be back, question mark. He said the versatility,” Lucht said. will have eight. pitches,” Gerlach said. tal of 15 in a season, set in as well. players need to have the “Almost every player can One of those seniors will “She’s honed in her 1992. A pair of injured play- confidence that the deci- play a second position and be top pitcher Olivia offspeed pitches, as well.” Colvis, who replaced ers, junior Alaina Fett and sions they are making are has good speed and abil- Oathout. Oathout also Despite no seniors and Wade Miller, has coached sophomore Kyla Krause, correct and execute them. ity. They have been work- brings a solid bat and a just a pair of juniors on on and off at the junior will make their return to “We also need to play ing really hard and have bevy of varsity playing ex- the team, Gerlach is not high level for 10 years, the diamond. Fett will pro- with more energy,” Engel- been very coachable.” perience with her. worried about the youth. Chester summer ball vide pitching depth, as hardt said. “We need to A pair of newcomers to Senior Haylee Shevlin “A lot of these girls have teams and a select ball well as outfield play, and love playing the game, the varsity team that Lucht will stand tall at first base been on select softball team for the past eight Krause will join an out- play with a bounce and sees as players who could and bring leadership to teams,” Gerlach said. years. field mix that Childers said energy and keep the have a strong impact are the squad. “They have gained more With seven returning is strong physically. tempo of the game up. The sophomores pitcher/third Another key player is experience by playing se- starters from last year’s Freshman pitcher/first best teams I have ever baseman Sophia Koes- junior Emmily Cato, who lect softball. They are in squad, Colvis said all of baseman Isabella Combs coached in any sport have terer, who Lucht described Zimmermann said was the competition all the time. her players are key. is another Lady Meteor played with high energy as a good athlete, and third team’s offensive leader a There’s a lot of committed “Every one of them is player to watch for. and picked up their team- baseman/left fielder Laura season ago and will spend softball players on this going to excel at different “We should improve on mates when they were hav- Juelfs. Juelfs will be an- time at catcher and short- team.” times and every one of last year’s record with ing a low energy day. other athletic player on the stop. Being committed and them is going to have more experience, more “We need this energy to diamond and possesses A pair of seniors Zimm- having confidence are a games they wish they pitching depth, a solid achieve what we hope to great speed. ermann tagged as poten- couple of attributes could play over again,” catcher and great team this year.” “Although young, our tial break-out players are Gerlach said will be key, Colvis said. “The focus of morale,” Childers said. Red Bud pitching should keep us Martina Ashley and Tahja as well as being united as a team is to pick each other “The key will be how well (Cahokia) in every game,” Lucht said. Douglas. a team. up when someone on our incoming talent improves The Lady Musketeers “We will also have the abil- While this team will “I’m excited about the team is having a bad day, and learns. The men- will bring back just four ity to put the ball in play boast much more experi- youth we have,” Gerlach because we are all not per- tioned players must play starters from last year’s and put pressure on the ence over last year’s said. “We just need to get fect every game.” up to their capability for squad that went 20-11 but defense. Our varsity expe- squad, it will still need to it through their heads to Chester will also have us to be more successful.” was eliminated from the rience may be lacking, but find a way to get players to have the confidence to go an influx of six freshmen Pinckneyville playoffs in the Class 2A we look to be a very solid cross home plate. out and get wins now and in the program, which will (SIRR Mississippi) Nashville Regional cham- fundamental team. “This year, we need to not wait two years to do aid in one of Colvis’ other The Lady Panthers will pionship game, 6-1, by the “As always, we will need focus a great deal on of- it.” goals to get a junior var- bring back seven players sity program started so the from last year’s Class 2A younger players have a Du Quoin Regional cham- better chance to improve pionship team. BUY • SELL • TRADE and gain experience. Pinckneyville saw its For this season, though, postseason run end in the Build Your Own Colvis said success starts Carterville Sectional semi- AR STUMP REMOVAL Veteran Owned Sam’s Super New Updated Stump Grinding Equipment & Operated We Can Grind Out The Stump, Cody W. Jones Storage Clean-up Woodchips And Debris, email: [email protected] Haul-In Topsoil And Plant Grass Seed. Reasonable Monthly Rental On Storage Space See Us Before You BOSTON Pay TOO Much! ENTERPRISES Fully Insured And Bonded 5 x 10s • 10 x 10s • 10 x 20s 618-317-6699 SECURITY LIGHTING & CAMERAS Backhoe And Bobcat Work (618) 200-0688 Please Inquire As To Other Monday, Wednesday, Thursday & Friday 9am-5pm Rte. 13 • Tilden, IL Services That We Offer. Saturday & Sunday 10am-5pm • Closed Tuesday - Teddy Boston 101 E. Main St., Du Quoin 587-3707 or 534-2855 Page 28 County Journal March 10, 2016 W’ville purchases sewer pump, hires summer help
After a lengthy discus- he has four applications a plan could come next sion Tuesday night, the and will soon interview month. Willisville Town Board the candidates. The After little discussion, moved ahead to pur- three hired will each the board agreed to chase a gasoline-pow- work 20 hours a week. raise the fee charged by ered sewer pump. The board discussed a attorney Aaron Atkins. The town already had procedure to eliminate Atkins has been the the pump, which cost some of the ditches in town’s attorney since $500. town. 1998 and has always Board member Scott Simms said it would be charged a flat fee of $500 Simms said he thought to the town’s benefit to a month. Warner noted it could have been pur- pay for the installation that Atkins did not ask chased for $350 but of culverts on private for a raise in his fee. The eventually agreed to property roadside board voted to raise the make the $500 pur- ditches at if property fee to $800 a month. chase. owners paid for the cul- “We are very pleased The board also agreed verts. He said that would with his work. (The to hire three part-time mean the town would no raise) is well deserved, summer workers. Mayor longer have to clean out and he is well worth the Clarence Warner said those ditches. Action on money,” said Warner. Vietnam Veterans Day set To commemorate the Of that number, 18 Evansville, Roger Dale 50th anniversary of the were from Randolph Partington of Sparta, Vietnam War, the Ran- County, 12 from the Charles Wayne Rader of dolph County commis- Army and six Marines. Chester and Frank Dale sioners and the Liberty Those from the Army Steibel of Prairie du Scout proclamation Bell of the West Chapter were Frederick Allen Rocher. Trico Area Girl Scouts visited the Willisville Town Board meeting Tuesday National Society of Allmeyer, James Ed- An excerpt from the night. They watched as Mayor Clarence Warner signed a proclamation Daughters of the Ameri- ward Cowell, Kenneth proclamation reads as designating Girl Scout Week as March 6-12 in Willisville. Above from left can Revolution have Charles Frazer and follows: are Sophia Coke, Kathleen Jackson, Jaden Coke, Riley Thompson and proclaimed Tuesday, Bruce Richard Welge of We offer our uncondi- Warner. March 29 as Vietnam Chester; Robert Joe tional gratitude to all Veterans Day. Bowlin, Terry Lee Dou- our Vietnam veterans. The official proclama- glas and Donald Eugene You served with honor, Cutters and Strutters to hold tion will be signed at the Parsons of Sparta; Leon courage and valor under March 24 county board Christ Buehler and some of the most chal- meeting. Glenn Edward Nichol- lenging conditions ever annual heritage banquet This day of honor is set son of Red Bud; Ivan faced. The Randolph County Hazel Street. programs. aside to assist in thank- Ivory Green of Coul- To our collective Cutters and Strutters of Funds raised from the The evening will in- ing these veterans, espe- terville; Leonard Arthur shame, there were no the National Wild Tur- banquet are directed clude a social hour, din- cially those in the com- Nitzsche of Ellis Grove parades upon your re- key Federation will host through the NWTF to ner, raffles, silent and munity and their fami- and Alan Dale Trucano turn, no hero salutes. its annual hunting heri- support many Illinois live auctions and a lies who made the ulti- of Steeleville. Through your suffer- tage banquet Saturday, projects for wild turkey chance to view special mate sacrifice. Those from the county ing, our consciousness April 2 at St. John’s and other habitat spe- edition wildlife prints, The official end to the in the Marine Corps has changed, and we are Catholic Parish Center cies. Chapters can also bronze sculptures and war was in April of 1975. were William Karl a stronger, smarter na- in Red Bud. apply for funding to sup- wildlife items. By then, at least 58,195 Colegate and Daniel Ray tion, better prepared for Doors will open at 5 port JAKES Day activi- For more information, people were killed in Kettmann of Red Bud, the challenges our veter- with dinner served at ties, turkeys for families call Scott Whelan at 830- battle. Steven William Moll of ans face today. 6:30. The center is at 519 in need and educational 3918. C’ville to purchase Brown Bag Meal old Eagle Market AVAILABLE ALL DAY For A Family Of 4 TO GO ONLY $ By Jeff Blair determined that the lin- Call Ahead & Only 20 The former Eagle Mar- ing was not necessary. We’ll Have It Ready! ket building in Coulter- The change order is for 10 Pieces Fried Chicken ville will soon be owned a credit to the village in by the village. the amount of $12,995. OR 2 Lbs. Catfish Fillets The town board voted Authorization was OR 2 Lbs. Codfish Fillets Monday night to autho- given to purchase a new rize Mayor Steve zero-turn mower from With 2 Quart Sized Sides Marlow to sign docu- Sparta Equipment at a & 2 Flowerpot Breads ments to purchase the cost of $11,625. Sides: Mashed Potatoes & Gravy • House Salad Chicken & Dumplings • Corn • Green Beans building from the cur- A pump used to move rent owners for $55,000. water during heavy Serving Southern llinois Since 1979
The village plans to rains was repaired at a THE PIONEER’S CABIN www.thepioneerscabin.com clean up the property cost of $4,206. After dis- Located 1/4 Mile Off Rte. 4 • Willisville • 497-2380 and building and try to cussion with mainte- Thurs.-Sat. 10:30am-9pm • Sun. 11:30am-3pm • Closed Mon.-Wed. entice another business nance workers, it was to locate there. determined that a In other notes, pay- smaller pump would suf- ment was approved for fice. A new pump would $18,808 to Haier Plumb- cost just over $400. Ap- Now Taking Orders For ing for work on the proval was given to pur- storm sewer project. chase the smaller pump. Also approved was a The board voted to do- EasterEasterEaster change order relating to nate $100 to the Cham- the storm sewer project. ber of Commerce for its HamsHamsHams In the original plan, sev- golf scramble. The event We want you to know - in the eral of the sewer lines will be held May 14 at Weekly SPECIALS were to have liners put White Oak Golf Course event of an accident, PRICES GOOD THRU SATURDAY, MARCH 12 WHILE SUPPLIES LAST inside them. It was later in Marissa. $ 99 It Is Your Right Butterfly Pork Chops ... 2 LB. Chester chamber to to select the Auto Body shop $ 29 that repairs your vehicle! Pork Cutlets ...... 3 LB. host diabetes program We Accept All Insurance Claims! $ 69 Split Chicken Breasts ... 1 LB. The Chester Chamber about diabetes and the Tim Gasser • Eric Montroy of Commerce will host a diabetic clinic at Memo- Fantastic $ 59 one-hour lunch program rial Hospital. There will Sirloin Tip Roast...... 4 LB. Thursday, March 17 at also be time allotted for the Chester Eagles Club questions. F I N I S H E S beginning at noon. Lunch is not provided Complete Collision Repair The speakers will be by the chamber but can Autobody Carmen Nehrt, RN, be ordered from the Chester St. & Nature Trail Rd • Sparta BSN, diabetes nurse menu. The program is educator, and Melissa open to the public. 618-443-3269 OR 618-317-1986 1505 N. Market • Northtown Center • Sparta • 443-3900 Soellner, registered di- MONDAY-FRIDAY 8AM-7PM • SATURDAY 9AM-6PM etitian and nutritionist, ACSM clinical exercise specialist and certified diabetes educator. St. Mark’s They will be talking We’re on Care your Center Easter RAFFLE egg hunt Extended Drawing The Randolph County New Drawing Date May 7 Care Center, located at At St. Mark’s Dinner Auction 312 West Belmont in Early Bird Winners $ Sparta, will host its Side 1st ~ Madina Renner ~ $1,000 25,000 community Easter egg 2nd ~ Jason Vallett ~ $500 hunt March 25. If you 3rd ~ Cindy Sickmeyer ~ $250 GRAND PRIZE The egg hunt for chil- 2nd - $5,000 ~ 3rd - $2,500 dren 1-6 starts at 2 p.m. 4th ~ Tim Allard ~ $100 4th-6th - $500 ~ 7th-10th - $250 in the dining room, fol- need 5th ~ Marilyn Kueker ~ $50 11th-15th - $100 ~ 16th-25th - $50 lowed by the hunt for All Previous Tickets Sold Wil lBe those 7-12. Included In This New Drawing Participants should siding $20 Per Ticket bring their own baskets. If 4,000 Tickets Are Not Sold, Prize Breakdown Will Be We Gladly Accept Eddie Kutz Based By The Following Percent Of Total Tickets Sold #ELL s Grand 20% • 2nd 6.25% • 3rd 3% • 4th-6th x 0.625% • 7th-10th x 0.3% • 11th-15th x 0.1% • 16th-25th x 0.06% 3 +INGSHIGHWAY Contact St. Mark’s Lutheran School 618-965-3838 COUNTY JOURNAL 0ERRYVILLE -/ or Casey Vallett 636-579-0591 For More Info Percy • 497-8272 WWWKKGUTTERINGCOM Facebook.com/StMarksSuperRaffle March 10, 2016 County Journal Page 29
$%62/87( Complete Septic /$1'$8&7,21 Perry County 280+- Acres & Aeration System INSTALLATION & REPAIR SALE: Saturday, April 2, 10 am JK Thompson Company At DuQuoin Elks Lodge in DuQuoin IL (618) 521-6174 (Lodge Address: 300 Shagbark Road, DuQuoin IL) Ken
Selling in 3 Tracts — 237+- Tillable Acres Justin (618) 967-0075 Open Lease for 2016 Farm Year Located 10 Minutes North of DuQuoin Near Intersection of 51 and 154
CHARTRAND EQUIPMENT CO. For more information contact DOZERS • LOADERS • EXCAVATORS • BACKHOES • GRADERS AUCTIONEER MARK KENNEDY at 618-924-1747 7(506$1'&21',7,216GRZQEDODQFHDWFORVLQJ1REX\HU¶VSUHPLXP We Buy And Sell Used Construction $XFWLRQHHU0DUN.HQQHG\,//LF6HHEX\DIDUPFRPIRUFRPSOHWHWHUPV DHULDOVPDSVHWF Equipment And Parts
866-770-8801 • 618-282-2585 email [email protected] or [email protected] www.ChartrandEquip.com Fully Licensed & Insured FOUNDATION, FLAT WORK, STAMPCRETE/COLORED, SEPTIC INSTALLATION, BASEMENT WATERPROOFING & FOUNDATION REPAIR Now Specializing Owners: Tim & Tracy Wildermuth PROPERTIES FOR SALE Serving Perry & Randolph Counties OKAWVILLE, River Bluff Rd, 11.72 Acres ~ Approx. 7 Acres In Basement Tillable, Balance Woods & Kaskaskia River Access. $85,000. Waterproofing (618) 758-1104 MARISSA, 922 S. Borders ~ 1 1/2 Story, 3-Bedroom, 1-Bath Home, Full Basement, 2-Car Insulated Garage, Corner Lots. $52,000. SPARTA, 310 S. Vine ~ 19,454 Sq. Ft. Commercial Building, Storefront, Storage Areas, Office Areas, Loading Docks, 800 Amp Elec. Service. This Place Has It All. $199,000. HOMESITES/ACREAGE CUTLER, 305 E. Hetherington ~ 2-Bedroom, 1 1/2-Bath Home W/ 299 Fuhrhop Road • Ava • 426-3982 Covered Carport, Gazebo & Storage Shed On Nice Corner Lot. $35,000. PRICE REDUCED! SPARTA, 9167 State Rte. 153 ~ 4-Bedroom, FOR SALE BY OWNER 1-Bath Home W/Full Basement (28 Acres, 11.75 Tillable, Balance For a list of properties for sale Woods). Great Lake Site! $185,000. Tract 1 PRICE REDUCED! COMMERCIAL / COULTERVILLE ~ 23- 80 ACRES +/- WASHINGTON CO. in southern Illinois go to: Lot Mobile Home Park, $175,000. Located On Hwy. 153, North Of Coulterville COULTERVILLE, 1024 W. Main ~ 3-Bedroom, 1-Bath Home W/ 55 +/- Tillable, Woods Good For Hunting, tri-county-realty.com $ Basement On 4.2 Acres.SALE MAY PENDINGDIVIDE. 82,500. Lake Site/Homesite TILDEN, 1232 Minnie St. ~ 3-Bedroom, 2-Bath Mobile Home W/ Call One Of Our Agents For Personal Service – 32x30 Heated Garage On 100x220 Lot. $55,000. PRICE REDUCED! PERCY, 505 E. Chestnut ~ 1-Bedroom, 1- Tract 2 65 ACRES +/- RED BUD AREA Sam Shaw ...... 618-559-1056 Bath Home W/Garage & 2 Storage Buildings On 3 Lots. $20,000. Located On Richfield Rd., 60 +/- Tillable Pat Williard ...... 618-443-8928 COULTERVILLE, 423 Nashville Road ~ 3-Bedroom, 1-Bath Home W/2 OutbuildingsSALE On 2PENDING 1/2 Lots. $48,500. Linda Kranawetter ...... 618-357-0424 COMMERCIAL / SPARTA, 209 S. Burns St. ~ Formerly The Tract 3 20 ACRES +/- RED BUD AREA $ Gathering Place Dinner Theater. Zoned B-2. 145,000. Located On Richfield Rd., 1/2 Woods Good Jeff Phillips ...... 618-790-4455 TILDEN, 234 Center Street ~ 1-Bedroom Home W/Full Basement Clay Fuhrhop, Managing Broker ... 618-924-1416 & Carport On 2 Lots. $32,500. For Hunting, 1/2 Tillable In CRP Now NEW PROPERTY LISTINGS ARE BEING ACCEPTED! Serving Southern Illinois Since 1989 See Listings On realtor.com, zillow.com And trulia.com CALL FOR DETAILS, 618-853-4115 Now For All Your Real Estate Needs...Buying Or Selling. Fax: 618-426-3690 Hiring Agents! GUTJAHR REALTY, LLC ® EQUAL HOUSING REALTOR Like Us On Facebook! OPPORTUNITY David Gutjahr, Managing Broker 2347 Roosevelt Road, Coulterville, IL 62237 • (618) 578-8833 (618) 758-2731 • email: [email protected] We Have A Home For You Anywhere, Through Our Referral System.
Call One Of Our Agents For Personal Service – ILLINOIS LAND IS IN DEMAND
Florence Kane, WE ARE ACTIVELY PURSUING HUNTING & Broker Manager ...... 967-6516 FARMLAND LISTINGS IN YOUR AREA. Dorcas Gruber, Broker Manager ...... 559-9147 Jeff Heil (618) 615-7357 Janice Barbour ...... 615-9187 Agent, Land Specialist Rachel Cross-Kane ...... 967-8264 WHITETAILPROPERTIES.COM Joyce Hagene Dierkes .. 534-3457 Whitetail Properties Real Estate, LLC. DBA Whitetail Properties | In the State of Nebraska DBA Whitetail Trophy Properties Real Estate LLC. | Dan Perez, Broker - Licensed in IL, IA, KS, KY, MO, NE & OK | Jeff Evans, Broker - Licensed in AR, GA, IL, John Lane ...... 708-0900 MN & TN | Wes McConnell, Broker - Licensed in AL, IL, OH, SD & WI | John Boyken, Broker - Licensed in IN | Sybil Stewart, Broker - Licensed in MI & LA | Chris Wakefield, Broker - Licensed in TN | Joey Bellington, Broker - Licensed in TX Doug Little ...... 615-5001 Dustin Nail ...... 363-7058 JACKSON COUNTY 15 ACRES — MURPHYSBORO Don Otten ...... 830-2999 Excellent building sites with nice road frontage and a patch of woods. PERRY COUNTY 17 ACRES — PINCKNEYVILLE Tim Schulein ...... 317-0577 Great building site. Pinckneyville School District. Pond and several pole Kim Wesbecher ...... 317-2230 buildings. Washington County water available. NO PRICE REDUCED! RANDOLPH COUNTY 6 ACRES + HOME Or View Our Listings At Ellis Grove. 3-bed, 1-bath home and barn with beautiful views and a www.Century21.com place to have your animals close to you. This property is ready for your www.Realtor.com personal touch! PRICE REDUCED! RANDOLPH COUNTY 33 ACRES — SPARTA TRESPASSING Sparta (618) 443-2211 Mostly tillable tract. Chester (618) 826-3421 RANDOLPH COUNTY 30 ACRES — SPARTA Perry County (618) 357-2130 Hunting and fishing by permit only. GOLDEN KEY REALTY, INC. Mostly tillable tract. EQUAL HOUSING RANDOLPH COUNTY 20 ACRES — STEELEVILLE Each Office Independently Owned & Operated OPPORTUNITY Trespassers Subject To Arrest Hunt property located 1 mile SE of Steeleville on Cox Creek. PRICE REDUCED! WASHINGTON CO 42 AC — COULTERVILLE IN THE CIRCUIT COURT OF THE 20TH JUDICIAL DISTRICT RANDOLPH COUNTY, ILLINOIS All wooded tract. Great campsite, home site or hunting camp! CHANCERY DIVISION SEE WEBSITE FOR MORE LISTINGS IN YOUR AREA! FIRST BANK, Plaintiff, -v.- STEVEN C. EVERDING, et al, Defendant 13 CH 00084 EX\DIDUPFRP NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure SPECIALIZING IN RURAL REAL ESTATE SALES & AUCTIONS! Knight Hawk Coal, LLC • (618) 426-3662 and Sale entered in the above cause on January 8, 2016, an agent for The Judicial Sales Corporation, will at 1:30 PM on April 11, 2016, at the Randolph County Courthouse, One Taylor Street front door entrance, CHESTER, IL, 62233, sell at public auction to the highest bidder, as set forth below, the following described real estate: Commonly known as 6821 EDGEWOOD ROAD, RED BUD, IL 62278 Property Index No. 09-049-003-00. The real estate is improved with a residence. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is One Year • 52 Papers calculated on residential real estate at the rate of $1 for each $1,000 or Please Enter My Subscription To fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to Please Check One the residential real estate arose prior to the sale. The subject property is County Journal subject to general real estate taxes, special assessments, or special taxes ❏ levied against said real estate and is offered for sale without any New Subscription representation as to quality or quantity of title and without recourse to Plaintiff and in \"AS IS\" condition. The sale is further subject to confirmation PO Box 369 • Percy, Illinois 62272 ❏ by the court. Upon payment in full of the amount bid, the purchaser will Renewal receive a Certificate of Sale that will entitle the purchaser to a deed to the real estate after confirmation of the sale. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to Name verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at Address the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 15- 1701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. You will City State Zip need a photo identification issued by a government agency (driver's license, passport, etc.) in order to gain entry into our building and the foreclosure sale room in Cook County and the same identification for sales ❏ held at other county venues where The Judicial Sales Corporation conducts $23.00 For One Year foreclosure sales. For information, examine the court file or contact Phone Plaintiff's attorney: CODILIS & ASSOCIATES, P.C., 15W030 NORTH Randolph, Perry Or Jackson County & Marissa FRONTAGE ROAD, SUITE 100, BURR RIDGE, IL 60527, (630) 794-9876 Please refer to file number 14-15-17167. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 60606- ❏ 4650 (312) 236-SALE You can also visit The Judicial Sales Corporation at $25.00 For One Year www.tjsc.com for a 7 day status report of pending sales. CODILIS & ❏ $30.00 For One Year All Other States ASSOCIATES, P.C. 15W030 NORTH FRONTAGE ROAD, SUITE 100 In Illinois BURR RIDGE, IL 60527 (630) 794-5300 E-Mail: [email protected] Attorney File No. 14-15-17167 Attorney ARDC No. 00468002 Case Number: 13 CH 00084 TJSC#: 36-457 NOTE: Pursuant to the Fair Debt ❏ $30.00 For One Year ❏ Collection Practices Act, you are advised that Plaintiff's attorney is deemed $1.50 Discount For Senior Citizens to be a debt collector attempting to collect a debt and any information Online obtained will be used for that purpose. I684855 Page 30 County Journal March 10, 2016
Phone: 618-497-8272 Fax: 618-497-2607 Email: [email protected] Deadline: Tuesday At 2pm
the office of Village Hall, 403 Spring Street, STATE OF ILLINOIS FOR SALE FOR RENT GARAGE SALE STORAGE PO Box 257, Evansville, IL 62242 until 10:00 IN THE CIRCUIT COURT OF THE AM, April 11, 2016, and then at said office TWENTIETH JUDICIAL CIRCUIT publicly opened and read aloud. RANDOLPH COUNTY FOR SALE: Built-Mor FOR RENT IN SPARTA: STORAGE UNITS avail- “Any contract or contracts awarded under FIRST NATIONAL BANK OF SPARTA, A 2 & 3-bedroom mobile GOING OUT OF BUSI- able at Alcatraz Mini Buildings. 24x40, $8,415; NESS SALE: Everything 30x50, $12,260; 40x60, homes in park. Also mo- Storage, Percy. 5X10, this invitation for bids are expected to be banking corporation organized and existing $18,545; Erected, choice of bile home lots in park. Pri- must go! Up to 75% Off. $39.50/mo. or 10X15, funded in part by a loan from the Illinois under the laws of the United States of colors. 732-8704 or 237- vate mobile home lots for Twenty-Five Boutique, $49.50/mo. January Spe- Environmental Protection Agency (Illinois America, Plaintiff, vs. sale. Call Ronnie John- 604 N. Sparta St., Steele- 0792 or go to builtmor cial: First month free, 618- EPA). Neither the State of Illinois nor any TERRI L. HATLEY, MIDLAND FUNDING buildings.com. son. 618-443-3325. ville. Wednesday - Friday, 497-2241...... 0-x-x ...... 0-x-xB 11:30am-4:30pm & Sat- ...... 0-x-x of its departments, agencies or employees LLC, SPARTA COMMUNITY HOSPITAL, CONSTRUCTION FOR RENT: 1 & 2-bed- urday, 9am-noon. March is or will be a party to this invitation for UNKNOWN OWNERS and NON-RECORD room apartments in Spar- PARTS: Used construc- 31 last day! WANTED bids or any resulting contract. The CLAIMANTS, Defendants. tion parts for all makes of ta, $425/month for 1 bed, ...... 1-3-10 $550/month for 2 bed. Wa- procurement will be subject to regulations No. 16-CH-6 dozers, loaders, graders, RUMMAGE SALE: Fri- WANTED TO BUY: excavators, etc. Fast, effi- ter and trash included. No contained in the Procedures for Issuing NOTICE OF FORECLOSURE pets. Broker owned. 618- day, March 18, 4pm-7pm Mobile homes in good cient service. Two loca- & Saturday, March 19, condition. 1978 or newer. Loans from the Public Water Supply Loan The requisite Affidavit for Publication tions: Chartrand Equip. 791-3289...... 0-x-xB 7am-2pm. St. Peter’s Must have central A/C. Program (35IAC Part 662), the Davis-Bacon having been filed, NOTICE IS HEREBY Co., Red Bud 618-282-2585 573-721-5710. RENT TO OWN: 2-bed- Lutheran Church, 900 Act (40 USC 276a through 276a-5) as defined GIVEN YOU, TERRI L. HATLEY, & Ellis Grove 618-853- Church St., just off of Rte...... 0-x-x 2314. Email us at chartr@ room, 1-bath house. Nice by the United States Department of Labor, MIDLAND FUNDING LLC, SPARTA quiet neighborhood in 3, Evansville. htc.net. I Buy Houses! the Employment of Illinois Workers on COMMUNITY HOSPITAL, ALL ...... 0-x-x Percy. 618-559-3525...... 1-3-17B FOR SALE: BED: Queen ...... 0-x-x INDOOR YARD SALE: Any Price. Any Area. Public Works Act (30 ILCS 570), and the UNKNOWN OWNERS AND NON-RECORD MOBILE HOMES FOR At Landmark Apostolic Any Condition. “Use of American Iron and Steel” CLAIMANTS, Defendants in the above pillowtop mattress set/ RENT: Nice 2 & 3-bed- NEW-in plastic. $175, can Church, 401 N. Vine, requirements as contained in Section 436 of entitled suit, that said suit has been room mobile homes in Sparta. Saturday, March Local Investor deliver. 618-772-2710. Steeleville mobile home H.R. 3547, The Consolidated Appropriations commenced in the Circuit Court of ...... 1-5-26B 12, 7am-noon. park. Water, sewer and (618) 559-3525 Act, 2014. This procurement is also subject Randolph County by said Plaintiff against CENTRAL BOILER E- trash included in rent...... 1-3-10B southernillinois CLASSIC OUTDOOR Starting at $400 per homebuyers.com to the loan recipient’s policy regarding the you and other Defendants, praying for the WOOD FURNACE: Lim- month. No pets. Call 573- increased use of disadvantaged business foreclosure of a certain Mortgage conveying ited time big savings 721-5710. enterprises. The loan recipient’s policy the premises described as follows: to-wit: offer. Instant rebate up to ...... 0-x-x LEGAL NOTICES $1000. Call today! Slover FOR RENT: 1, 2 & 3-bed- requires all bidders to undertake specified Parcel 1: Outdoor Heating 618-496- room apartments 618-534- affirmative efforts at least sixteen (16) days Fifty Feet off the South end of Lots 1 and 3285. 4934. prior to opening. The policy is contained in 2, Block 7; ALSO Lot 3 of Block 7, EXCEPT ...... 0-3-10 IN THE CIRCUIT COURT OF THE ...... 0-x-xB the specifications. Biders are also required the North 70 feet thereof, of Stevensonfs FOR SALE: 1200 lbs. hay HOUSE FOR RENT: 217 TWENTIETH JUDICIAL CIRCUIT bales, net wrapped, 618- E. College, Sparta. 4 bed- to comply with the President’s Executive First Addition to the Village of Tilden, 853-4115. RANDOLPH COUNTY, ILLINOIS room, 1 3/4 bath, $700 per IN RE: NAME CHANGE OF: Order No. 11246, as amended. The Randolph County, Illinois, EXCEPT the coal ...... 1-3-17 month. Pictures can be requirements for bidders and contractors underlying, together with the right to mine FOR SALE: 2012 3-wheel seen on zillow.com, for Kelsey AnnMarie Lambert, a minor Hoveround. 24V, new info call, 618-443-8067. No. 16-MR-9 under this order are explained in 41 CFR and remove the same and subject to all batteries, tires, charger, ...... 0-3-10B NOTICE 60-4.” other rights and easements in favor of the basket, back-up alarm, The CONTRACT DOCUMENTS may be owner of the mineral estate or of any party speed dial & free-wheel For Rent In Notice is hereby given that Diane G. Mills mode. Paid more than as Mother and Next Friend of Kelsey examined at the following locations: claiming by through or under said estate; $400 but will take best CHESTER AnnMarie Lambert, a minor, has filed with Village of Evansville, Village Hall, 403 Parcel 2: offer. Call 618-363-0454. Spring Street, Evansville, IL 62242 Seventy feet off the North end of Lots 1, 2 ...... 1-3-17B Now taking the Circuit Court of Randolph County a FOR SALE: 1979 Chevy Petition to Change Name from Kelsey Office of the Engineer, Asaturian Eaton and 3 in Block 7 of Stevensonfs First pickup, new tires. Also, applications for AnnMarie Lambert to Kelsey AnnMarie and Associates, 1440 Old West Main Street, Addition to the Village of Tilden, Randolph garden tiller, 5HP Briggs 62 years or older, Deutschmann. A hearing will be held on Carbondale, IL 62901 County, Illinois, EXCEPT the coal & Stratton. Call 618-282- Southern Illinois Builders Association underlying, together with the right to mine 2793 or 618-806-7161. disabled or said Petition no sooner than March 11, 2016...... 0-3-10 handicapped LAW OFFICE OF BETH M. HEATON Plan Room, 1468 Green Mount Rd., O’Fallon, and remove the same and subject to all IL 62269 & 504 W. Jackson St., Marion, IL other rights and easements in favor of owner regardless of age, Beth M. Heaton MOBILE HOME ...... 0-3-10 62959 of the mineral estate or of any party claiming for one-bedroom Copies of the CONTRACT DOCUMENTS by, through or under said estate. apartments. FOR SALE: Mobile home may be obtained at the office of Asaturian PIN: 16-060-002-00 located on corner lot in Free water, sewer NOTICE OF PUBLIC HEARING Eaton and Associates, located at 1440 Old Commonly known as 1007 Vine Street, Park Estates, Sparta. 1216 and trash pickup. NOTICE OF HEARING West Main Street, Carbondale, IL 62901 Tilden, Randolph County, Illinois, and for sq. ft., 3 bed, 2 bath, nice Off-street BEFORE THE ZONING BOARD upon payment of $100.00 for each set. other relief; that Summons was duly issued covered front and rear OF APPEALS/PLAN COMMISSION porches, handicap acces- parking. On-site Any BIDDER, upon returning the out of said Court against you as provided by VILLAGE OF TILDEN sible with ramp and deck, laundry facilities. CONTRACT DOCUMENTS promptly and law, and that said suit is now pending. 2 storage sheds and single TO WHOM IT MAY CONCERN: in good condition, will be refunded his NOW THEREFORE, unless you, the above carport. Call 618-708-1404 Appliances Public notice is hereby given that a public for appointment. payment, and any non-bidder upon so named Defendants, file your Answer to the ...... 1-3-17B furnished. hearing will be held Tuesday, March 29, returning the CONTRACT DOCUMENTS Complaint in this suit, or otherwise make For additional 2106 at 7:00 p.m. in the Tilden Firehouse at will be refunded the amount of $50.00. your appearance therein, in the Office of COMMERCIAL information, contact 650 Butler Street, Tilden, Illinois, to consider Craig Valleroy the Clerk of the Circuit Court of Randolph Jennifer Ross at a request for a special use permit to have Village President County, Randolph County Courthouse, WAREHOUSE FOR chickens on the following described March 10, 2016 Chester, Illinois, on or before the 11th day LEASE: 6,400 sq. ft., 1 3/4 (618) 826-2802. property: 142 Butler Street - 543/282 BLK 1 acres, highway 157/15, ...... 0-3-10 of April, 2016, default may be entered between Line J Trucking This institution is an Wm Stevenson’s 2nd Addition, 504/406 Lots against you at any time after that day, and and Our Lady Of The equal opportunity 1, 2, 3, 4 & 5 BLK 2 Wm Stevenson’s 2nd a Judgment of Foreclosure entered in Snows. 618-340-2090. provider and Addition, Village of Tilden. Said request STATE OF ILLINOIS accordance with the prayer of said ...... 0-x-xB employer. was made by Clark Powell and application IN THE CIRCUIT COURT OF THE Complaint. REAL ESTATE Equal Housing is on file in the office of the Zoning TWENTIETH JUDICIAL CIRCUIT The following information applies to the Opportunity. Administrator at 550 South Railroad, Tilden, RANDOLPH COUNTY foreclosure proceedings: IL. All interested persons are invited to (i)The name of all Plaintiffs and the case For Rent In attend said hearing and be heard for or CITY OF SPARTA, Illinois, number are identified above. FSBO: 3-bedroom brick STEELEVILLE against said proposal. a municipal corporation, (ii)The Court in which the action was home, great location, Dated this 8th day of March 2016. Plaintiff, brought is identified above. completely remodeled, ...... 0-3-10 vs. (iii) The name of the title holder of record family room with bonus Now taking room, 1 full bath, 2 half applications for FARLEY MINES, SCOTT SIERON, is: TERRI L. HATLEY RAVEN SECURITIES, INC., and JICTB INC. (iv)An identification of the mortgage baths with showers, 62 years or older, STATE OF ILLINOIS separate dining room, 2 f/k/a JANSON INVESTMENT COMPANY, sought to be foreclosed is as follows: disabled or IN THE CIRCUIT COURT OF THE 20TH fireplaces (1 gas, 1 elec- UNKNOWN OWNERS and NON-RECORD Names of original mortgagors: Terri L. tric), third-car garage, JUDICIAL CIRCUIT handicapped CLAIMANTS, Hatley closed-in back porch, RANDOLPH COUNTY brick patio overlooking regardless of age, Defendants. Name of mortgagee: The First National CHANGE OF NAME TO creek. Move-in ready. for one-bedroom No. 16-MR-10 Bank of Sparta Completely landscaped. Brandon David Hoffman Date of mortgage: August 25, 2014 402 Friendly Drive, Red apartments. NO. 15-MR-133 NOTICE BY PUBLICATION Date of recording: September 8, 2014 Bud. 618-301-2354. Free water, sewer NOTICE OF FILING OF PETITION ...... 1-3-17B Notice is hereby given to you, FARLEY County where recorded: Randolph and trash pickup. FOR CHANGE OF NAME PRICED TO SELL: 3- MINES, SCOTT SIERON, RAVEN SECURI- Recording document identification: bedroom, 1.5-bath, car- Off-street Notice is given you, the public, that on TIES, INC., and JICTB INC. f/k/a JANSON Document No. 2014R02885 port, covered patio, shed, April 14th, 2016, at 9:00am, a hearing will covered front porch, parking. On-site INVESTMENT COMPANY, UNKNOWN Dated at Chester, Illinois, this 2nd day of be held on a petition for change of name, stove, 2 refrigerators, laundry facilities. OWNERS and NON-RECORD CLAIM- March, A.D. 2016. microwave, washer and asking the court to change my present name Appliances ANTS, Defendants of the above-entitled /s/ Sherry L. Johnson dryer, on large lot at 1013 of Brandon David Hoffman to the name of furnished. cause, that an application has been filed in Clerk of the Circuit Clerk Country Club Road, Brandon David Balsom. The hearing will Sparta. Call 317-1460. the Circuit Court of Randolph County by Randolph County, Illinois For additional take place at 9:00am, April 14, 2016 in court- ...... 1-3-31 the City of Sparta against you and other Alan R. Farris information, contact room #2, Randolph County, Illinois. Defendants praying for authority to Attorney at Law at Date February 23, 2016 APPLIANCES Jennifer Ross demolish a dangerous and unsafe building, No. 03124299 Plaintiff: Brandon David Hoffman (618) 826-2802. located within the City of Sparta, Randolph 221 S. Market ...... 0-3-10 County, Illinois, and more particularly FOR SALE: Refrigerators, This institution is an P. O. Box 314 ranges, washers, dryers, equal opportunity described as follows: Sparta, IL 62286-0314 freezers, propane stoves. IN THE CIRCUIT COURT Lots 4 and 5 of Block 4 in Alexander H. Telephone: (618) 443-1947 Guaranteed. Tilley’s Used provider and employer. TWENTIETH JUDICIAL CIRCUIT IN Neill’s Addition to the City of Sparta, [email protected] Appliances, 518 E. Park ILLINOIS, RANDOLPH COUNTY St., Du Quoin, 618-542- Equal Housing Randolph County, Illinois, more particu- ...... 0-3-24 6810 Opportunity. larly described as follows: ...... 1-3-31B In the Matter of the Estate of: Commencing at an old iron pin at the JULIE HELEN WEITHORN, Deceased IN THE CIRCUIT COURT Northeast corner of Block 9 of Alexander TWENTIETH JUDICIAL CIRCUIT H. Neill’s Addition to the City of Sparta, No. 16-P-25 IN ILLINOIS Randolph County, Illinois, as recorded in RANDOLPH COUNTY NOTICE FOR PUBLICATION AND FOR Plat Book “A”, Page 33 of Randolph County records; thence northerly along the West APARTMENTS MAILING OR DELIVERY TO In the Matter of the Estate of: line of Walnut Street (40 feet wide), 40.84 CREDITORS - CLAIMS GEORGE H. HEIDINGER, Deceased feet to the Southeast corner of Block 4 of AVAILABLE FOR RENT No. 16-P-24 Notice is given of the death of Julie Helen said Neill’s Addition; thence westerly along the South line of said Block 4, 80.00 feet to In PERRY COUNTY Weithorn. Letters of Office were issued on CLAIM NOTICE an iron pin at the Southeast corner of Lot 5 March 1, 2016 to Virginia L. McCrary, 7 Notice is given of the death of George H. FOR MORE INFO CALL of said Block 4; for a point of beginning of Sumac Circle, Makanda, IL 62958, as Heidinger. Letters of Office were issued on Perry County herein described tract; thence continuing Independent Administrator, and whose February 29, 2016, to Roy C. Heidinger, 225 westerly along last described course along Housing Authority attorney of record is Arbeiter Law Office, Lamb Road, Carbondale, Illinois 62902, said South line of Block 4, 160.00 feet to an 1019 State St., PO Box 367, Chester, Illinois Administrator, and whose attorney of (618) 542-5409 iron pin at the Southwest corner of Lot 4; 62233. record is Arbeiter Law Offices, 139 South thence northerly with a deflection angle of The estate will be administered without Main Street, PO Box 8, Red Bud, Illinois 100036’00” along the West line of said Lot 4, court supervision unless under Section 28- 62278. COMING LIVESTOCK 119.20 feet to an iron pin at the Northwest 4 of the Probate Act, any interested person Claims against the estate may be filed in corner of said Lot 4; thence easterly with a EVENT terminates independent administration at the Office of the Clerk of the Circuit Court, deflection angle of 79024’00” along the North any time by mailing or delivering a petition Randolph County Courthouse, 1 Taylor 40TH ANNUAL QUILT line of said Lots 4 and 5, 160.00 feet to an to terminate to the Clerk. Street, Chester, Illinois 62233, or with the SHOW at the Tilden iron pin at the Northeast corner of said Lot Presbyterian Church. FRUITLAND Claims against the estate may be filed in representative or both, on or before 5; thence southerly with a deflection angle Saturday, March 12, 10am- the Office of the Clerk of the Circuit Court, September 6, 2016, or three months from of 100036’00” along the East line of said Lot 2pm. $ 7 admission in- LIVESTOCK SALES Randolph County Courthouse, Chester, IL the date of mailing or delivery of this Notice cludes salad bar lunch- 5, 119.20 feet to the point of beginning; 7505 U.S. Highway 61 62233 or with the representative, or both, to creditors, whichever is later, and any eon, large quilt display, SUBJECT to all exceptions, reservations, white elephant table and on or before September 3, 2016, or three claim not filed on or before said date is void. Jackson, MO 63755 easements, covenants and restrictions of country kitchen. months from the date of mailing or delivery Within ten days after filing of the Claim ...... 1-3-10B record, or as would be determined by a 573-243-4255 of this Notice to creditors, whichever is with the Clerk, the claimant shall cause a physical inspection of the premises or a Cattle Every Tuesday later, and any claim not filed on or before copy of the Claim to be mailed or delivered SERVICES survey thereof. 12:30pm said date is void. to the representative of the estate and to the Within ten days after filing of the Claim Perm. Index No. 19-026-002-00 representative’s attorney of record. DAYCARE: Loving day- MONTHLY FEATURES with the Clerk, the claimant shall cause a commonly known as 503 W. College, care provider in Percy copy of the Claim to be mailed or delivered currently has full-time 3rd Friday - 10:00am Sparta, Illinois, and for other relief. Dated: February 29, 2016 openings Monday-Fri- Sheep & Goats to the representative of the estate and to the NOW THEREFORE, unless you, the above- day, 5am-5pm, children 4th Tuesday - 11:00am representative’s attorney of record. named Defendants, file your answer to the Roy C. Heidinger, Administrator ages 0 & up, CPR, first aid Pigs Dated: March 1, 2016 Complaint in this suit or otherwise make By: Arbeiter Law Offices certified, licensed and Attorneys Neal Franke, Manager your appearance therein in the Office of the participates in a food Virginia McCrary, Representative Circuit Clerk of the Circuit Court of ...... 0-3-17 program for nutritional 573-382-0003 Steve Preusser By: Arbeiter Law Offices Randolph County, Randolph County meals, CHASI state aid is Attorneys accepted. Contact Chris- 573-833-6432 Courthouse, Chester, Illinois, on or before ...... 0-3-17 th tine at 618-615-1474 for Ken Carney, Auctioneer the 4 day of April, A.D. 2016, default may questions or references. 573-568-2353 be entered against you at any time after that ...... 1-3-31 Joe McMurtry 618-443-2435 ADVERTISEMENT FOR BIDS date; and an Order authorizing demolition Need a job? Village of Evansville of dangerous and unsafe building be entered 403 Spring Street in accordance with the prayer of relief con- Evansville, IL 62242 tained in said Application. You’ll Separate sealed bids for the construction Dated at Chester, Illinois, on this 25th day T. W. Construction of of February A.D., 2016. find it ROOFING • REMODELING • DECKS • DRYWALL • SIDING Contract A: Construct addition to water SEAMLESS GUTTERING • POLE BARNS • BARN REPAIRS treatment plant for chlorine dioxide /s/ Sherry Johnson here! ROOM ADDITIONS • NEW CONSTRUCTION • GARAGES • ETC. generation and chlorine feed systems, Sherry Johnson, Circuit Clerk including related plumbing, piping, Tom Wilhite FREE electrical and ventilation system. Alan R. Farris County Carpenter Contract B: Modify inlet/outlet piping to Attorney at Law Estimates existing bolted steel water tank to provide No. 03124299 Journal 308 Little Kinkaid Rd. • Ava spiral/ribbon flow pattern. 221 S. Market CLASSIFIED Appurtenant work for each contract as PO Box 314 SECTION (618) 426-9025 show and specified. Sparta, IL 62286-0314 Will be received by the Village of Telephone (618) 443-1947 618-497-8272 Evansville, Randolph County, Illinois at ...... 0-3-17 March 10, 2016 County Journal Page 31
IN THE CIRCUIT COURT FULL-TIME MEAT TWENTIETH JUDICIAL CIRCUIT COUNTER RETAIL HELP WANTED CLERK: Benefits include HELP WANTED POSITION AVAILABLE IN ILLINOIS competitive pay, health RANDOLPH COUNTY insurance, simple IRA, RETAIL SALES HELP WANTED: Part- holidays, vacations, meat Shirwin Farms in Lenzburg is seeking time position available, 25 In the Matter of the Estate of: discounts. Apply in per- individuals who enjoy plants, produce, CNA hours weekly, day shift son. Wenneman Meat Co., Benefits Include: Paid Sick Leave, EULA IRENE DAVIS, Deceased with no weekends, work- people, are friendly and can smile. St. Libory, IL. Paid Vacation, Paid Holidays, Merit Pay, No. 16-P-22 ing with developmentally ...... 0-3-10 Applicants will need skills in plant disabled adults. Must be HELP WANTED: Local maintenance, sales and merchandising. Attendance Incentive, 401(k). 21 or older. Requires a swine operation looking CLAIM NOTICE high school diploma, for farm labor. Swine and Experience a plus. For A Rewarding Career In Health Care, Notice is given of the death of Eula Irene valid driver’s license and agriculture experience PART-TIME POSITION Join A First-Rate Team That Cares. Davis. Letters of Office were issued on be able to pass drug and preferred but not neces- background checks and February 23, 2016 to Brenda Sue O’Rear, sary. Please call 618-473- Apply in person – Shirwin Farms Three Springs Lodge also a DOT physical, as 2325. 2411 State Rte. 13, Lenzburg, Illinois 403 W. Palm Street, Coulterville, IL 62237, some driving is required...... 1-3-10 NURSING HOME Executor, and whose attorney of record is Send resume to Human HELP WANTED: Now WE WILL OPEN MARCH 10 Arbeiter Law Office, 1019 State Street, PO Service Center, Attention: hiring all positions. Ex- 161 Three Springs Road • Chester • 826-3210 Stacey Mitchell, 10257 perienced cooks, barten- Box 367, Chester, Illinois 62233. State Rte. 3, Red Bud, ders & waitresses. bilin- Claims against the estate may be filed in Illinois 62278. EOE. gual speaking applicants the Office of the Clerk of the Circuit Court, ...... 0-3-10 welcome! Call to set up HELP WANTED: Seeking Randolph County Courthouse, 1 Taylor St., appointment to come in, passionate, like-minded, Corner Cafe, Coulterville, SPARTAN Chester, Illinois 62233, or with the team player who shares 618-758-3141. IMMEDIATE representative, or both on or before the vision of Christ Our ...... 0-3-10 Light Metal Products September 3, 2016, or three months from Savior to join our staff as Factory Positions Available Director of Admissions OPENING the date of mailing or delivery of this Notice and Marketing. Responsi- All Shifts ~ Full-Time & Part-Time to creditors, whichever is later, and any bilities would include ~ HS Diploma/GED Required ~ claim not filed on or before said date is void. admissions, international Part-Time student program and mar- Apply In Person At Within ten days after filing of the Claim keting. Resumes to be with the Clerk, the claimant shall cause a submitted by March 25. COOK copy of the Claim to be mailed or delivered For more information, go to www.coslhs.org . to the representatives of the estate and to ...... 1-3-17 the representative’s attorney of record. WANTED: Care giver for 7-year-old autistic boy in CNA 1009-B State Street ~ Chester WANTED Midnights 11-7 Dated: February 23, 2016 my home in Sparta. After Monday - Friday 8am - 5pm school and some Satur- days. Can train the right Apply In Brenda Sue O’Rear, Representative person, must be non- Great Working Environment. By: Arbeiter Law Office, Attorneys smoker. 618-708-0452. Apply in person. Ask for Shelley...... 1-3-17B Person ...... 0-3-17 NOW HIRING: Aides, Equal Opportunity Employer Bus Wash Lane/ teachers & director, Ha- THE kuna Matata Kid Care, Detailer IN THE CIRCUIT COURT OF THE 20TH Inc. Send resume to april MANOR AT CRAIG FARMS JUDICIAL DISTRICT [email protected] or 3030 State St. • Chester • 826-1400 RANDOLPH COUNTY, ILLINOIS mail to 2 Westwood Drive, & General Steeleville, IL 62288. CHANCERY DIVISION ...... 0-3-10B FIRST BANK, Plaintiff, -v.- BARTENDER WANTED: Cleaning STEVEN C. EVERDING, et al, Defendant Honest and personable, 13 CH 00084 apply in person at Sparta 903 S. St. Louis St. Part-Time – Up To 30 Hours Per Week Country Club Pro Shop. Sparta POSITIONS AVAILABLE NOTICE OF SALE PUBLIC ...... 0-3-17B NOTICE IS HEREBY GIVEN that Apply At: pursuant to a Judgment of Foreclosure and Sale entered in the above cause on January 8, 2016, an agent for The Judicial Sales HELP WANTED RN & CNA SWIBCO Corporation, will at 1:30 PM on April 11, We are looking for experienced and 2421 Old Plank Road 2016, at the Randolph County Courthouse, dedicated professionals to assume Chester, IL 62233 One Taylor Street front door entrance, 826-2323 CHESTER, IL, 62233, sell at public auction BARTENDER key positions on our nursing team! to the highest bidder, as set forth below, the Part-Time WE OFFER: Excellent starting wage, following described real estate: PART OF THE NORTH HALF THE Must Be 21 Or Older vacation, holiday, PTO, advancement HUMAN RESOURCE NORTHWEST QUARTER OF SECTION 32, opportunities and much more! TOWNSHIP 4 SOUTH, RANGE 7 WEST OF Apply In Person DIRECTOR For an immediate and confidential THE THIRD P.M., RANDOLPH COUNTY, interview, APPLY IN PERSON ILLINOIS, LYING WEST OF THE At Memorial Hospital Korner Tavern or call Whitney at (618) 758-2256. KASKASKIA RIVER, DESCRIBED AS In Chester FOLLOWS, TO-WIT: BEGINNING AT THE Campbell Hill • 521-1253 SOUTHWEST CORNER OF THE NORTH Coulterville Bachelor’s Degree With HR Professional HALF OF THE NORTHWEST QUARTER Certification Required OF SECTION 32, TOWNSHIP 4 SOUTH, Rehab & Health Care Master’s Degree Preferred, 3 Years Of RANGE 7 WEST OF THE THIRD P.M., 13138 State Rte. 13 • Coulterville Related Healthcare Experience Required RANDOLPH COUNTY, ILLINOIS; HELP WANTED THENCE EAST 320 FEET; THENCE To Apply Call (618) 826-4581, Ext. 1260 Or Online at mhchester.com NORTHEASTERLY, FORMING AN Full-Time INCLUDED ANGLE OF 126 DEGREES, A COOK DISTANCE OF 1,550 FEET; THENCE IN A 5 Days A Week PART-TIME POSITION Memorial WESTERLY DIRECTION TO A POINT ON Approximately 35 Hours The City of Sparta is seeking qualified THE WEST BOUNDARY OF SECTION 32, Hospital SAID POINT BEING 80 FEET SOUTH OF Apply In Person candidates for the position of THE NORTHWEST CORNER OF SECTION PART-TIME TREASURER 32; THENCE SOUTH ALONG SAID WEST BRUNZEEZ This position is a 25-hour a week position BOUNDARY TO THE POINT OF working 8:30 a.m. to 2:30 p.m. This candidate BEGINNING. CAFE Motor Coach COOK should be prepared to fill in for full-time Commonly known as 6821 EDGEWOOD 209 W. Main Street, Ava personnel to cover sick and vacation days. ROAD, RED BUD, IL 62278 Property Index Qualified candidates will have experience in Drivers Needed No. 09-049-003-00. The real estate is improved with a residence. Sale terms: 25% HELP WANTED business or accounting. The ideal candidate Qualified With Class "B" CDL down of the highest bid by certified funds at will have strong organizational skills, excellent "Airbrake & Passenger" the close of the sale payable to The Judicial communication skills and knowledge of local Endorsements Needed Sales Corporation. No third party checks FLOOR TECH government operations, including budget and will be accepted. The balance, including Full-Time With Benefits finance. Wage will be DOQ. Full & Part-Time Positions the Judicial sale fee for Abandoned Variable Hours, Shifts, Weekends, Holidays, The City of Sparta is an equal opportunity Apply At: Residential Property Municipality Relief provider and employer. Fund, which is calculated on residential Requires High School Education & real estate at the rate of $1 for each $1,000 or Driver’s License, Preferred Experience In The City of Sparta will be taking appli- Floor Care/General Maintenance cations/resumes until the position is filled. SWIBCO fraction thereof of the amount paid by the purchaser not to exceed $300, in certified For More Information Applications can be picked up at Sparta 2421 Old Plank Road funds/or wire transfer, is due within twenty- Call (618) 826-4581, Ext. 1260 City Hall, 114 W. Jackson Street, Sparta, IL Chester, IL 62233 four (24) hours. No fee shall be paid by the 62286. 826-2323 mortgagee acquiring the residential real Memorial estate pursuant to its credit bid at the sale Hospital or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential Now Taking Applications HELP real estate arose prior to the sale. The subject property is subject to general real estate HELP WANTED taxes, special assessments, or special taxes For Positions In WANTED levied against said real estate and is offered for sale without any representation as to Resident quality or quantity of title and without recourse to Plaintiff and in \"AS IS\" condition. The sale is further subject to Assistants ALL DEPARTMENTS COOKCOOKCOOK confirmation by the court. Upon payment Apply In in full of the amount bid, the purchaser will Certified Nursing Assistants receive a Certificate of Sale that will entitle Person the purchaser to a deed to the real estate Part-Time / Full-Time Weir Chevrolet, Buick, GMC after confirmation of the sale. The property will NOT be open for inspection and plaintiff Red Bud makes no representation as to the condition of the property. Prospective bidders are Part-Time Cook For Details Call admonished to check the court file to verify Inquire Within Larry Or Brandon At 282-2311 1775 N. Market all information. If this property is a condominium unit, the purchaser of the Or Apply Online At Sparta unit at the foreclosure sale, other than a www.cedarhurstsparta.com 443-3500 mortgagee, shall pay the assessments and Weir Ford the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). Red Bud If this property is a condominium unit which For Details Call Brad At 282-2375 is part of a common interest community, the purchaser of the unit at the foreclosure 211 North Market • Sparta sale other than a mortgagee shall pay the assessments required by The Condominium Weir Chrysler, Jeep, Dodge Follow Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), New Athens Us On YOU HAVE THE RIGHT TO REMAIN IN Come Join The POSSESSION FOR 30 DAYS AFTER For Details Call Gary At 475-3115 Facebook ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 15- Chester Walmart www.facebook.com/ 1701(C) OF THE ILLINOIS MORTGAGE All Replies Are Confidential! FORECLOSURE LAW. You will need a thecountyjournal photo identification issued by a government Team! agency (driver's license, passport, etc.) in order to gain entry into our building and NOW HIRING Ð the foreclosure sale room in Cook County Don’t Want To Wait For The and the same identification for sales held at TEMPORARY other county venues where The Judicial Sales Corporation conducts foreclosure Garden Center Sales Mailman To Arrive? sales. For information, examine the court Associates file or contact Plaintiff's attorney: CODILIS & ASSOCIATES, P.C., 15W030 NORTH PART-TIME Get your paper from your FRONTAGE ROAD, SUITE 100, BURR Overnight Maintenance RIDGE, IL 60527, (630) 794-9876 Please refer to file number 14-15-17167. THE JUDICIAL Overnight Mod/Price Team computer! SALES CORPORATION One South Wacker CAP Team 1st Shift Drive, 24th Floor, Chicago, IL 60606-4650 (312) 236-SALE You can also visit The CAP Team 2nd Shift Judicial Sales Corporation at www.tjsc.com Exactly as in print for a 7 day status report of pending sales. Wage Increase Up To CODILIS & ASSOCIATES, P.C. 15W030 $10 - $10.50 After 6-Month NORTH FRONTAGE ROAD, SUITE 100 Completed Additional Training Call to order BURR RIDGE, IL 60527 (630) 794-5300 E- Mail: [email protected] Attorney Apply At The Hiring Center Kiosk your online File No. 14-15-17167 Attorney ARDC No. In Store Or Online At 00468002 Case Number: 13 CH 00084 TJSC#: www.Walmart.com subscription today 36-457 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attempting to collect a debt and any information obtained will be used COUNTY JOURNAL for that purpose. I684855 2206 State St. • Chester • 826-5041 1101 E. Pine / Percy / 497-8272 ...... 0-3-17 Page 32 County Journal March 10, 2016 Egyptian to hold FREE THURSDAYS It All Adds Up, LLC Bring Your Own Container Bookkeeping & Accounting And Receive One Free Popcorn Fill With Your Movie Ticket Purchase Fast • Professional • Personal member meeting Offer Valid Thursdays Only. One Per Person. Free Popcorn www.spartashowtime.com Equivalent To Medium Size Popcorn. (Approx. 130 oz.) ★★ MOVIE HOTLINE 443-1234 ★★ Showtimes March 10-17 INCOME TAX PREPARATION Egyptian Telephone Cooperative will hold a mem- bership meeting at the Steeleville Legion Friday, 10 Cloverfield Lane ZOOTOPIA LONDON HAS FALLEN PG13 PG R BIGGEST REFUND April 1 at 5 p.m. Thurs. 7:00 Thurs. 7:15 Thurs. 7:20 Fri. 4:20, 7:05 & 9:35 Fri. 4:30, 7:15 & 9:45 Fri. 4:15, 7:20 & 9:40 Best Price AVAILABLE Ricky Rover Rooter Roasters will serve bar-beque Sat. 1:05, Sat. 1:10, Sat. 1:45, 4:15, Guarantee! from 5 to 7, and business will begin at 7:15. 3:35, 7:05 & 9:35 3:45, 7:15 & 9:45 7:20 & 9:40 Sun. 12:10, Sun. Noon, Sun. 12:25, Call For An Appointment Members are advised to arrive early because the Gail Knop, MBA 2:40, 5:20 & 7:50 2:30, 5:00 & 7:30 2:50, 5:10 & 7:40 Registered Tax Return Preparer (618) 965-3456 first 50 members will receive an early bird gift. Mon. - Thurs. 7:05 Mon. - Thurs. 7:15 Mon. - Thurs. 7:20 After the business session, there will be a draw- DEADPOOL Risen PG13 Gods Of Egypt ing for other prizes. R Thurs. 7:05 Thurs. 7:25 Fri. 4:10 & 9:30 PG13 Fri. 7:00 Members will elect three directors for three-year Fri. 4:40, 7:25 & 9:55 Sat. 1:00 Sat. 3:50, 7:00 & 9:30 terms to the board. Sat. 1:25, Sun. 12:05 & 7:55 Sun. 2:55 & 5:25 Looking at Bankruptcy? 4:00, 7:25 & 9:55 Mon. & Wed. 7:00 Tues. 7:00 The nominating committee has selected Rudy Sun. 12:15, 2:45, Eggemeyer, Don Hamilton and David Ibendahl as 5:15 & 7:45 Miracles PG The Divergent Series: How long will it take? nominees. Other nominees will be selected by pe- Mon. & Tues. 7:25 From Heaven Allegiant PG13 How much does it cost? If You Haven’t Seen Our Newly Opens Thurs. 3/17 tition or from the floor. Renovated Theater – Please Opens Wed. 3/16 Check Us Out! You’ll Love It! Wed. & Thurs. 7:10 Thurs. 7:00 Will I lose everything? What are the new laws? P’ville church to Do I qualify? You have the host Easter musical Come In For questions, let me help The First Baptist Church of Pinckneyville will present “Glorious Day,” an Easter musical from with the answers. Word Music. SPRING S P E C I A L S ★ FREE INITIAL CONSULTATION ★ The program showcases a mix of new and famil- iar songs. Get Discounts Or Free Merchandise Full Range of Services including Credit Counseling, It will be presented by the Community Choir in Credit Education, Notices, Hearings and More Pinckneyville Wednesday, March 23 at 7 p.m. The public is invited. RANDOLPH The church is located at 105 Mill Street. Mary L. West MONUMENT Attorney at Law WORKS PO Box 654, Sparta, Illinois 62286 Serving Families Since 1900 (618) 443-4940 County Journal Samantha Davis, Manager e-mail: [email protected] 701 W. Broadway • Steeleville “We Are A Debt Relief Agency. We Help People File IT’S NOT THURSDAY WITHOUT IT! 965-3333 For Bankruptcy Relief Under The Bankruptcy Code.” E. PINE •Get PO BOX 369 • PERCY your• 497-8272 paper from your computer! Exactly as in print
Call to order your online subscription today
COUNTY JOURNAL 1101 E. Pine / Percy / 497-8272