WWW.TRIANGLE TRIBUNE.COM The Triangle Winston-Salem chancellor retires
RIBUNE with legacyBy Donna Rogers intact TTHE TRIANGLE’S CHOICE FOR THE BLACK VOICE THE CHRONICLE WINSTON-SALEM – It was a long time coming, but Donald J. Reaves, 68, achieved his desire to be the leader of a historically black VOLUME 16 NO. 24 WEEK OF JANUARY 11, 2015 $1.00 college or university. “I always said that I would like to lead an HBCU,” he said in an interview. His career path took him to opportunities to be high in the chain of command, such as chief financial of- Hillside girls and ficer, but the Winston-Salem State chancellorship allowed him to be a chief executive officer. Jordan boys “This job was kind of the capstone in higher education,” he split Tuesday said, because it called for all of the skills he had developed over several decades. His chancellorship ended on Dec. 31. night in junior Reaves said what he takes the greatest pride in is: “I believe Reaves that our body of work in Winston-Salem over the last seven varsity action. years has resulted in improved perceptions of the institution by virtually every constituency that matters. (Six or seven years ago) “This institution wasn’t held in the highest esteem. We think that we made a lot of progress in that regard. We’ve improved the quality of everything.” Please seeCHANCELLOR/2A WCPSS board discusses strategyBy Latisha Catchatoorian Sickle cell [email protected] CARY – The Wake County Public Schools System Vision trait 2020 strategic plan is still in the works as team members continue to iron out details – right down to the wording of related to certain statements. Board and committee mem- bers met Tuesday to discuss the plan during its work ses- kidney sion. Also on the agenda were school enrollment caps. Marvin Connelly, co-chair of PHOTO/LATISHA CATCHATOORIAN diseaseBy Latisha Catchatoorian the strategic plan work team, said they had over 11,000 re- A resident rides through the Washington Terrace complex on a sunny afternoon. [email protected] spondents to a countywide African-Americans who carry survey on the plan. A town the sickle cell gene face up to a hall meeting drew 700 partic- twofold risk increase for chronic ipants. kidney disease, according to the “Our strategic plan work Journal of the American Medical team convened with commu- Association. The outlined find- nity and business leaders, Bright future for ings in a published paper of the board of education members, journal include data from nearly principals, teachers, students 16,000 people. and central services staff. The sickle cell gene carries po- slowly redevelop the property for These teams met every two By Latisha Catchatoorian $548. tential for the hereditary disease residents. weeks over a three month pe- [email protected] TerraceLast December DHIC received a sickle cell anemia, which is ab- “It would be done in phases, but riod to synthesize all the $150,000 grant from Wells Fargo normally shaped red blood RALEIGH – Washington Terrace, it would certainly look to provide input taken from the stake- & Company Housing Foundation cells. These crescent shaped a well-known affordable housing affordable replacement housing holders,” he said. “As the re- to support the revitalization of cells make it hard for blood to complex in Southeast Raleigh, for the residents there,” he said. sult of this work, the team Washington Terrace. flow in the blood vessels, caus- looks like any other neighbor- No residents are being pushed developed vision, mission “This grant from Wells Fargo ing discomfort and various hood. You can see a little boy out, but the units whose tenants and core belief statements, as will be used to expand affordable health problems. walking his dog, neighbors talk- do move out are being left vacant well as a goal statement and housing opportunities for fami- Dr. Rakhi Naik, Johns Hopkins ing outside their homes, and the for now. Employees in the leasing key objectives.” lies in our community,” Warren University assistant professor of remnants of holiday decorations office said they were not allowed Phil Kirk, also a co-chair of said in a press release. “It demon- medicine and the paper’s first on various front doors. to comment on the new manage- the work team, said school Su- strates the confidence Wells Fargo author, said she wanted to in- Early last year, DHIC Inc. offi- ment or serve as a spokesperson perintendent Jim Merrill has in DHIC and the belief that vestigate the possible conse- cially purchased the property for DHIC, but did say that they are asked him to take on the re- community revitalization of quences of having the sickle cell with a $3 million loan from Com- currently not leasing to any new sponsibility, and the whole Washington Terrace is important trait. munity Housing Capital after re- residents. team worked hard. Merrill for the City of Raleigh.” “It’s generally under-studied. ceiving approval from the Raleigh “When they move out, they said they wanted to create a Though official phases of revi- There’s conflicting information City Council. Previous property (property owners) aren’t opening plan that represented all audi- talization have yet to commence, and scant evidence out there owner Ocwen Financial Group ac- them back up,” said resident ences and all desires. residents seem happy with the about the implications of (sickle cepted a bid of $4.75 million in Sarah Turner, who speculated it’s Vision 2020 lays out this vi- new management and the way November 2013. DHIC is the Tri- because DHIC plans to renovate Please seeSICKLE CELL/2A sion statement: “All WCPSS things are going. angle’s oldest and largest non- the apartments and doesn’t want students will be prepared to In 2013 real estate company profit housing organization to have to ask people to move reach their full potential and Cushman & Wakefield sent out a “dedicated to the development of when the time comes. lead productive lives in a prospectus on the property call- high-quality housing communi- The rents have not gone up – complex and changing ing it a place “ripe for gentrifica- ties” in the area. yet. Warren previously assured world.” tion” which set some residents on House Before the official purchase, that rents would remain low with School board member edge. Warren previously said that DHIC President Gregg Warren said modest increases from year-to- Susan Evans said a vision the last ownership was “without that over time they were going to year. Rents currently average statement helps them focus Please see TERRACE/2A speaker and “hopefully provides us some unity of direction.” She said they wanted the state- ment to be focused on the talks students and not on the school district. The vision statement should speak to what educators want students honestyBy Gary D. Robertson to do beyond graduation. Associated Press “WCPSS will provide a rele- vant and engaging education, Caucus chair has big RALEIGH – Tim Moore has and will graduate students spent almost all his life in Kings who are collaborative, cre- Mountain, an old textile town ative and critical thinkers,” more than 150 miles southwest the mission statement reads. By Herbert L. White than the previous, and so I’ve got Butterield is cautiously optimistic, of Raleigh with perhaps more in Board member Christine [email protected] some big shoes to fill and I’m pre- especially with a reduction of Tea common with South Carolina ideas forpared for the challenge.”CongressParty influence. than North Carolina. Its name Kushner discussed the pro- U.S. Rep. G.K. Butterfield originates from the Revolution- posed goal statement: “By spent his first day as chair of The CBC’s membership is over- “The first challenge is to see what ary War battle just south of the 2020, WCPSS will annually the Congressional Black Cau- whelmingtly Democratic, with posture the Republicans will take in state line. graduate at least 95 percent of cus sizing up Capitol Hill. Utah freshman Mia Love the lone controlling the flow of business in the But the small-town attorney its students ready for higher Congressional Republicans, Republican to express an interest Congress,” he said. “They’re in control never has been too far from the education, career, and pro- who control the U.S. House of in joining. U.S. Sen. Tim Scott has of both the House and the Senate and thick of North Carolina politics ductive citizenship.” Representatives and Senate. declined membership and Rep. there have been some overtures pub- as an adult, from a university This statement ignited a lot The caucus, made up of 46 Will Hurd, a freshman from licly from the Republicans that they student government leader to of conversation and debate. African-American lawmakers. Texas, has not indicated his in- will work in a bipartisan manner. the parliamentary traffic cop Kushner said the work team Himself, the caucus’ 24th tentions. We’re in a wait and see mode. We’re and agenda enforcer in the state discussed having a singular chair. Hurd, like Love, represent a hoping the Republicans will govern House. goal versus various goals and Butterfield, a Democrat mostly white district. from the center, or at least near the As Rules Committee chairman landed on something singular from Wilson, N.C., has a goal: In seizing control of the Senate center and we will be able to get bipar- under House Speaker Thom that would be quantifiable. forge links to pass legislation in November’s elections, Republi- tisan legislation passed.” Tillis, however, Moore avoided She said the goal statement that impact underseved com- cans hold the legislative initiative High on the CBC agenda is job cre- the worst relational pitfalls the “would be our elevator munities. in Washington. GOP leaders, in- ation and mending the social safety position can bring when decid- speech” when talking to a par- “It’s my challenge now to cluding House Speaker John net, which haven’t recovered from the ing whose bills get heard. It ent or business inquiring equal or surpass the accom- Boehneer of Ohio and Senate Ma- Great Recession. helped him cobble support about WCPSS. plishments of my predeces- jority Leader Mitch McConnell of “There’s no one in the House who from fellow Republicans to be “I see this as having an im- sors,” he siad. “I think each Kentucky have indicated a will- would disagree with the need to create the party speaker nominee to pact all the way down to the two years should be better ingness to build consensus across the aisle. Please seeCAUCUS/3A Please see WAKE/2A Please seeSPEAKER/3A
Index Follow The To subscribe: 919-688-9408 or Tribune on Editorial 4A Sports 1B Email: [email protected] Focus 6A Classifieds 4B Arts & Life 5B Religion 6B © 2015 The Triangle Tribune 2A NEWS/The Triangle Tribune Sunday, January 11, 2015 Bright future for Sickle cell trait related
Continued from page 1A African-Americans generally suffer chronic kidney disease at higher rates tocell) trait,” kidney she said. “There have been na-disease Washington than whites and Asian-Americans. Further tional pushes for screening in many dif- research is required to definitively deter- ferent contexts, but really, not much is mine whether SCT is at play. known about sickle cell trait. And as “These findings suggest that sickle cell physicians, we don’t know specifically trait, which is present in about 8percent of what to do with that screening informa- TerraceContinued from page 1A housing residents voucher has lived in community partnerships and African-Americans, appears to be one fac- tion.” the best interest of the resi- the complex for three years. development, expressed sim- tor that contributes to the higher burden People with SCT inherit a sickle cell gene dents in mind,” and DHIC is She said she’s struggled with ilar sentiments saying that the of kidney disease among that population. copy from one parent. The SCT usually dedicated to making residents no safety or maintenance con- residents are “who she cares This study highlights the need for addi- doesn’t present disease symptoms. Sickle its priority. cerns. Police ride through the about.” tional research into the health conse- cell disease/anemia occurs when a person Turner said things like neighborhood frequently. “In many ways, this brings quences of sickle cell trait,” said Dr. Alex inherits a SCT from both parents. About maintenance are good and got “I love living here,” she said. us full circle,” Warren said in Reiner, a professor of epidemiology at the one in 12 African-Americans has SCT, as better once DHIC took over. “(I like) the community, the the press release. “Forty years University of Washington School of Public do 30 million people worldwide. Though “I can call down there (to the people at the office are nice, ago, DHIC began by renovat- Health. Reiner, a member of the Public oftentimes considered an “African” dis- leasing office) right now, and and (I’m) close by the store.” ing and rebuilding homes in Health Sciences Division at Fred Hutchin- ease, the trait is also found in populations they send somebody right up Warren formerly told The the adjacent College Park- son Cancer Research Center in Seattle, in the Middle East and India. here,” she said. Tribune that DHIC’s first Idlewild neighborhood, and Washington, co-led the project and is a co- Dr. James Wilson, University of Missis- An anonymous resident focus will be to get to know now we have an opportunity senior author of the paper. sippi School of Medicine professor of who moved to Washington the residents and then focus to transform the community Reiner said the findings might have im- physiology and co-senior author of the Terrace to accommodate her on redevelopment. Yvette at Washington Terrace.” plications regarding screening and/or Holmes, DHIC director of paper, said although the findings are sci- more closely monitoring kidney functions entifically impactful they shouldn’t cause in those who carry SCT. public alarm. “Since screening for the sickle cell mu- “The overall message for people with tation is already widely performed in the sickle cell trait is that they are still healthy U.S., these findings present additional people. They are at a modestly increased public health and policy implications,” he risk for chronic kidney disease,” he said. said.
PHOTO/LATISHA CATCHATOORIAN Board members discuss the strategic plan during their work session. WCPSS board talks strategic planContinued from and page 1A enrollmentvision, and belief statements capscaps in the 2015-16 school roots of our system,” board which we revisited through year, which is down from the member Bill Fletcher said. the day.” 20 capped schools this year. Evans expressed apprehen- Rodney Trice, WCPSS assis- Caps at 14 schools would be sion at first about putting out tant superintendent for equity removed, caps at six schools such a high quantifiable goal affairs, said his working team would be kept, and new caps in fear of perhaps not meet- wanted to address skill would be implemented at five ing it, but said one was deficits, push kids to do and schools. needed (in reference to the 95 be more, and employ the use “A cap does not necessarily percent graduation rate.) of “multiple measures” to mean that students will be TICKETS START AT $15! Leaders of objective work- think about the students and turned away,” reads a WCPSS JAN 21 – FEB 8 ing teams then discussed possibly move beyond End- press release. “Of the 20 PLAYMAKERSREP.ORG 919.962.PLAY strategies and measures in re- of-Grade testing practices. schools with enrollment caps Paul Green Theatre, Center for Dramatic Art, UNC-Chapel Hill Kathryn Hunter-Williams; Photo by Andrea Akin gards to topics such as learn- “Students often have these this year, only 12 had to di- ing environments, increasing experiences where we take vert students to overflow proficiency and growth rates them through these remedial schools as of the first day of across all groups, and the de- steps, but don’t necessarily school. And some of those velopment and implementa- have many opportunities to schools invited base students tion of a balanced assessment think bigger or consider very back mid-year as seats Now Hiring Hourly system that accurately re- challenging and difficult ma- opened. A cap does mean that flects students’ knowledge of terial,” he said. “So we were if a school’s population core curriculum standards. very intentional about provid- reaches its capacity, any new “I’m very proud of the work ing students with a high qual- students who moved into the Retail Associates of the team,” said Todd Wirt, ity learning experience. One area after the date the cap was team leader and WCPSS assis- that was rounded in real imposed would be assigned Full-time, tant superintendent for aca- world issues and problem to an overflow school.” demics. “Each team worked to solving.” A decision will be tenta- Part-time & Seasonal develop strategies… These The last item on the work tively made by Jan 20. are the essential strategies session agenda was enroll- To view a copy of the pres- Positions available in all that we believe create the type ment caps. The proposal re- entation and proposed strate- departments, including: of foundation that is neces- duces the number of capped gic plan visit: Opening sary to stay very tight to the schools by nearly 50 percent. http://bit.ly/1s5t0aT. goal, and the mission, and the Eleven schools would have Soon • Hunting • Camping in Garner, NC! • Fishing • Gifts • Backend • Footwear The World’s Foremost • Gun Counter • Customer Outfitter is expanding • Clothing Service Winston-Salem State and is hiring Full-time, Part-time and Seasonal • Camo • Cashier employees to join our University chancellor Garner Retail Store, scheduled to open Apply online at www.cabelas.jobs retiresContinued from page 1Awithing chancellor legacy for WSSU and mission intact standards. Tradition- Spring 2015. and view Job #18263BR. ally, HBCUs have lowered Reaves started work at positioned the campus for fu- Cabela’s is an Equal Opportunity Employer and seeks to create an inclusive workplace that embraces diverse WSSU on Aug. 16, 2007. He ture success,” UNC System standards in order to attract backgrounds, life experience, and perspectives. BGC and Drug Testing required. had been at the University of President Tom Ross said. students who had not Chicago from, where he was “Under his leadership, WSSU reached their full potential. vice president for administra- has raised academic expecta- However, Reaves believed tion and chief financial offi- tions, strengthened the cur- that the better the student, cer. Before that, he had been riculum, improved the more likely he would executive vice president for fi- graduation and retention graduate. nance and administration and rates, and expanded graduate He has been vindicated. chief financial officer at education in select high-de- Graduation rates have risen to Brown University during a 14- mand fields.” the point that President year tenure. Ross said that Reaves “has Barack Obama’s administra- “As I look at all the statistics also streamlined operations tion has taken note of it. that indicate the accuracy of to more effectively target “Cleaning up some of those that direction, I am amazed scarce resources, overseen policies, cleaning up some of that so much has been accom- the development of a campus those requirements, also have plished in what is a relatively master plan and strengthened helped students clear their short time in academic envi- partnerships within the sur- path from beginning to end,” ronments,” said rounding community.” Allen said. “It all kind of came Debra Miller, chairwoman of Miller called Reaves “a together to dramatically affect the WSSU Board of Trustees. courageous leader who has the graduation rate in a short “Donald has certainly moved never been afraid to make period of time.” the university forward, and right and hard decisions. No Reaves said his goal was we have benefited from his one could ever doubt where simple: “I want to improve expertise and his commit- he stood no matter the chal- outcomes for students. I want ment.” lenge he faced or the contro- them to be better prepared WSSU is part of the UNC Sys- versy that might ensue.” when they leave here to suc- MAVIS STAPLES tem of North Carolina univer- And there have been chal- cessfully compete in the 21st sities. lenges along the way. For in- century global economy.” “By any measure, Donald stance, Reaves faced strong Jan 30, 2015 • 8pm•$35 opposition when he raised ad- Reaves has been an outstand- From the delta-inflected gospel sound she helped create in the 1950s (“Uncloudy Day”), to the engaged protest of the civil rights era (“Freedom Highway”), and then, amazingly, on pop radio in the 1970s with a series of chart hits (“I’ll Take You There,” “Respect Yourself,” “Lets Do It Again”)—Mavis Visit us online for the Staples isasoul/gospel legend, Rock and Roll Hall of Famer, and civil rights icon. Rolling Stone lists her as one of the 100 Greatest Singers of All Time. latest news and information. Our Media Partners: Go to www.triangletribune.com WINGATE UNIVERSITY battecenter.org • 704.233.8300 3A NEWS/The Triangle Tribune Sunday, January 11, 2015 Likely NC speaker talks Elected black Republicans’ Continued from page 1A the student council at Camp- banning gay marriage and "I'm not taking time away honesty,succeed Tillis, who's now en- bell University bipartisanship before trans- said he would continue to from my kids and my busi- tering the U.S. Senate. ferring to UNC-Chapel Hill, legally defend the prohibition ness and everything else to be where he quickly became the as speaker even though up here just to get into politi- impact debated "I was always honest with everybody," Moore, entering speaker of the Student Con- judges struck it down in Oc- cal grudge matches," said his seventh House term, said gress. tober. Still, Moore said his Moore, the father of two sons. in a recent interview with The "He was quite the rising star focus as speaker would be on As rules chairman, Moore Associated Press, adding, "I'd in terms of campus politics," job creation and industrial re- had plenty of opportunity to in communityBy Freddie Allen make enemies within both treat my colleagues the way said state Insurance Commis- cruitment, and that people NATIONAL NEWSPAPER PUBLISHERS ASSOCIATION I'd want to be treated." sioner Wayne Goodwin, a De- would be hard pressed to find parties. While hard feelings in- Moore is expected to win mocrat who interacted with someone "who's felt like I've variably occur, lawmakers WASHINGTON – Black Republicans made history during the speaker's post when the Moore in student government treated them discourteously and legislative aides agree he the midterm elections in November by winning in Texas, full House votes Jan. 14, since while Goodwin was a UNC law or not treated them fairly dodged the levels of enmity South Carolina and Texas. But political analysts wonder if Republicans hold 74 of the school student. based upon their lifestyle some previous chairmen have the victories will have any long-term impact on the future chamber's 120 seats. Unoffi- Moore generated a firestorm choices." received. of the GOP in the black community. cially, his job will be to extend while UNC-Chapel Hill After time on the UNC sys- "He was accessible to the Traditionally, black candidates running for elected offices recent political successes for speaker when he attempted tem Board of Governors and membership," said Rep. David not only need a large black turnout, but also a majority of the GOP, which didn't control to prevent the Carolina Gay as Cleveland County Republi- Lewis, R-Harnett, who went to the black vote to win statewide and national races. both General Assembly cham- and Lesbian Association from can Party chairman, Moore Campbell with Moore and is Senator Tim Scott made history by becoming the first bers simultaneously for 140 receiving student activity joined the House after nar- expected to succeed Moore as black Republican elected to serve in both the House of Rep- years until 2011. There will funds. Moore said he doesn't rowly defeating then-House rules chairman. resentatives and the Senate. He won with just 10 percent of also be expectations for him regret his actions at the time, Majority Whip Andy Dedmon Democrats complained the black vote and 82 percent of the white vote, according to be a strong negotiating which angered many on cam- in 2002. Moore used parliamentary to exit polls. counterweight to Senate pus. Moore found paths to ac- procedure dozens of times to Representative-elect Will Hurd beat his Democratic chal- Leader Phil Berger and work "At the heart of the issue complishment while Republi- cut off floor debate. Rep. Jean lenger Pete Gallego in Texas by a narrow 2.1 percent mar- well with Gov. Pat McCrory. was the belief that we should- cans were in the minority or Farmer-Butterfield, D-Wilson, gin in a predominately Hispanic congressional district Moore, 44, grew up in Kings n't use taxpayer dollars or stu- shared power with Democ- is hopeful Moore would as- (House District 23) to become the first black Republican Mountain, working in his fa- dent fees to fund a gay and rats. He cites overwhelming semble important legislation from Texas elected to Congress since Reconstruction. ther's convenience store as a lesbian group, as well as a lot passage of a measure he co- that both parties can support When the next congressional term begins, Mia Love, a youth. The younger Moore of other groups for that mat- sponsored in 2007 to toughen but as rules chairman, "he'll black Mormon and daughter of Haitian immigrants, will got interested in politics as a ter," he said. penalties for child sex offend- listen to what you have to say, represent Utah’s 4th House district in a state where blacks teenager, putting up cam- Moore supported the 2012 ers as proof he wants biparti- but I think ultimately his account for just 1.3 percent of the total population. paign placards. He served on constitutional amendment san legislation passed. agenda is what comes out on Howard political science professor Lorenzo Morris said top." the black community shouldn’t expect much from black Republicans during the next legislative session, because they won largely without black voters. In addition, he said, their rank as freshmen lawmakers will limit their influence within the party. “Their collective impact, if they are really outspoken, will just be on the plus side of zero, barely zero,” Morris said. “The obvious impact for Republicans is positive only to the extent that it shows visually, if not substantively, an out- reach to minorities.” Scott earned an “F” on the NAACP’s legislative report card during the first session of the 113th Congress from Jan. 2013 to Dec. 26, 2013. ThinkProgress.org reported that Scott proposed a bill in 2011 to block families from receiving food stamp benefits if one of the adults in the home joined a strike, and, as a state legislature, Scott supported cuts to South Carolina’s HIV/AIDS budget. In a 2012 speech, Love accused President Barack Obama of “pitting us against each other based on our income level, gender, and social status” and said that, “His policies have failed.” Love has also pledged to take the Congressional Black Caucus “apart from the inside out.” If they continue to express views counter to those held by the black electorate that overwhelmingly supported Presi- dent Obama with more than 90 percent of their votes in back-to-back elections, Morris said, their presence could ac- tually hurt that visual image of minority outreach, because it will further distance the GOP from the politics that are overwhelmingly characteristic of black voters. Former congressman Allen West (R-Fla.) said the Repub- lican Party has to remind black voters that the conserva- tive principles and values of the GOP are quite consistent with the history of the black community. “When you go back and read Booker T. Washington’s writ- ings at the turn of the century, his remedy for the black community under the stress and strain of segregation and Jim Crow laws were three points: education, entrepreneur- ship and self-reliance,” West said. “When you look at each one of those individuals, Sen. Tim Scott, representatives- elect Mia Love and Will Hurd, that’s what they represent, and those are the three things we must have conversations about in the black community.” West compared the overwhelming loyalty black voters have for the Democratic Party to an investor that puts all of his eggs in one basket. “The people in these majority-minority districts are going to have to look up and say, ‘Why are we still in this situa- tion? Why do we continue to elect the same person and nothing is getting any better?’” he said. FILE PHOTO U.S. Rep. G.K. Butterfield (D-N.C.) is chair of the Congressional Black Caucus. Do you or a loved one STRUGGLE on the stairs? We have the AFFORDABLE solution!
LIMITED TIME OFFER! $250 OFF* PURCHASE OF A NEW STAIRLIFT! EXPIRES February28,2015 Caucus chair 1-800-862-9614 CALL NOW TOLL-FREE *Certain restrictions apply. Continued from page 1A thing very simple such as said that many times. I belive “But if you’re willing to American jobs,” he said. “The body cameras. They ought to President Obama is willing to come into the process and it’s hasquestion is how do we do itbigagree on that. Who would plans not negotiate with the Republi- just your way or no way, that and the best way to do it. I’m want to document to film an cans on some very important it’s cutting spending and optimistic.” arrest, especially if it’s a dan- issues. I know that for a fact, nothing else and cutting triangletribune.com Criminal justice reform is gerous situation?” and I can tell you Democrats spending irresponsibly, then also a rallying point for black Butterfield is optimistic are willing to do the same. we’re going to have a fight.” lawmakers, especially in the Congress will be open to wake of police-involved fatal- working with the White ities of African-Aemricans in House, where President New York City and Ferguson, Obama has struggled to gain Mo., that sparked protests traction with lawmakers for around the counrty. The cau- most of his six years in office. MLK, Jr. Dreamfest 2015 cus will push for funding for With Republicans in control of Capitol Hill, and Obama hold- police body cameras to be Celebrate the spirit of Dr. Martin Luther King, Jr. worn by officers on the job to ing the power of veto, Butter- document their interaction field sees an opening for at these Cary community events! with civilians. cooperation between the leg- “Right now, there is a dis- islative and executive Jan. 16 | 7-9p.m. Women of Action Gathering branches. Page-Walker Arts & History Center trust between the black com- Jan. 17 | Noon - 3 p.m. Dream of Community munity and law enforcement “I’m hoping there’s an op- portunity,” he said. “President Special Guest, Mrs. Naomi King officers,” Butterfield said. “I The Cary Theater would hope (Republicans) Obama certainly will never run for office again and he’s Jan.18|3-5p.m. AnArts Tribute to Martin would join with us for some- Page-Walker Arts & History Jan.19|10-11:45a.m. Dream of Democracy March Downtown Raleigh – reservations required for free transport Jan. 19 | 10 a.m. & 2 p.m.DayofService Middle Creek Community Center – advance sign-up required Jan.19|12:30-1:30p.m. Appreciation Celebration Middle Creek Community Center
------All these Dreamfest events are FREE & open to all! For more, call (919) 460-4963 or visit www.townofcary.org and search “Dreamfest 2015”
Co-Sponsored by the MLK Jr. Task Force of Cary, JMG and the Town of Cary Parks, Recreation & Cultural Resources Department The Triangle Tribune 4A OPINIONS/ Sunday, January 11, 2015
Reshaping“New York, New York, big matedthe 1 millionhip-hop people in response agenda to emergency calls incommunities 2015 safer. They city of dreams, but everything Times Square, and it may as in the black neighborhood? have decided to stand down in New York ain’t always what well have split in half. What does it mean when the instead of being a crime-sav- it seems. You might get fooled Despite the out-of-towners New York Post reports that ing force swooping on the if you come from celebrating by standing in the number of arrests scene. out of town, but I one place for more than nine dropped 66 percent since I think essentially that is 115 Market Street, Suite 360G am down by law hours, no one is willing to the tensions between the what people are really asking for. Why did it have to take Durham, NC 27701 and I know my compromise; no one is will- police unions and the mayor way around.” – ing to see each other’s point began? Are the police staging the murder of two officers to Grandmaster of view and no one can see a silent protest with hopes get to this softer approach? Even so, this is an opportu- Gerald O. Johnson Flash and the an end to this madness. people will see the impor- Furious Five Mayor Bill De Blasio recent- tance of their work? Are they nity to branch out and show PUBLISHER ly met in a closed door meet- willing to sacrifice more lives the world who we really are. JINEEA ing with Police by not responding to calls? Our story for years has been Bonitta Best Since the trag- BUTLER ic murder of Commissioner Bratton and Are we headed back to the “they” are holding us back. MANAGING EDITOR two NYPD offi- union leaders and reportedly days of police not showing While we know there are sys- cers, New York City has been came up with nothing. up for hours in certain neigh- tematic hurdles, we also in disarray. It has been a con- Former mayor Rudy Giuliani borhoods when people are in know they can be avoided. stant back and forth between entered the fray by saying need? Now that we have some cops and protesters objecting that De Blasio should apolo- When the police ignore room to breathe, let’s take to police practices, the mayor gize to the boys in blue for daily quotas in favor of safe- full advantage. Scalise should siding with the people he insulting them with his com- ty and the crime rate doesn’t The new year has begun, serves, and the police com- ments and siding with pro- shoot through the roof, it and we need to reshape our missioner battling disrespect- testers. may imply that the current agenda. On Jan. 13–15 at the ful officers who want to be Do you remember Flavor system is flawed. Police all of Sheraton Times Square in be removed respected by all of the above. Flav of Public Enemy’s debut a sudden know what not to New York City, the Hip Hop After a phenomenal election last November in which The Big Apple dropped on solo, “911 is a Joke,” a refer- do to disrupt people’s lives Union will join the Rev. Jesse Republicans increased their margins in the House and New Year’s Eve with an esti- ence to the delayed or non- in the name of making the Jackson Sr. for the 18th took control of the Senate, the expectation was that con- annual Wall Street Project gressional Republicans would prove to the country that Economic Summit. The they could lead like mature adults. But as the adage theme is “Where Wall Street, goes, “They never miss an opportunity to miss an Main Street, and Silicon opportunity.” Valley Converge.” Specifically, House speaker John Boehner and the rest The Hip Hop Union started of his leadership team had a great opportunity to show a crusade five years ago to that they understood the optics of 21st century politics. resurrect Dr. Martin Luther Two weeks ago, it was reported that House Majority King’s last initiative, I AM A Whip Steve Scalise, the No. 3 person in the GOP House MAN. We continue in our leadership, had addressed a group of white suprema- efforts to complete his mis- cists in 2002. sion with the I AM A CITIZEN I think Scalise could have survived the fact that he campaign. Dr. King said, attended this racist gathering simply by being honest “The next phase of the move- about the fact that he attended and it was a huge mis- ment is economic.” take. He could have asserted that his body of work in Ed Lover will host our fifth public office has proven that his views are not consis- anniversary VIP toast and TV tent with what the European-American Unity and Rights launch party on Jan. 15. Organization represent. There, we will unveil our He still would have taken some heat in the media for Super PAC Hip Hop United a few weeks, but it would have gone away. But, no, and our Entrepreneur Co- Scalise’s initial response by his spokeswoman, Moira operative, which will allow Bagley was, “he [Scalise] was unaware at the time of the members and friends of the group’s ideology and its association with Hip Hop Union to share in racists and neo-Nazi activists…through- the fruits of wealth building. out his career in public service Mr. Scalise Together, we will build a has spoken to hundreds of different new foundation for econom- groups with a broad range of view- ic empowerment and a polit- points…In every case, he was building ical force to combat injus- support for his policies, not the other way tice. around…In 2002, he made himself avail- able to anyone who wanted to hear his pro- RAYNARD posal to eliminate slush funds that wasted JACKSON millions of taxpayer dollars as well as his opposition to a proposed tax increase on middle-class families…He has never been EdSandwiched Brooke between the Senate, doesn’t Brooke served two getThough his fellow due Republican public housing tenants’ out- affiliated with the abhorrent group in deaths of former New York terms as attorney general of Richard Nixon was in the White of-pocket rent expenditure question…The hate-fueled ignorance and intolerance Gov. Mario Cuomo and popu- Massachusetts. When he House, Brooke opposed Nixon’s to 25 percent of the resi- that group projects is in stark contradiction to what Mr. lar ESPN sportscaster Stuart came to Washington, he attempts to abolish the Office of dent’s income, a percentage Scalise believes and practices as a father, a husband, Scott, the declined to join the Economic Opportunity and the that has since increased to and a devoted Catholic.” passing of for- Congressional Black Caucus Job Corps and weaken the Equal 30 percent. In politics, it is said that the cover-up is worse than the m e r and told Time magazine: “I Employment Opportunity With the Voting Rights Act original sin. The Scalise affair is Exhibit A. Massachusetts do not intend to be a Commission. And when Nixon up for renewal in 1975, As one who has spent his entire adult life working on S e n a t o r national leader of the Negro nominated Clement Brooke engaged in an political campaigns, I know that no politician speaks at Edward W. people. I intend to do my Haynsworth and Harrold extended debate with John an event without knowing all the particulars surround- Brooke III at job as a senator from Carswell to the U.S. Supreme Stennis (R-Miss.) on the ing the event: who is the convener, the purpose, the the age of 95 Massachusetts.” Court, Brooke was part of a Senate floor that resulted in audience, etc. Because Scalise and his staff tried to feign did not get While doing his job, bipartisan coalition that the landmark measure being ignorance, he should be forced to step down from his nearly the Brooke showed – as did sev- blocked the appointment of the extended and expanded. He leadership position. His response is an insult to anyone attention it eral black Republicans who two nominees who were consid- was also part of the team of with a brain – and any sense of morality. GEORGE deserved. would later follow him in ered hostile to civil rights. legislators who retained Title The organizer of the event was none other than David URRY Though two public service, including On Nov. 4, 1973, Brooke IX that guarantees equal edu- Duke, former Grand Wizard of the Ku Klux Klan. The E. C A f r i c a n - assistant secretary of labor became the first Republican to cation to females and the national Republican Party had been playing footsie with Americans were Arthur Fletcher in the Nixon call for Nixon’s resignation after Equal Credit Act, a measure Duke and the likes in the early 1990s and thus were inti- elected to the U.S. Senate dur- administration and secre- the famous “Saturday night that gave married women mately familiar with who he was. ing the Reconstruction era by tary of transportation massacre” that took place when the right to have credit in Without the likes of Duke, Newt Gingrich would have the Mississippi legislature – William T. Coleman Jr. Nixon ordered the firing of spe- their own name. never become speaker of the House in 1995. So, for Hiram R. Revels and Blanche under Gerald Ford – that he cial prosecutor Archibald Cox In 1967, Brooke served on Gingrich, Boehner, McCarthy, etc. to try to explain K. Bruce, both Republicans – could be a black Republican after Cox issued a subpoena for the 11-member President’s Scalise’s attendance before this group as a mistake is an Brooke was the first black without selling out his prin- copies of Nixon’s taped conver- Commission on Civil outright lie. It was done with full knowledge of who the elected to the upper chamber ciples or abandoning the sations recorded in the Oval Disorders, better known as group was and what it stood for. by popular vote, beginning fight for civil rights. Office. the Kerner Commission, This scandal has nothing to do with “racism” or his term in 1967. What made When Barry Goldwater Brooke assumed an offensive which was established by whether Scalise is a racist. This is about telling the truth, his election remarkable at the won the party’s 1964 presi- posture as well, particularly on President Johnson to investi- which he has not done. time was that a black dential nomination, for housing issues. He co-spon- gate the causes of the 1967 I am deeply offended as a black Republican who has Republican Episcopalian example, Brooke, the state sored the Fair Housing Act of race riots and to provide rec- worked very hard to get more blacks involved in my could be elected statewide in attorney general, refused to 1968, which prohibited discrim- ommendations for the party to see people such as Gingrich, Boehner, Massachusetts, a predomi- be photographed with ination based on race, color, future. McCarthy and others attempt to defend the indefensi- nantly Democratic and Goldwater or endorse the religion or ethnicity. President At various points during ble. On matters of race, I have come to expect absolute- Catholic state with a black Arizona ultraconservative. Lyndon B. Johnson signed it his career, Brooke was at ly no leadership from Republicans in Congress, and population of less than 3 per- In the 1966 book titled into law a week after the assas- odds with civil rights leaders they never disappoint me in this regards. cent. It would be another 25 The Challenge of Change: sination of Dr. Martin Luther and liberals. As attorney gen- So, let me publically pose a few questions to Scalise years before another African- Crisis in Our Two-Party King Jr. eral, he opposed the and the House leadership – and I use the term “leader- American – Carol Moseley System, he asked, rhetori- He continued to work on NAACP’s call for a boycott of ship” very loosely. Does Scalise have any blacks on his Braun of Illinois – would win a cally: “Where are our plans strengthening the law and in Boston’s public schools to official or political staff? Did he reach out to any credi- U.S. Senate seat (1992). for a New Deal or a Great 1969, Congress passed the protest the city’s de facto ble black Republicans, not the usual blacks they go to Prior to his election to the Society?” “Brooke Amendment” limiting segregation. who will say anything they are told to say, before accepting the invitation? Speaking of staff, does Boehner or McCarthy have any blacks on their staffs? If so, who are they and what do they do? OUR VOICES It has long been said that the most segregated hour in America is at 11 a.m. on Sundays, when blacks and whites go to separate churches. A corollary to this could be that the most segregated place in Congress is the ForBy manyHarry Alford of us,the sale 2014 of their first was busi- aAmerican banner Chamber year of and astute investments are staff of Republican leadership. NNPA ness venture, Lacrosse Commerce has put together making this sector not only Where are the voices of the so-called black Playground. a consortium to link a por- survive but grow and take a Republicans/conservatives who will miss their own I will be 67 years old next Side money is now coming tion of the high-speed rail- firm position to lead America mother’s funeral to denounce Al Sharpton when he month. For nearly half of in from their individual con- way in Northern California – to more affordable energy does something stupid, but will never publically criti- those years my wife, Kay, sulting service. They are fast $1.5 billion of infrastructure. providing wealth for cize Scalise and Boehner when they are wrong for fear and I have been stand-alone becoming the best invest- Oh yes! investors, jobs for workers of not being invited to go on FOX News to praise all entrepreneurs. Times can be ment Kay and I have ever We have learned how to do and lower prices for con- things Republican. bad, good, great and cata- made together. I see this this and are putting it to sumers. As Eric Erickson asks, “How do you show up at a David strophic, depending on how bundle of “tools” being practice. Cuba is about to There is no other nation on Duke event and not know what it’s about?” GOP opera- you look at it. For us, 2014 applied to the growth of the open up and we are more earth as strong as the United tive, John Weaver said, “Scalise cannot serve in leader- will go down as a very good National Black Chamber of than ready. To say that in States when it comes to ener- ship.” year. Challenging, yet Commerce. 2014 we have taken it to a gy reserves and exporting. I have not read any black Republicans calling for rewarding in regards to the Procurement activity new level would be a major All of this accomplished with Scalise’s resignation from leadership. So let me do so upcoming prospects. among our members has understatement. the fiercest of adverse regu- publicly: Steve Scalise must go! Our twin sons presented us taken off with lightning The organized threat lation and evil policymaking. with their first postgraduate speed. Central and South against the NBCC by the Our Department of Raynard Jackson is president & CEO of Raynard degrees. Thomas received America have been the most White House has apparently Education continues to fight Jackson & Associates, LLC, a Washington, D.C.-based his Masters in communica- active. Liquid Nitrogen Gas ended in failure. We have against free enterprise with public relations/government affairs firm. He can be tion management from the stations are up and running stood firm against the back its attack on for- profit col- reached at www.raynardjackson.com. University of Southern in Colombia. alley Chicago-style dirt. leges and universities. California. Harry brought Solar heating farms now Marching forward and rising Confusing policies such as home his Masters in sports exist in El Salvador. NBCC as we step – God is truly Common Core curriculum management from members from Maryland, great! We continue to be the and a hatred of charter Georgetown University. They Mississippi, Colombia and strongest black business schools reminds me of the Send comments and questions to: immediately kept the pace Spain have commissioned a association in the world with late singer Curtis Mayfield up. gold mine in Surinam. Deep exponential continuing “taught by fools from unedu- The Triangle Tribune Harry is in the MBA pro- Water Port activity is now growth. cated schools.” 115 Market, Suite 360G gram for Babson University taking place in Nigeria, Costa The organized attempt to Let us close the Durham, NC 27701 while Thomas is enrolled in Rica and Nicaragua. An actu- kill the coal industry has Department of Education, the MBA program at John al resort city is in the plan- ended in a heap of ashes. which was another crazy (919) 688-9408 Hopkins University. They ning stages in Ghana. Technology breakthroughs, idea started by former (919) 688-2740 - fax also successfully completed Our San Francisco African a very friendly free market, President Jimmy Carter.
CYAN-AOOO MAGENTA-OAOO YELLOW-OOAO BLACK 01/29/08 USINESS B WWW.TRIANGLETRIBUNE.COM BRIEFS The Triangle SENIOR DEMOCRATS Matilda Phillips, statewide president of the N.C. Senior TRIBUNE Democrats, will be the guest speaker at this month’s SUNDAY, JANUARY 11, 2015 PAGE 5A Durham County Senior Democrats meeting Jan. 12, 8 a.m. in the catering hall of Rick’s Hope Valley Diner, 3710 Shannon Road in Business Durham. Visit www.ncse- Social niordemocrat.com.
LANDLORDS A Landlord Training Security Workshop is Jan. 15, 8 a.m. to 5 p.m. at City of Durham Neighborhood Improvement Services Department, 807 E. coming Main St., Suite 2-300. Contact: Lynwood Best at 560-1647, ext. 34254 or [email protected] of age ... ov. Deadline: Jan. 12.
RALEIGH CHAMBER • Jan. 27, 11:30 a.m. to 1:30 Again!By Brenda Brown p.m. – Executive Women’s SPECIAL TO THE TRIBUNE Luncheon at Embassy Suites Think back to when you Cary, 201 Harrison Oaks were younger. Blvd. RSVP by Jan. 20 to Life was simple at the Katelyn Crouse at 664-7036. kids’ table. The smell of a • Jan. 29, 8 to 10 a.m. – home-cooked dinner fills Success in Business work- the air on a lazy Sunday shop, Raleigh Chamber, 800 afternoon and everyone S. Salisbury St. RSVP by Jan. crowding around the TV 22 to 664-7063. FREDDIE ALLEN/NNPA after dinner to watch the • Feb. 13, 7:30-9 a.m. – last football game of the Chamber President/CEO Robert Xiao, the CEO of Perfect World (left) and Johnny Taylor, president and CEO of the Thurgood Marshall College Fund, celebrate the new Perfect World U.S.-China Young Leaders Fellowship program. season. Harvey Schmitt is the Fast-forward a few years, keynote speaker at the next when the adults first invit- C-Suite Perspectives break- ed you to their table and fast for chamber members your life changed. Your only. RSVP by Feb. 6 to 664- coming-of-age moment 7082. had arrived! This rite of passage is a transition from BUSINESS EXPO asking permission to giving City of Raleigh’s 17th annu- notice. al expo for small, disadvan- Coming-of-Age Day in taged minority- and women- China-HBCU Japan honors all the young owned businesses is Jan. 22, people who reached age 20 4 to 7 p.m. at Southeast during the past year. This Raleigh High, 2600 Rock national holiday takes Quarry Road. Call (919) 996- place on the second 2596 or 996-4278. Deadline: student exchange Monday of January and cel- Jan. 21. ebrates their privileges and responsibilities as new RESTAURANT WEEK adults. Triangle Restaurant Week is dent and CEO of the “We know a lot of young and thanks to the Coming-of-age moments Jan. 26 through Feb. 1. By Freddie Allen Thurgood Marshall College professionals need to not 100,000 Strong don’t come just once in life. Participating restaurants will NATIONAL NEWSPAPER programFund, a group thatlaunched advo- only grasp the technology Initiative, a group that Another important coming- offer a special three-course PUBLISHERS ASSOCIATION cates for nearly 300,000 part and the art part, but promotes Mandarin lan- of-age moment occurs lunch or dinner menu. Visit WASHINGTON – In an students through a network also the culture part,” he guage learning and when you decide to retire. www.trirestaurantweek.com. effort to develop the that includes publicly-sup- said. “You gotta go abroad, study abroad, Hao said Social Security can help. next generation of global ported Historically Black you gotta be able talk to dif- more that 100,000 Determining when to GALA leaders, the Thurgood Colleges and Universities, ferent people; you have to American students have retire is a personal deci- Greater Black Durham Marshall College Fund said that after meeting with understand other nations the chance to study in sion, influenced by your Chamber of Commerce will joined Perfect World, the world leaders in the public and other cultures deeper.” China. preferences and lifestyle. host its inaugural Black China Education and private sector, he found Xiao added that not only Morgan State We encourage you to go Business Gala Feb. 7, 6 p.m. Association for Perfect World to be the per- will Perfect World benefit President David Wilson online to www.socialsecuri- to midnight at The Durham International Exchange, fect partner because not from these types of led a delegation of HBCU ty.gov/pubs and read our Armory, 220 Foster St. RSVP and domestic groups only was the company inter- exchanges, but the industry officials on the trip to fact sheet, “When To Start to http://blackgala.- focused on building ties ested in entry-level oppor- will benefit as well. The CEO Beijing last July, where Receiving Retirement eventbrite.com. between the United tunities for HBCU students, said he wants to expose the memorandum of Benefits.” You may find States and China to but officials were also look- black college students to understanding was that this information helps Send your business news to embark on a new stu- ing for mid-tier profession- “the beautiful business signed between the you make an informed [email protected]. dent exchange program. als, as well. from China” while giving schools and the Chinese decision about the best The Zhi-Xing China – Taylor said the exchange Chinese students a modern government. The Beijing time to retire. Invest the Perfect World U.S.-China isn’t just about number- piece of America and a delegation included time to learn what you Young Leaders crunchers and program- deeper understanding of school administrators should do now to enjoy Fellowship program will mers, but also about graph- the community. from Tougaloo College, your retirement later. The offer students and mid- ic designers and artists. “That’s what we call an Hampton, Bowie State, Once you’ve come of age career professionals the Taylor noted that people “’exchange,’” he said. Spelman College, to retire — or even before, opportunity to travel limit science, technology, According to the Howard, Morehouse, while you’re in the plan- Triangle across China, strength- engineering and math pro- International Monetary Xavier, and Morgan ning phase — our quick ening business and per- fessions, but, in reality, Fund, China recently sur- State. and convenient online serv- sonal networks, and everyone interacts with passed the United States as Even though the eligi- ices are available at sharing inspirational STEM every day. the world’s largest econo- bility requirements and www.socialsecurity.gov/ret Tribune’s cross-cultural experi- “Everything that we do is my. Taylor said it would be selection process still ireonline. In as little as 15 ences with their Chinese about STEM,” Taylor said. senseless not to have rela- needs to be finalized, minutes, you can soar peers. Perfect World, an Robert Xiao, the CEO of tionships with the Chinese, officials with the through our online applica- e-Edition online gaming company, Perfect World, said through especially with what he Thurgood Marshall tion. It has never been easi- will assist in funding the conversations with Taylor, called a “Chinese-American College Fund said stu- er to come of age at retire- fellowship initiative, he discovered that they company.” Perfect World is dents will begin travel- ment! is free which is open to all edu- shared a similar vision and publicly traded on the NAS- ing to China for the Take advantage of our cational disciplines and a grand goal of changing DAQ stock exchange. exchange program this services and resources to industries, through people in the United States By 2013, more than July. make the best decision for online! 2025. and in China. 400,000 Chinese students you at www.socialsecuri- Johnny Taylor, presi- were studying in the U.S. ty.gov.
AuthorBy Phreddy Wischusen and childrenreleases can opt to have “I wanted ‘Pretty to put the app people are freed like up to focus Me’ App series highlighting natural hair, THE MICHIGAN CITIZEN the app read aloud to them, their energy on other things, similar to audiobooks. because I wanted her to cele- and with added self-confi- Anyone who spends time The story/text is accompa- brate her pride and what dence comes an enhanced with young children knows nied by Harper’s whimsical makes her beautiful, and ability to manifest their ambi- they have a love and an affin- animations/illustrations and sometimes even in the tions. Harper is living proof. ity for our devices: smart- gives children opportunities African-American communi- Many consider the arts and phones, tablets to interact with it, transform- ty, there can be pressure on sciences to be opposites, but and computers. ing caterpillars into butter- black women (to) conform Harper, an award-winning Long before flies and making the stars and wear (their) hair a certain playwright and filmmaker, most children twinkle. way, that (they) should taught herself how to code in learn to read, “I’m a storyteller, so straighten it,” she said. order to produce her series of they know how whether it’s writing plays or Rising rates of female apps. The work was extreme- to identify the writing books or developing anorexia indicate to the ly challenging at first, she appropriate storybook apps, I like to tell author that this pressure is says, and required a lot of growing in all segments of Harper charger for each stories,” Harper said. math, “but a very different device, how to “(Developing apps) … is a our society. kind of math than we were Dara Harper uses apps to tell stories, build financial open apps, and so on. way for me to tell stories in a “When you’re watching tel- taught in high school.” independence. Detroit native Dara Harper different medium. And I find evision or you’re online all She said high school math rather make $10,000 from 10 income sources. If one of – author, playwright, and a lot of value in that.” day and tuned to certain teaches you how to solve a sources than $20,000 a those sources is compro- mom – has added app devel- For Harper, however, sim- images and they’re flashing problem to find a single solu- month from one source. mised in some form or fash- oper under her belt. The ply telling stories is not in front of your face con- tion, but coding is like engi- “If all of your money is ion, you still have $9,000 innovative Harper has enough. She strives to use stantly (and think to yourself) neering, one starts with a coming from one source, if from the others. And while merged her skill as a story- them to uplift and educate ‘I don’t look like that…’ and desired solution and finds something changes or some- you still have those going, teller with the creation of a her audience in the long tra- yet those people don’t even any of an infinity of ways to thing goes bad — whether it’s you have time to retool and new application. dition of African griots, and look like that,” Harper said. achieve it. a pink slip or even if you’re a figure out how to fill in the “Pretty like Me” is the story for her craft to provide for “…I’ve been around celebri- “Everyone’s code looks dif- business owner and the cli- missing blank there.” of Nia, a young black girl who her and her family financial- ties up close and personal, ferent just like them,” Harper mate changes — and all of a Harper’s books and applica- learns to love her natural ly. and I can tell you: Flawless said. “Johnny’s code looks sudden your $20,000 a tions for children are avail- hair, and in turn herself. But Harper created Nia, whose skin doesn’t exist like you crazy because he’s crazy. month shrinks to $3,000 and able at “Pretty like Me” is not a tradi- name means purpose in think it does … There is such Sally’s code is neat and you don’t have anything else www.seashellkids.com, and tional storybook; it’s an app. Kiswahili, to inoculate chil- a thing as Photoshop … and I organized because that’s her going for you, then that’s her novels for adults can be The app has three different dren to the negative affects think that can send the style. Brother Deon‘s code is painful. found at modes: The most advanced of growing up in a world wrong message to a lot of cool and smooth, just like “But think about the person www.darawrites.com. children can read the story to where there is so much pres- young men and women.” him.” But, she says, it all who makes a total of $10,000 themselves. Parents can read sure to look other than how When appearance anxiety works. a month from 10 different the story to their children, they do naturally. is eased, Harper believes, Harper said she would
VISIT US ON THE WEB www.triangletribune.com WWW.TRIANGLETRIBUNE.COM Tobacco The Triangle prevention TRIBUNE efforts not up SUNDAY, JANUARY 11, 2015 – PAGE 6A to parBy Mary Kuhlman N.C. NEWS SERVICE RALEIGH – According to a recent report Focus ASK from the Campaign for Tobacco-Free Kids, North Carolina will only spend about $1.2 DR. SWINER million of the $422 million it will receive from the 1998 Big Tobacco settlement and tobacco taxes this fiscal year on efforts to prevent kids from smoking and helping others to quit. Natural John Schachter, director of state commu- nications at the Campaign for Tobacco-Free Kids, said states are collecting more than $25 billion from the landmark legal settle- and herbal ment. However, states are spending less than 2 percent of that total amount on smoking prevention and cessation pro- remediesDid you accomplish the goals you grams. "Those numbers are indicative that set out to accomplish last year? Did states are literally sacrificing the lives and you set out to achieve something by health of their kids," Schachter said. "It's the end of the year? If you didn’t, it’s something which doesn't have to be the not too late. case." One thing we might do differently is The Centers for Disease Control and to try more natural remedies for ail- Prevention recommends North Carolina ments. I’m in no way an spend nearly $1 billion per year on smok- herbalist or natural medi- ing prevention programs. The report points cine specialist, but I do to Florida as an example other states should believe there’s some bene- follow. fit to use of alternative Florida cut its high school smoking rate medicines. I’m aware of to 7.5 percent from 15 percent by adequate- many anecdotal evidence ly funding tobacco prevention programs in this category of medi- through a voter-approved ballot initiative. Swiner cine. The flip side, howev- "We would actually save 2.3 million lives, er, is that most of these and over $120 billion in health care costs," supplements are not studied by the Schachter said. "We would prevent 7 million FDA, and therefore can’t promise much kids from becoming adult smokers if we of what they suggest. So try them with could just get every state to achieve caution. Florida's rate, let alone go beyond that." For sleep, you may recall me men- Schachter said North Carolina's 15 per- tioning melatonin, which is a nice, nat- cent high school smoking rate is in line with ural remedy because it already occurs the national average. He adds that tobacco in our blood stream. It peaks when it’s use kills an estimated 14,000 North time to sleep, and then levels out. By Carolinians each year, and taxpayers spend taking melantonin orally, we enhance nearly $3.8 billion on health care for sick this effect. I took it during pregnancy smokers. FOX-TV and did not have side effects of signif- Latasha McCutchen is feted with champagne after the finale. icant drowsiness when I awakened, and it worked well. SCHOOL NEWS For joint issues and gout, the use of DURHAM COUNTY cherry juice, turmeric and glucosamine Durham County Library will host are becoming increasing popular. All of “Wanted: Science and Math Enthusiasts,” a these potentially decrease inflamma- STEM program for teens, Jan. 12 at 6:30 tion, swelling and immobility. The key p.m. at the Main Library, 300 N. Roxboro St. Chef La Tasha is taking all of these consistently and The program is intended for teens interest- daily. A little bit here or there does ed in pursuing careers in science or math, nothing. and will feature a conversation with Rene My most favorite class of these sup- Daughtry, advanced services project man- plements is those that treat the hor- ager with Cisco. “Wanted” is part of an McCutchen wins monal symptoms that occur with peri- ongoing initiative by DCL to present pro- menopause (nearing menopause) and gramming in STEM for teens. menopause. By age 50, most women Daughtry has worked with Cisco in var- have experienced or are experiencing ious capacities for 19 years. He established By Carolyn Guniss ence, math and finally landing in nutrition. menopause. This feared phenomenon Cisco Network Academies at Elizabeth City ‘Hell’s Kitchen’Her classmates noticed her commitment is a natural progression of a women’s THE MIAMI TIMES State, N.C. Central and N.C. A&T State uni- and interest, not in classes but in Lagasse’s menstrual cycle, and after a full year versities. These academies offer students Chef La Tasha McCutchen performed well show. without a period, we consider it done. an educational foundation in information throughout season 13 on Fox Network’s “Hell’s “You take more notes watching that show However, the stopping of menses is technology, which can be used to enter the Kitchen.” So when she was selected from four than you do in class,” she said they told her. just one of the many effects field immediately or as a platform for high- chefs to face emotional chef Bryant Gallaher in Coming from what she calls a modest food menopause causes, and almost every er education in STEM fields. the final two, she knew she could win. background, she started waiting tables to get woman is familiar with the others. I’m For more information, call Placedia “Honestly, I was hoping the pressure would more exposure to food. Then the crossroads talking about the feared hot flashes, Nance at (919) 560-0122 or visit durham- get to him,” McCutchen said. “I am cool, calm came: stay with food or choose another path. along with mood changes, weight countylibrary.org. and collected, and I was hoping he would shoot She would go on to earn associate degrees changes, vaginal dryness and irritation, himself in the foot.” from both Horry-Georgetown Technical hair loss, decreased sexual desire and In the end, McCutchen, who has been a part College and Johnson & Wales University in memory difficulty, to name a few. As a of the South Florida food scene for around Miami. doctor that treats women of every age, seven years, took the title and executive chef Her growth started under Chef Paula I blame almost anything on job of Gordon Ramsay Pub & Grill at Caesars DaSilva, another “Hell’s Kitchen” alum, at menopause. To marry or Atlantic City, a prize package worth $250,000. 1500°, an eatery inside Miami Beach’s Eden Because there can be other causes “La Tasha, you were rock solid, and it was no Roc resort. While working as lead line cook, for these symptoms, such as thyroid surprise that you were the only person not put “Hell’s Kitchen” held auditions at the Eden disease, iron deficiency or even depres- not toBy Alma marry Gill up for elimination,” Chef Ramsay said Roc. DaSilva encouraged the staff to try out. sion, I like to test a woman’s hormone NATIONAL NEWSPAPER PUBLISHERS ASSOCIATION moments before announcing the winner of the “I was the only person that went down for levels to judge where she is in her cycle Dear Alma, culinary reality competition. “You belong in the the audition,” McCutchen said. After audition- of life. I test FSH and LH levels, which A friend of mine is engaged to her fiancé kitchen.” ing, she joined the Citron American Brasserie can correspond to a lady’s estrogen of four years. She recently found out that McCutchen said she’s still pinching herself at the JW Marriott Grand Lakes in Orlando, and progesterone level, respectively. If he has a child that he never told her about because of the victory, but in the end “Mommy Florida. While there, she got the call that she peri-menopause or menopause is con- or talked about. This happened before they and Daddy didn’t raise no fool,” a line she used was selected for the cast of season 13, which firmed, then treatments can be consid- got together. He said he didn’t want to say in the season finale. finished airing Dec. 17. After filming the show ered. anything because he didn’t “My parents taught me to ignore negative in early 2014, McCutchen found her South There are many ways I treat these want to hurt her or didn’t comments and never to second-guess myself. Florida mentor DaSilva and joined her as lead symptoms – both natural and pharma- want it to ruin what they Make a decision and stick to it,” she said. line cook, this time at the award-winning 3030 ceutical. Supplements such as soy, have. He has had no contact “Words can’t describe how I feel right now. I Ocean restaurant at Fort Lauderdale Marriott evening primrose oil, black cohosh and with the child or mother since was true to myself.” Harbor Beach Resort & Spa. wild yam extract are available in almost it happened, but now it has Her winning menu – get ready for your McCutchen leaves for her executive chef every store now. Each one works differ- come out because he has to mouth to water and your mind to race – consist- job after the holidays. She will oversee the ently for each woman. You have to try ed of prime filet mignon tartare with shallots, Gill pay child support. Apparently operations and opening of Gordon Ramsay a couple of weeks on each to see which the mother didn’t want him capers, whole grain mustard, cornichons, Pub & Grill set for February. The highest works best for you. involved in the child’s life. chives, lemon zest, sunny-side-up quail egg and moment of the show, other than hearing For chronic headaches like She is feeling like she can’t trust him waffle potato crisps; pan-seared Chilean sea praise from Ramsay, was seeing her parents migraines or tension, I’m a fan of anymore or even go forward with dealing bass with beet risotto, glazed thumbelina car- together. Riboflavin, which is essentially Vitamin with the situation. He has stressed how rots and herb gremolata; and spiced bread pud- “Growing up, I lived with my mom and my B2. If taken in high doses (400 mg) sorry he is and that he couldn’t find a way ding with pumpkin spice ice cream, praline dad lived on the same street, but I never saw daily for three months or more, there is to tell her. Should she move forward with crumble and spiced chocolate anglaise. them together as a couple,” McCutchen, 34, evidence it decreases frequency of him, or just move on and let it go? Her journey to know food began while said. “When I saw that they both flew across headaches. If it doesn’t work, it’s still a From Alma: watching Chef Emeril Lagasse on “Essence of the country together for me, that just made me good thing to take because it’s a vita- Hmmm, that was a stretch even for the Emeril” while attending South Carolina State. unbeatable.” min. Rubber Band Man. His answer sounds She changed major a few times: computer sci- Leg cramps or charlie horses? Try overwhelmingly familiar. Personally, I’d quinine or magnesium daily. Quinine is end it. But I’m not you, or your friend, and an old-fashioned drug that was off the if she really wanted to leave, she’d already RECIPE OF THE WEEK market for a while, but it’s now back. It be gone. does, however, work as a muscle relax- When a person is ready to bounce from ant. You do have to be careful with this a relationship, they don’t tell a soul except one if you have a history of heart dis- the confidant who’s helping them break ease. away. When one decides to go, there is no Drinking a cup of tonic water (which LiveNORTH AMERICAN a PRECIS full, SYNDICATE flavorfulThis low- life contains quinine) may be just as help- turning back. Your mind’s set and your bed’s made; there’s no room for discus- Being diagnosed with diabetes doesn't calorie ful. I’ve had patients swear to me that sion. mean your life needs to lack flavor. While it's Maple eating a teaspoon of mustard helps as How about you insist that he disclose important to pay attention to what you eat, Pecan Bread well. everything to you and tell you why he there's no need to sacrifice the sweet. can be Toe fungus? Try over-the-counter walked away. Be it unemployment or Here are a few quick tips and simple sub- good for tea tree oil, Listerine (careful for skin stitutions to help you make healthier choices immaturity, you deserve to know. After he those with changing to the tint of the mouthwash and get your taste buds talking: for a short time), Vicks Vapor Rub or takes full responsibility, the two of you can diabetes, start to work on this together, along with • Eat fewer "empty calories," including chlorine. I’d be careful with all except all of life’s challenges you’ll face as man foods high in added sugar. and deli- the tea tree oil, which seems to be a rea- and wife. • Choose protein foods that are lower in cious for sonable choice. This is huge, make no mistake about it. saturated fat such as fish and chicken with- everyone Another favorite area of mine is the The chains of deception are broken and in out the skin. else. class of omega-3 supplements. This need of delicate repairs. Seriously speak- • Flavor your food with fresh herbs and includes krill oil, fish oil and flax seed spices. Association, Equal tastes good in hot and cold ing, hold him accountable and help him to beverages from coffee and tea to iced tea and oil. The omega-3 group is helpful in do right by his child. It’s gonna get a lot • Fill up with high-fiber foods like beans, lowering blood pressure and choles- lentils and whole-grain breads and cereals. lemonade, sprinkled on cereal and fruit, and in worse before it gets better. Stay focused most recipes that require sugar. terol. The type of cholesterol these are and devote yourself to the commitment of • Substitute Equal zero-calorie sweetener most helpful for are the triglycerides. If for sugar in beverages and recipes. A leader The Maple Pecan Bread recipe is at your new family. www.30waystoloveequalsweets.atshelf.com/reci taken daily and consistently, one can Email questions to: among zero-calorie sweeteners and a nation- see change in usually three to four al sponsor of the American Diabetes pes/detail/recipe/1800. For more information, [email protected]. go to www.Equal.com. months. WWW.TRIANGLETRIBUNE.COM 2 trail- The Triangle blazers TRIBUNE SUNDAY, JAN 11, 2015 – SECTION B inWhile manysports of us will be per- forming acts of service during the Martin Luther King Jr. Holi- day weekend, some will be watching others serve court at the SJG 2015 MLK Classic. The creators of the Pro-Am Sports summer league, which was can- celled this past summer, spon- sor the two-day basketball tournament. The signature MLK Classic is set for Jan. 17 and 19 at Durham School of the Arts. Fifteen teams are expected to participate, in- cluding local fa- vorites Faith Assembly Chris- tian Academy, and Riverside, Bonitta Northern, Pan- Best ther Creek and Apex high schools. There will even be a girls game between Riverside and the 2013 2-A state champi- ons Kinston High on Monday. D’ymon Alston (23) fought off Jordan’s Hannah Williams and the Falcons for the The Pirates are 12-0 (as of Jan. win. 8) and should battle with Hill- side for supremacy in the PAC- 6 Conference. I saw them both at the holi- Bowie State coach Darrell Brooks and the high-fly- day invitational at Cary Acad- ing Bulldogs come to Raleigh to take on St. Aug’s emy last month, and they put and Shaw. the Raleigh teams to shame. Five games will be played on each day beginning at 1 p.m. Hillside, Jordan COLLEGE BASKETBALL and ending with the final matchup around 7 p.m. Northern looks to have one of the toughest draws. The Knights take on Panther Creek split in JV Saturday at 7 p.m., then Apex on Monday at 7 p.m. Conference Keep up the latest news and rosters at www.ncproam.com. with 11 points. But Freeny points, but that was as A time for the ages By Bonitta Best [email protected] did most of her damage actionon close as the Falcons could games heat My friend and colleague Lut defense with 10 steals to get. Williams did an outstanding DURHAM – Hillside jun- help Hillside overcome a sec- Brianna Allen led Jordan job this week with his Black ior varsity girls hadn’t ond-half deficit. with six points, seven College Sports Page. played a game since Dec. The Hornets also recorded steals and a block. Jordan Lut brought back so many 13, and it showed. collected seven blocks as a up inBy Bonitta C-I Best 26 team steals and two memories with his tales about But the Hornets shook blocks. team. [email protected] deceased sports broadcasters off the post-holiday blues Hillside trailed the entire Falcons make it a split The CIAA continues to be well represented in the Stuart Scott and Howard Cosell, and Christmas meals to game until Jessica Wright’s 3- Jordan used its size and latest Atlantic Region polls. and local Washington, D.C., defeat rival Jordan 31-23 pointer at the start of the speed to pull away from On the women’s side, Virginia State, Johnson C. broadcaster Glenn Brenner. Tuesday. The win keeps fourth quarter gave it a 19-17 Hillside for a 58-44 win. Smith and Livingstone are No. 7, 8 and 9, respec- It reminded me of my “Aha” Hillside undefeated in lead. The team reeled off 11 Three Falcons scored in tively. moment in sports from two PAC-6 JV Conference. straight points for a 27-17 double figures with Jaylen Bowie State leads the men at No. 4, followed by Win- women that are still living. Zakiyyah Freeny was score. ston-Salem State at No. 7 and Livingstone at No. 10. Click on any sports network the game’s high scorer Jordan trimmed it to six Please see HILLSIDE/2B today and the tube is filled with WOMEN women broadcasters – some Shaw (1-2 CIAA, 8-7) skilled, some not. But it wasn’t In uncharacteristic fashion, the Bears have dropped always the case back in the day, two straight conference contests. especially when it came to COLLEGE FOOTBALL Chowan defeated Shaw 66-57 for only the second b l a c k time since the Hawks joined the CIAA. Senior center women. Verdine Warner posted another double-double of 26 T h e n points and 16 rebounds. one day “We depended on Verdine a lot for scoring and did- ESPN did n’t get a lot from the other positions,” associate head the un- coach Carl Hatchell said. “Going into the next game, thinkable we have to get better. We don’t need to worry about and hired the other team, just focus on us, change and better not one but two black women More honors for ourselves.” to its broadcast: Robin Roberts The Bear lost the next game to Virginia State 84-62. and Pam Oliver. Warner, again, recorded a double-double of 21 points Roberts handled the presti- and 13 rebounds. gious anchor desk duties, while Shaw hosts its next four games at home, beginning Oliver trolled as a sideline re- By Bonitta Best with Virginia Union Jan. 8, Bowie State Saturday and [email protected] football porter. Two black women – one Lincoln on Monday. network. I was just starting out Virginia Union may in this business and could go N.C. Central (0-2 MEAC, 2-11) two years without seeing an- have come up short on the football end, but first- The Eagles are seeking just their third victory of the other black female sports re- season. NCCU has lost nine straight games, with its porter. year coach Mark James received another honor. last win Nov. 28 against UNC Asheville. Both women gave our genre The Eagles host South Carolina State Saturday at 2 credibility. For a time, every fe- The Black Athlete Sports Network named p.m. before Savannah State comes to town Monday at male reporter that came after 5:30 p.m. them was measured against James its rookie coach of the year. Senior defensive their knowledge and profes- St. Augustine’s (1-1, 7-4) sionalism. back Charles Davis III was named first-team All- The Falcons had their five-game winning streak bro- Neither was afraid to ask the ken by Chowan Monday night, 82-66. St. Aug’s trailed tough questions, even when American by the BASN. James led the Panthers Left to right: Mark James and Charlie Davis III 36-28 at halftime before the Hawks outscored the some male reporters shied team 32-17 for a 23-point lead with 4:04 left. to a 7-3 record and one Davis was 11th in the na- away. fensive coordinator Steed “An absolutely disappointing loss,” head coach win shy of the CIAA tion with six interceptions. During an interview, Oliver Lobotzke has left to take the Rachel Bullard said. “We came out flat and Chowan championship game. The He also had a team-leading and I bemused at how men can same position at the Univer- (2-1, 6-7) took advantage of it. Terri Jacobs had a get so caught seven wins are the most 83 tackles. sity of Richmond. by a first-year coach, and great game, but it was too late.” up into statis- The Rams averaged 35.7 Jacobs recorded a double-double of 20 points and was VUU’s first winning Rams OC leaves tics and sports points per game and 14 rebounds. season since 2009. Winston-Salem State of- trivia. Please see VUU/2B The Falcons begin a three-game homestand starting “What has Jan. 8 against Bowie State. Then it’s Lincoln (Pa.) on that got to do Saturday and Virginia Union Monday. with the price of eggs?” she COLLEGE CORNER MEN said. “I don’t need to reel off N.C. Central (2-0, 10-5) every Super Bowl champion in After losing two straight games, the Eagles have my head. I know where to get won their past four – all nonconference. the information if I need it.” The meat of the MEAC schedule begins this week- Roberts, with her catch NCCU hires Hans Olsen end when S.C. State comes to town at 4 p.m., followed phrase “Go on with your bad by Savannah State on Monday at 7:30 p.m. The Tigers self!”, did double duty at and Eagles have built a heated rivalry since both “SportsCenter” and “Good joined the conference at the same time. Morning America” until she left asWOMEN interim tennis coach sports for good in 2005. Fayetteville State St. Augustine’s (0-2, 6-6) I thought she was crazy at women’s bowling repu- After winning four games in a row, the Falcons have the time, but obviously what do tation precedes them. lost their first two conference games. Elizabeth City I know. The Broncos debut at State defeated them 79-70 last weekend before Oliver has carved out a 25- No. 10 in the inaugural Chowan make it two straight with a dominating 76- year career as a sideline re- National Tenpin Divi- 47 win. porter that will end after this sion II/Division III poll. The road doesn’t get any easier with their next season with Fox Sports for the FSU is undefeated at 9- three games against Bowie State, Lincoln (Pa.) and Vir- younger and blonder Erin An- 0. ginia Union. drews. “This is a much appre- And although she and ciated recognition, and Shaw (2-1, 7-6) Roberts were only together on I’m glad the NTCA has Two former Raleigh rivals were at it again Monday ESPN for a short time, they al- decided to start ranking night at Virginia State. Shaw coach Cleo Hill Jr. de- ways will be No. 1 and No. 2 in the top teams in DII,” feated his former St. Aug’s nemesis Lonnie Blow Jr. my book. head coach Bobby Hen- 72-61 for their second straight win. Shaw defeated In this day and age of short derson said. “It’s a good Fayetteville State women’s bowling team Chowan last weekend. skirts, low-cut blouses and thing to start strong and Jamar Cooper led all scorers with 17 points, while weaves longer than the Missis- be ranked, but it’s more accomplished.” while Cheyney is at No. 9. Larry Richardson and John Savoy tied for 14 each. sippi, they set the standard for important to finish strong Bowie State is the highest Shaw hosts Virginia Union Jan. 8, Bowie State this excellence. and then see what we’ve ranking HBCU at No. 6, Please see TENNIS/2B weekend and Lincoln Monday. Sunday, January 11, 2015 2B SPORTS/The Triangle Tribune More honors coming to
Continued from page 1B ent to coach successfully on Jan. 17 all-star game on Cal- different environment, rub- Virginiaany level of football.”Unionifornia State University football cam- bing shoulders with some of recorded eight straight 400-plus yard games this pus. The game will be the other pro prospects past season. Reed commits to televised live on ESPN2 at 4 across the nation, as well as Xavier Eason (5) and the rest of the Falcons had reason “Coach Lobotzke is a bowl game p.m. having some NFL representa- to smile in the second half. great coach and was always Fayetteville State senior of- “This is an awesome op- tion contribute to the prepared,” head coach fensive guard Marcus Reed portunity, and I’m excited process just heightens my Kienus Boulware said. “He will participate in the 2015 about the upcoming experi- excitement.” is a very professional per- NFLPA College Bowl. ence,” Reed said. “I always Keep up with the latest son that was always fair to The event showcases some get excited at the chance to news on Twitter @NFLPA- the players. He has the tal- of the best senior players in a play football. But being in a Bowl.
Hillside guard Marieon Upchurch (44) proves size doesn’t matter. Hillside, Jordan split in JV John Perry, at left, organized "Sherman's Boys" to provide a home-cooked meal for Family House guests.
Continued from page 1B FormerSherman’s players continue to honorBoys youth league coach actionRichard leading the way with 14 points, followed by Boyi Bokar and Kaeson Mayfield tying for 12 points each. Xavier By Elizabeth Swaringen Hospitals and their families. month.” least I could do to give back Easton recorded three blocks. Special To The Tribune A community of support And as the schedules of to this wonderful place.” Up 26-21 at halftime, Jordan saw its lead balloon to 15 forms among staff, volun- 15-year-olds allow, Lundy “I keep coming back to the CHAPEL HILL – If you need points in the third quarter. teers and guests once they Fine and Eliza Irwin, Morris’ metaphor of ‘sports as an proof that a coach makes a The Falcons were never threatened in the fourth period. cross the threshold of the 40- and Britt’s daughters, re- embodiment of life’,” Lovin- lifelong impact on his play- bedroom house minutes spectively, who were al- good said. “It’s referred to ers, look no further than from the hospitals. ready close friends, help out often, but seldom is it exe- Sherman’s Boys. Besides Perry, Sherman’s their fathers in the kitchen cuted with the precision we The “boys” are five men, at Boys include fellow Chapel and earn community service witnessed when we played or near the big 5-0 birthday, Hill natives Morris Fine, Bill credits required for gradua- for Sherman. who gather six times a year Kempf and John Lovingood. tion from Chapel Hill-Car- “Chapel Hill was a much to cook dinner at the SECU Britt Irwin, a Burlington na- rboro Public Schools. different place when we Family House, the hospital tive who has lived in Chapel Sherman’s Boys don’t have played for him. Sherman hospitality house where their Hill 19 years, is an “adopted” a go-to menu for which they was able to transcend any beloved youth league and member — with Sherman’s are known, but tailor their boundaries and whatever volunteer middle school blessing. offerings to the seasons. rancorous hesitation either coach, Sherman Riggsbee, “I’m proud to be honorary,” Hamburgers and hot dogs whites or blacks brought to 68, is the night manager. Britt said. “If I’d lived in on the grill were perfect for the field. In short order, we “For us to get together and Chapel Hill, I would have July 23. Chili with all the fix- put away any prejudices that cook and engage with those been right there with them, ings and cornbread wel- might have been lingering, struggling and coping with playing baseball, football comed fall on Sept. 24. and we always prevailed as a serious illness is the very and/or basketball for Sher- “I think this is awesome,” team, together.” Hans Olsen will guide the Eagles tennis squad. least we can do to pay for- man.” said Betty Hollingsworth of “He treated every one of his ward some of the life lessons Sherman’s Boys cooked Fayetteville on July 23, refer- players with respect, and he we absorbed so many years their first Family House din- ring both to the food and never wanted to be called ago on those dusty fields and ner on March 26. Members of how Sherman’s Boys choose Coach Riggsbee,” Fine said. indoor courts influenced — Sherman’s family attended to honor their coach. “But “He was simply Sherman, NCCU hires unbeknownst to us at the as did children of the cooks. then Sherman is awesome.” and he was cool. We felt like time — by Sherman,” said “Hey Coach” and “Meet And Hollingsworth would we were being coached by a John Perry, who organized Grandpa Sherman” echoed know. Since 2012, she has professional, and we always his buddies after being part through the meal prep. been a Family House guest had the best uniforms.” interim of another team of volun- “It was like old home numerous times, either as a teers who provided a home- week,” Sherman said. “Even patient or as the caregiver of cooked evening meal for though some of my family a longtime friend. In grati- Family House guests. and the boys had never met, tude, Hollingsworth made tennisContinued from page coach 1B nally beat Jacques Curtis as a Now approaching its sev- they took up like they’d her signature strawberry head coach? For that matter, N.C. Central enth year of service, Family known each other all their lemonade cake to add to the can St. Aug’s coach Rachel The Eagles have hired House offers safe, affordable lives. My daughter, Yolanda desserts offered Sept. 24. Bullard? Hans Olsen as interim head and comfortable accommo- Riggsbee Hamer, was so in- “It’s always a joy to bake Oh, the drama, the drama! coach for women’s tennis. dations to seriously ill pa- spired she started serving that cake and especially so Olsen replaces Davis Nass tients being treated at UNC dinners one Saturday a tonight,” Betty said. “It’s the who retired at the end of MEN last year. He has 18 years N.C. Central of Division I head coaching Baseball is set to host its experience at N.C State and fourth annual First Pitch Din- Charleston Sout.hern. ner and Silent Auction Jan. 31 “I am very excited for the at the Sheraton Imperial opportunity to join the Hotel RTP. The event pro- Eagle family,” Olsen said. ceeds help support the pro- “Coach Nass’ dedication gram. and leadership has built a “Each year it has proven to strong foundation for the be a special event,” head program to move forward. I coach Jim Koerner said. “We will work very hard to con- look forward to introducing tinue building the tradition our team to what has always of excellence of our ex- been a great crowd of NCCU tremely talented and hard- baseball fans.” working women’s tennis Call 530-6723 for more team.” info. Boyi Bokar scored 12 points St. Augustine’s St. Augustine’s in three quarters to lead The Falcons will begin Bowie State coach Darrell Jordan past Hillside. broadcasting and web- Brooks is coming to Raleigh. streaming their home games on Jan. 21 against Shaw Johnson C. Smith. Perfect Bowie State coach Darrell time to begin since the Brooks is coming to Raleigh. Golden Bulls are roaring. If you don’t understand why You can watch on TWC this is so important to CC, Channel 168. CC will have well, you haven’t been read- to actually show up for this ing CC. one.
Shaw Uh oh, Shaw has lost two straight conference games. Well, CC is still not con- The Best vinced the Bears are ready to give up the throne just in yet. However, we must admit we can’t wait for HBCU sports... their matchups against Liv- triangle ingstone and Johnson C. Smith. tribune.com Can Steve Joyner Jr. fi- Sunday, January 11, 2015 3B SPORTS/The Triangle Tribune
FOR THE WEEK OF JANUARY 6 - 12, 2015 2 0 1 4 - 15 B L A C K C O L L E G E B A S K E T B A L L (Results, Standings and Weekly Honors - Men)
CENTRAL INTERCOLLEGIATE MID EASTERN SOUTHERN INTERCOLLEGIATE SOUTHWESTERN CIAA ATHLETIC ASSOCIATION MEAC ATHLETIC CONFERENCE SIAC ATHLETIC CONFERENCE SWAC ATHLETIC CONFERENCE INDEPENDENTS DIV CONF ALL CONF ALL CONF ALL DIV ALL W L NORTH DIVISION W L W L W L W L W L EAST DIVISION W L W L W L W L Virginia State 1 0 2 1 8 4 North Carolina Central 2 0 10 5 Paine 2 0 6 3 Lincoln (Mo.) 4 11 Bowie State 0 0 3 0 11 4 Alabama State 2 0 6 5 Norfolk State 2 0 9 7 Benedict 2 0 4 4 UDC 2 10 Lincoln 0 0 3 0 9 4 Texas Southern 2 0 5 10 Hampton 2 0 8 7 Morehouse 2 0 4 5 Tennessee State 3 13 ™ Chowan 0 0 2 1 8 4 Southern 1 1 4 12 SC State 2 0 4 8 Albany State 1 0 5 3 W. Va. State 1 12 Eliz. City State 0 0 2 1 9 7 Miss. Valley State 1 0 2 12 Md. E. Shore 1 1 8 8 &ODÀLQ Cheyney 1 12 Virginia Union 0 1 0 3 4 9 Jackson State 1 1 3 12 SOUTH DIVISION Howard 1 1 6 6 Clark Atlanta 1 1 2 7 Alabama A&M 1 1 2 10 Shaw 0 0 2 1 7 6 Bethune-Cookman 0 1 4 11 Fort Valley State 0 2 0 9 INDEPENDENT PLAYERS OF THE WEEK Alcorn State 1 1 2 12 PLAYER & NEWCOMER Livingstone 0 0 1 2 7 5 ^ Florida A&M 0 1 0 13 WEST DIVISION Fayetteville State 0 0 1 2 7 6 Ark. Pine Bluff 0 1 3 12 Christian Mekowulu, 6-9, Fr., F, TENN. STATE - NC A&T State 0 2 2 11 LeMoyne-Owen 2 0 5 5 J. C. Smith 0 0 1 2 7 7 Grambling State 0 2 2 10 Averaged 13.5 points and 6.5 rebounds in 1-1 week. Morgan State 0 2 2 12 Lane 1 0 2 5 Winston-Salem State 0 0 0 2 7 4 Prairie View A&M 0 2 2 13 Scored 16 points and had 11 boards in win over St. Augustine’s 0 0 0 2 6 6 Coppin State 0 2 1 14 Kentucky State 1 1 2 6 Kennesaw State. Had 11 points and 2 rebounds in Delaware State 0 0 5 8 Stillman 0 2 4 5 SWAC PLAYERS OF THE WEEK loss to SE Missouri. BCSP CIAA PLAYERS OF THE WEEK Savannah State 0 0 3 10 Tuskegee 0 2 3 6 PLAYER PLAYER Miles 0 2 1 8 Maurice Strong, 6-5, Sr., F, ALABAMA STATE - Cameron Knox, Sr., G, BSU - Averaged 26.5 points MEAC PLAYERS OF THE WEEK Spring Hill 0 2 1 10 $YHUDJHGSRLQWVDQGERDUGVDV+RUQHWVJRW¿UVW in two wins getting career-high 31 vs. Livingstone and PLAYER t w o S WA C w i n s o f t h e s e a s o n . S c o r e d 1 2 p o i n t s w i t h Tariq Cephas,5-11, Sr., G, COPPIN STATE - Aver- BIRTH 22 vs. JCSU. Also shot 90% from the line (20-22) with SIAC PLAYERS OF THE WEEK 9 boards vs. JSU, 14 points and 9 boards vs. GSU. aged 14.5 points, 7.5 assists, 5 rebounds and 4 NEWCOMER ESPN Photo 3.5 rpg. and 3.0 apg. PLAYER steals in two losses. NA. NEWCOMER Daequan Mitchell-Fields, 6-5, Sr., F, LOC - Av- ROOKIE OF THE RIP: Rest and Peace, Stu Alonzo Murphy, Sr., C, LINCOLN - Scored 16 points eraged 19.5 points in two wins to start new year. Craig Bowman, 6-3, Fr., F, FAMU - Average 10.5 and grabbed 7 boards in win over WSSU. Had 5 of- 7DOOLHGSRLQWVLQZLQRYHU&ODÀLQDQGLQZLQ Scott. points, 2.5 rebounds, 2.5 assists and 2.0 steals fensive rebounds and hit 6 of 11 free throws. COOL in two losses. over Clark Atlanta. ROOKIE DEFENDER NEWCOMER Quamon Burton, Fr., G, LINCOLN - Scored 12 of DShon Taylor, 6-5, Jr., G, NSU - Averaged 6.5 NA BLACK COLLEGE HOOPS LEADERS IN NATIONAL team-high 17 points in second half vs. WSSU. rebounds, 2.0 steals and 1.0 blocks in two losses. COACH Scored 19 points. STATS; BCSP PROFILE FROM WILD CARD GAMES Darrell Brooks, BSU - 2-0 week with wins over Livingstone and JC Smith. Stuart Scott and Birth of the Cool
LUT WILLIAMS FDUULHV(631+H¶VEHFRPHOLNHWKHIDFHRIWKH BCSP Editor QHWZRUN :DQWWRNQRZKRZVSHFLDO(631%HUPDQFDOOHG´%RRPHU´´%RRP´RU EURDGFDVWHUDQGKRVW6WXDUW6FRWWZKRGLHGWKLV ´7KH6ZDPL´E\KLVFROOHDJXHVRQWKHYDULRXV ZHHNDIWHUDORQJERXWZLWKFDQFHUZDV"7KLQN SODWIRUPVKHKHOPVLVDUHDOSHUVRQDOLW\ZLWKKLV DERXWLW7KHUHDUHQRWDQGKDYHQRWEHHQPDQ\ IXQQ\QLFNQDPHVDQGSOD\VRQWKHQDPHVRIWKH OLNHKLP FRDFKHVDQGSOD\HUVKHFRYHUV+H¶VWRQHGWKDW +HZDVJLYHQDSODWIRUPRQ(631DQGKHGRZQLQUHFHQW\HDUVDVKH¶VEHFRPHWKH:DOWHU FDUULHGLW:KRHOVHFDQ\RXVD\WKDWDERXW"1RW &URQNLWHRI(631 PDQ\ %XW6FRWWWRRN(631WRDQRWKHUOHYHO ,QWKHGD\VEHIRUH(631ODWHVSRUWVFDVWHU+H PDGH VSRUWVFDVWLQJ FRRO FRPELQLQJ *OHQQ %UHQQHU RI:723 DQG ZKDWHYHU RWKHU SURIHVVLRQDOLVPZLWKYHUYHDQGWHOOLQJVWRULHVLQ FDOOOHWWHUVLWJRHVE\WRGD\ LQ:DVKLQJWRQZDV DZD\WKDWHYHQWKHPRVWUDELGIDQFRXOGLGHQWLI\ DFRPLFJHQLXV, ZKLOHVRPHWLPHVDWWHQGLQJ ZLWK+HEURXJKWWKDWVDPHHQHUJ\WRKLVEDWWOH +RZDUG8QLYHUVLW\LQWKHODWHV WXQHGLQ ZLWKFDQFHU WRKLVGDLO\EURDGFDVWVDQGMXVWZDLWHGIRUWKH $QGKHEURXJKWDOOWKHKRPLHVLQFOXGLQJ MRNHV ´3RRNLH´ ´5D\ 5D\ DQG ¶HP´ LQWR WKH 7KHUHZDVQHYHUDEURDGFDVWWKDWKH FRQYHUVDWLRQ:KRHOVHFRXOGHQGKLVVSRUWVFDVW SCOTT: Kicked Cancer‘s A--. GLGQ¶W PDNH \RX ODXJK DW OHDVW RQFH ZKLOH ZLWKWKHSHDFHVLJQRUE\VD\LQJ´+ROOD´" VWLOOGHOLYHULQJWKHVSRUWVQHZVRIWKHGD\7KH +H PDGH KLV FRQWULEXWLRQ RQ WKH EODFN RXUVKRZRQ)ULGD\ÁHZRXWDQGZDVEDFNRQ DWPRVSKHUHZDVRISXUHHQWHUWDLQPHQWZLWKDELW FROOHJHVSRUWVIURQWDVWKHWZRWLPHKRVWRIWKH 6SRUWV&HQWHU6XQGD\´ RIVSRUWVWKURZQLQ Eddie Robinson Awards. +HZDVXQLTXHDQGKHZDVJRRG+HKDGKLV %UHQQHUFRPPDQGHG\RXUDWWHQWLRQ ´+HFDPHLQGLGKLVUHVHDUFKDQGSHUIRUPHG RZQVW\OHDQGJDYHOHVVWKDQDGDPQLI\RXOLNHG 7KHQWKHUH¶V+RZDUG&RVHOOWKHODWHJUHDWLPSHFFDEO\´VDLGReggie RutherfordFUHDWRU LW IRUPHU$%&KRVWDQGFRPPHQWDWRU&RVHOOZDV DQG H[HFXWLYH SURGXFHU RI WKH +HLVPDQOLNH +HZDVRQHRIWKHLFRQVWKDWWRRNVSRUWV ERPEDVWLFIRUVXUHEXWKHZDVPRUHOLNHDVHWXS EODFNFROOHJHDZDUGVVKRZKHOGLQ/RV$QJHOHV IURPDZHHNHQGSDVWWLPHWRDREVHVVLRQ CARRYING PDQRUDIRLOIRUWKHOLNHVRIVKRZPHQ´'DQG\´ IURP6FRWWKRVWHGWKHDQG (631QHHGHGSHRSOHOLNH6WXDUW6FRWWWRPDNH 'RQ0HUHGLWKRI0RQGD\1LJKW)RRWEDOOIDPH VKRZV WKDW IHDWXUHG Florida A&M ZLGHRXW WKDWKDSSHQ THE DQGER[LQJJUHDW0XKDPPDG$OL Jacquay Nunnally DQGTennessee State ,QWKDWVHQVH6WXDUW6FRWWGLGIRUVSRUWV &RVHOOZRXOGGHOLYHUKLVSRPSRXVYHUERVHTXDUWHUEDFNLeon Murray DVWKHSOD\HUV ZKDW 0LOHV 'DYLV GLG IRU MD]] 7KH\ EURXJKW TORCH KLJKPLQGHG TXHVWLRQV RU FRPPHQWDU\ DQG RIWKH\HDU VRPHWKLQJGLIIHUHQWDQGLQQRYDWLYHWRWKHWDEOH 0HUHGLWKDQG$OLZRXOGXQFHUHPRQLRXVO\VKRRW ¶%RR H O O P S T H I S W E E K SATURDAY, JANUARY 10 MONDAY, JANUARY 12 CIAA CIAA Lincoln @ St. Augustines Lincoln @ Shaw BCSP Notes Bowie State @ Shaw Bowie State @ Fayetteville State Virginia Union @ St. Augustines Virginia Union @ Fayetteville State Elizabeth City State @ W-Salem Black college players in national hoops stats Chowan @ Winston-Salem State State 6L[WHQDelaware State VHQLRU FHQWHUKendall Gray LVHLJKWKLQWKH MEAC Virginia State @ JC Smith QDWLRQLQEORFNHGVKRWVDWSHUJDPHDQGHLJKWKLQUHERXQGLQJDW Coppin State @ Howard Chowan @ Livingstone Hampton @ Bethune-Cookman MEAC SHUJDPH%RWKVWDWVDUHWRSVLQWKHMEAC SC State @ NC Central Delaware State @ Howard 6L[IRRWArkansas-Pine Bluff MXQLRUTevin Hammond LVFXUUHQWO\ Gray Gaston Warner Morgan State @ Delaware State SC State @ NC A&T VHFRQGLQWKHQDWLRQLQVWHDOVDWSHUJDPH+HLVWKHWRSVWHDOVPDQLQ Norfolk State @ Florida A&M Norfolk State @ Bethune-Cookman WKHSWAC Carbo WRSVWKH0($&LQVFRULQJDWSRLQWVSHUJDPHJRRGIRUWK Savannah State @ NC Central Savannah State @ NC A&T Norfolk State MXQLRUIRUZDUGRashid Gaston LVWLHGIRUWHQWK LQ'LY, SIAC UMES @ Morgan State Hampton @ Florida A&M LQWKHQDWLRQLQGRXEOHGRXEOHVZLWKHLJKW*DVWRQLVQLQWKLQWKHMEAC 6L[WZRMXQLRUFHQWHUJasmine Peeples RIAlabama State WRSVWKH Clark Atlanta @ Kentucky State SIAC Fort Valley State @ Stillman LQVFRULQJDWSRLQWVSHUJDPHDQGVHFRQGLQUHERXQGLQJDWSHU 6:$&DQGLVVHFRQGLQ'LY,LQEORFNHGVKRWVDWSHUJDPH6L[IRXU &ODÀLQ#6WLOOPDQ FRQWHVW Bethune-Cookman VRSKRPRUHKailyn Williams EHVWVWKH0($&DQGLV Morehouse @ Miles Morehouse @ LeMoyne-Owen &ODÀLQ#/DQH Paine @ Kentucky State 6L[IRXUMXQLRUJXDUGA. J. EnglishVRQRIWKHIRUPHUCIAA SOD\HU WKLQ'LY,DWSHUJDPH Benedict @ Spring Hill Fort Valley State @ Tuskegee RIWKH\HDUDWVirginia Union RIWKHVDPHQDPHLVVHFRQGLQWKHQDWLRQLQ Delaware State VRSKRPRUHJXDUGRaven Bankston KDVFDQQHG Albany State @ Tuskegee Albany State @ Spring Hill 'LY,VFRULQJDWSRLQWVSHUJDPH RIIUHHWKURZVWRWRSWKH0($&DWDFFXUDF\%DQNVWRQ¶VSHU Paine @ LeMoyne-Owen Clark Atlanta @ Lane Fayetteville State VRSKRPRUHJXDUGJoshua Dawson LVDPRQJWKH FHQWDJHLVHLJKWKLQWKHQDWLRQ Benedict @ Miles SWAC DVVLVWVOHDGHUVRQWKH1&$$'LY,,OHYHO'DZVRQDYHUDJHVD&,$$EHVW Jackson State VHQLRUJXDUGDominique Brothern OHDGVWKH6:$& Alabama A&M @ Miss. Valley State SWAC Alcorn State @ Grambling State Alcorn State @ Jackson State DVVLVWVSHUJDPHJRRGIRUWKLUGLQWKHQDWLRQ DQGLVWKLUGLQ'LY,VWHDOVDWSHUJDPH Alabama State @ Miss. Valley State Alabama State @ Ark.-Pine Bluff 6HYHQIRRWMXQLRUFHQWHUGatluak Thiep DOVRRI)D\HWWHYLOOH6WDWH ,Q'LY,,&,$$VFRULQJDQGUHERXQGLQJOHDGHUVerdine Warn- Alabama A&M @ Ark.-Pine Bluff OHDGVWKHFRQIHUHQFHLQEORFNVDWSHUJDPHDÀJXUHWKDWSXWVKLPVHF erDWUDQVIHUIURPHamptonLVWKLUGLQWKHQDWLRQDWSRLQWVSHUJDPH RQGQDWLRQDOO\LQ'LY,,Johnson C. Smith IRUZDUGAlandre Davis DQGIRXUWKLQUHERXQGLQJDWSHUJDPH+HUWHQGRXEOHGRXEOHVWLHIRU LVDOVRLQWKHWRSWHQDWSHUJDPH IRXUWKQDWLRQDOO\:DUQHULVDOVRVKRRWLQJDOHDJXHEHVWIURPWKH Winston-Salem State VHQLRUIRUZDUGWykevin BazemoreKDVUHJ ÀHOGJRRGIRUÀIWKLQWKHQDWLRQ LVWHUHGHLJKWJDPHVZLWKGRXEOHGRXEOHVWLHGIRUIRXUWKLQWKHQDWLRQ+H &,$$DVVLVWVOHDGHUShahadah Barrett RIVirginia Union LVWLHGIRU OHDGVWKH&,$$DQGLVIRXUWKQDWLRQDOO\LQUHERXQGVSXOOLQJGRZQSHU VHYHQWKQDWLRQDOO\DWSHUJDPH7HDPPDWHAshle Freeman JHWV JDPH+HDOVRVFRUHVSRLQWVSHUJDPHWLHGIRUWKLQWKH&,$$ VWHDOVSHUJDPHWKLUGLQ'LY,,Elizabeth City State VHQLRUJadda Jef- 2QWKHZRPHQ¶V'LY,VLGHNorfolk State VHQLRUJXDUGRae fries LVVHYHQWKDWSHUJDPH 2 0 1 4 - 1 5 B L A C K C O L L E G E B A S K E T B A L L (Results, Standings and Weekly Honors - Women) CENTRAL INTERCOLLEGIATE MID EASTERN SOUTHERN INTERCOLLEGIATE SOUTHWESTERN CIAA ATHLETIC ASSOCIATION MEAC ATHLETIC CONFERENCE SIAC ATHLETIC CONFERENCE ATHLETIC CONFERENCE BCSP NFL PLAYERS OF THE WEEK SWAC INDEPENDENTS DIV CONF ALL CONF ALL CONF ALL DIV ALL W L NORTH DIVISION W L W L W L W L W L EAST DIVISION W L W L Virginia State 0 0 2 0 10 2 W L W L Md. E. Shore 2 0 5 7 Benedict 2 0 7 3 UDC 10 2 Wild Card Weekend Chowan 0 0 2 1 6 7 Texas Southern 2 0 5 8 Hampton 1 0 5 9 &ODÀLQ Lincoln (Mo.) 6 6 Lincoln 0 0 1 1 9 3 Jackson State 2 0 5 8 Florida A&M 1 0 4 8 Clark Atlanta 1 1 4 4 Tennessee State 4 8 Bowie State 0 0 1 2 6 6 Coppin State 1 0 2 10 Ark. Pine Bluff 1 0 3 9 )RUJDPHVRI-DQXDU\ Paine 1 1 3 7 W. Va. State 4 6 Eliz. City State 0 0 1 2 6 6 SC State 1 1 8 5 Alabama State 1 1 5 7 Virginia Union 0 0 0 2 4 7 Fort Valley State 1 1 3 10 Cheyney 2 11 NC A&T State 1 1 7 6 Southern 1 1 2 9 SOUTH DIVISION Albany State 1 1 2 7 Bethune-Cookman 1 1 4 10 Alcorn State 1 1 2 9 Livingstone 0 0 3 0 12 0 Norfolk State 1 1 2 11 WEST DIVISION INDEPENDENT PLAYERS OF THE WEEK OFFENSE J. C. Smith 0 0 2 0 12 1 Alabama A&M 1 1 1 10 Howard 1 1 1 12 Kentucky State 2 0 6 2 PLAYER JACOBY JONES, WR/KR, Bal- St. Augustine’s 0 0 1 1 7 4 Miss. Valley State 0 1 2 10 Telisha Turner, 5-3, Sr., G, UDC - Scored 25 points Savannah State 0 1 4 8 LeMoyne-Owen 2 0 6 4 Shaw 0 0 1 2 8 7 Grambling State 0 2 3 10 on 10 of 17 shooting including 2 of 5 from behind the Morgan State 0 2 3 11 Spring Hill 1 0 6 4 timore (6th year, LANE) – One Fayetteville State 0 0 1 2 5 7 North Carolina Central 0 2 2 11 Prairie View A&M 0 2 3 11 arc in win over Daemen. Tuskegee 0 1 0 8 UHFHSWLRQIRUWKUHH\DUGVÀYH Winston-Salem State 0 0 0 2 4 8 Delaware State 0 0 1 10 NEWCOMER Miles 0 2 1 6 NA SWAC PLAYERS OF THE WEEK kickoff returns for 115 yards BCSP CIAA PLAYERS OF THE WEEK MEAC PLAYERS OF THE WEEK Lane 0 2 0 8 PLAYER \DUGDYHUDJH PLAYER PLAYER Stillman 0 2 0 10 A l e x u s J o h n s o n , 6 - 2 , R - S o . , F, T E X A S S O U T H E R N Verdine Warner, Sr., C, SHAW - Averaged 22 Alexis Udoji, 6-4, Jr., F/C, UMES - Fifth double- - Averaged 19 points and 8 boards in two wins to points and 17 rebounds in two games. Had 26 in double with 22 points, 10 rebounds vs. Monmouth. SIAC PLAYERS OF THE WEEK open the new year. Had game-high 25 points with loss to Chowan. 6KRWRIIURP¿HOGVFRUHGDOOLQVHFRQGKDOI PLAYER & NEWCOMER 8 rebounds vs. Southern after tallying 13 points with DEFENSE NEWCOMER Malia Tate-DeFreitas, HAMPTON - Averaged 21.5 Tenesha Wright, 5-8, Fr., F, LOC - Averaged 13.5 8 boards vs. Alcorn State. Kaye Crosby, Sr., F, LIVINGSTONE - Averaged 17 points 3.5 boards and 1.5 steals in two Classic points and 7 boards in two wins. Tallied 15 points NEWCOMER RASHEAN MATHIS, DB, De- points and 7 rebounds shooting 66.7% in two wins. games. Named MVP in Classic totalling 26 points with 9 rebounds in win over Clark Atlanta, 12 points NA ROOKIE vs. Bowling Green DQGERDUGVLQZLQRYHU&ODÀLQ troit (12 year, BETHUNE- Diyamond Crenshaw, Fr., F, CHOWAN - In 1-1 ROOKIE COOKMAN) - Three solo tack- week, averaged 11.5 points, 7.0 rebounds. Scored Moengaroa Subritzky, 5-10, G, UMES - Double- 14 vs. FSU. double of 21 points and 10 boards in win over les and one forced fubmle in COACH Monmouth. Anita Howard, LIVINGSTONE - Wins over BSU and DEFENSE loss to Dallas. VUU to move to 11-0 overall. Zuri White, 5-8, Fr., G, MSU - Had 26 boards, 11 points, 3 steals vs. UMBC. Grabbed 14 boards in loss to Brown. © AZEEZ Communications, Inc. Vol. XXI, No. 22 Classifieds SUNDAY, JANUARY 11, 2015 PAGE 4B ANNOUNCEMENTS FOR SALE SERVICES ADOPTION MEDICAL SUPPLIES AUTO Childless, married couple seeks to adopt. Will be hands-on Medical Guardian- Top-rated medical alarm and 24/7 DONATE YOUR CAR, Truck or Boat to Heritage for the Blind. mom/devoted dad. Love, laughter, learning. Expenses medical alert monitoring. For a limited time, get free Free 3 Day Vacation, Tax Deductible, Free Towing, All Pa- paid. Preplacement assessment approved by Better Living equipment, no activation fees, no commitment, a 2nd perwork Taken Care Of. 800-337-9038. Agency, 6/26/2014. Jeanne & Damian 1-855-563-8901. waterproof alert button for free and more - only $29.95 per month. 800-615-3868 FINANCIAL AUDITIONS Sell your structured settlement or annuity payments for Acorn Stairlifts. The AFFORDABLE solution to your stairs! CASH NOW. You don't have to wait for your future pay- ALL NEW HIP-HOP REALITY TV SHOW!! Now Accepting Sub- **Limited time -$250 Off Your Stairlift Purchase!** Buy Direct missions! Your ONE SHOT to WIN $100,000 + Record DEAL. ments any longer! & SAVE. Please call 1-800-291-2712 for FREE DVD and Call 1-800-291-9551 Will You Take It? www.MyOneShot.TV Twitter: @OneShot- brochure. Show HOME IMPROVEMENT DISABILITY BENEFITS TV/SATELLITE All Things Basementy! Basement Systems Inc. Call us for all REDUCE YOUR CABLE BILL! SOCIAL SECURITY DISABILITY BENEFITS. Unable to work? De- of your basement needs! Waterproofing, Finishing, Struc- Get a whole-home Satellite system installed at NO COST nied benefits? We Can Help! WIN or Pay Nothing! Con- tural Repairs, Humidity and Mold Control. FREE ESTIMATES! and programming starting at $19.99/mo. FREE HD/DVR Up- tact Bill Gordon & Associates at 1-800-371-1734 to start your Call 1-800-698-9217 grade to new callers, SO CALL NOW 1-800-571-6851. application today! DirecTV! Act Now- $19.99/mo. Free 3-Months of HBO, Starz, PERSONALS SHOWTIME & CINEMAX. FREE GENIE HD/DVR Upgrade! Meet singles right now! No paid operators, just real peo- 2014 NFL Sunday Ticket included with Select Packages. ple like you. Browse greetings, exchange messages and New Customers Only. IV Support Holdings LLC- An author- connect live. Try it free. Call now: 888-909-9906 CAREER TRAINING ized DirecTV Dealer. Some exclusions apply - Call for details MEDICAL BILLING TRAINEES NEEDED! Doctors & Hospitals 1-800-849-3514 need Medical Office Staff! NO EXPERIENCED NEEDED! On- BIDS line Training gets you job ready! HS Diploma/GED & Com- Dish TV Retailer- SAVE! Starting $19.99/month (for 12 BlD REQUEST puter needed. Careertechnical.edu/nc. 1-888-512-7122 months.) FREE Premium Movie Channels. FREE Equipment, Installation & Activation. CALL, COMPARE LOCAL DEALS! RPC Contracting is requesting bids from any interested NCDOT Certified DBE firms for the Elizabeth City Halstead GET YOUR COMPUTER CERTIFICATION ONLINE! Train at 1-800-405-5081 Blvd. Greenway Trail Project EB-4991 bidding on 1/29/15. home to become a Help Desk Professional or MCSA certi- There will be a pre-bid conference at 3:00 PM on Monday fied! NO EXPERIENCE NEEDED! Call CTI for details! 1-888- 1/19/15 at the office of RPC Contracting, 934 W. Kitty Hawk 734-6712. Visit us online at MyCTI.TV SERVICES Road, Kitty Hawk, NC. Plans and specifications are avail- able for review at the same location or will be provided AVIATION Grads work w/JetBlue, Boeing, NASA and oth- ADVERTISING upon request. For more information, please call 252-261- ers- start here with hands-on training for FAA certification. REACH READERS across North Carolina for only $375. Run 3336, ask for Jay. RPC Contracting is an Equal Opportunity Financial aid if qualified. Call Aviation Institute of Mainte- your 25-word classified line ad in 99 newspapers with one Employer. nance. 877-300-9494. call to this newspaper, or call NCPS at 919-516-8009. Send your Classified ads to: career corner EMPLOYMENT ww.triangletribune.com/Submit_CLFD EDUCATION Navy Reserve provides a great ca- TEACHER RECRUITMENT FAIR to fill 2015-16 vacancies in 18 BIDS reer option for medical students Virginia school divisions. Fri, Jan 30, 2015 - 4pm to 7pm. Sat, ADVERTISEMENT FOR BIDS BrandPoint Jan 31, 2015 - 9am. to 12 noon @ Salem Civic Center, 1001 Brodgen Middle School Boulevard, Salem, VA 24153. www.wvpec.org -- Job Fair. Life Safety Upgrades The schooling needed to become a doctor is exten- Sponsored by the Western Virginia Public Education Con- Durham Public Schools/Durham County sortium. sive and expensive. There are four years of under- graduate studies, four years in a medical school, and Sealed bids from licensed contractors will be received by GENERAL Durham Public Schools, Durham, North Carolina on Tues- then several years of residency, depending on the US Census Bureau is Hiring in North Carolina Counties – day, February 10, 2015 for furnishing of labor, material and medical field the student wants to pursue. For doctors Franklin, Johnston and Wake equipment for the Life Safety Upgrades at Brodgen Middle who want to pursue a specialized field, a fellowship Field Representative- $13.96 an hour School, 1001 Leon Street, Durham, North Carolina, 27704. Applicants must pre-register to take the census applicant Bids will be received up to 2:00 PM from Single Prime bid- is also needed, and this can add another one to three test. Email a copy of your resume to ders at which time and place all bids will be publicly years of schooling. [email protected] or call - 404-730-3959 to opened and read aloud. Deliver bids to Durham Public apply. Schools, Construction and Capital Planning Office located The Bureau of the Census is an EEO employer at 2011 Hamlin Road, Durham, North Carolina 27704. The costs for this schooling can quickly add up, which is one reason medical students want to get as •No bid may be withdrawn after the scheduled closing much paid experience as they can. One area where PROFESSIONAL time for the receipt of bids for a period of sixty (60) days. CITY OF ALBEMARLE: Assistant City Manager. $75,046.40. •Bid security required is 5% of the bid in cash, certified medical students are needed is the Navy Medical Re- Contact: NC ESC; city website: www.ci.albemarle.nc.us. check, or Bid Bond. serve. Health-care professionals will gain experience Deadline 2/6/15. EOE •Performance and Payment Bonds in the amount of 100% helping others around the world at sea or at top med- of the contract amount will be required. •Durham Public Schools reserves the right to reject any ical facilities. They'll be exposed to advanced train- TRANSPORTATION and all bids and to waive informalities or irregularities. ing and technology so progressive, the civilian sector Hiring OTR Professionals who want Consistent Miles- aver- may not even be aware of it yet. age 2,800+; consistent pay- average $51,400 per year; Minority Business Participation: Bidders shall note that com- 2012 or newer trucks; call Fischer Trucking today at 1-800- pliance with County of Durham M/WBE policies and the 486-8660. North Carolina Statute 143-128.2 (c) are required for this There are many medical career opportunities avail- project. able in the Medical Reserve. You could work behind DRIVER TRAINEES NEEDED! Become a driver for Stevens Transport! NO EXPERIENCE NEEDED! New drivers earn Project scope: Includes removal of existing water cooled the scenes, or be on the front line of health care de- $800+ per week! PAID CDL TRAINING! Stevens covers all chiller, installation of new air cooled chiller and associated livery. You could care for the health and mental needs costs! 1-888-748-4137 drive4stevens.com piping, pump, electrical, controls and general construc- of service members, or expand into the local com- tion. ATTN: Drivers - $2K Sign-On Bonus. Make $55k a Year. Great munity of a third-world country that's been hit by ca- Benefits + 401K. Paid Training/Orientation. CDL-A Req - 877- Pre-Bid Conference: Scheduled for Tuesday, January 20, tastrophe. Thousands of people serve in Navy Health 258-8782. www.ad-drivers.com 2015 at 2:00pm in the cafeteria of Brodgen Middle School. Care, researching a better way of life or guarding Inspection of the site shall be scheduled immediately after Join our Team! Guaranteed pay for Class A CDL Flatbed the Pre-Bid Conference. The project Engineer or Engi- against threats to human health. Drivers! Regional and OTR. Great pay/benefits/401k neer’s representative will be available to answer questions. match. CALL TODAY 864-299-9645. www.jgr-inc.com EOE It is mandatory that prime bidders attend the entire Pre- Medical students who join Navy Medical Reserve Bid Conference and visit the site prior to bidding. Super Career in 2015! Earn up to $0.43/mile, $2,500 Sign On may do the following: Bonus PLUS up to $0.03 per mile in bonus! Call 866-291-2631 Statement of Qualifications: Each proposal shall be ac- or SuperServiceLLC.com companied by a statement of qualifications that demon- * Use the latest techniques and technology in state- strates experience in at least five (5) projects of similar scope within the past three (3) years with references. of-the-art facilities, such as a national naval hospi- tal. FOR SALE Bidders may obtain a hard copy of the plans and specifi- cations at their own expense from: AUCTIONS * Collaborate with skilled, dedicated colleagues Accent Imaging – Raleigh Office using unrivaled resources. GOING, GOING, GONE! Promote your auction with a clas- 8121 Brownleigh Drive sified ad in 96 N.C. newspapers. A 25-word ad is only $375. Raleigh, NC 27617 For more information, call this newspaper or 919-516-8009. (919) 782-3332 * Support medical relief and education efforts around www.accentimaging.com the globe. WATERFRONT PROPERTIES AUCTION, 11.2+/-Acres Prime Waterfront on Trent River & Mill Creek, Pollocksville, NC - Plans and specifications are also open for inspection at just 15 minutes from New Bern - OnLine Bidding ENDS Jan- the following locations: * Take on leadership roles among leaders, giving stu- uary 22. Over 2300ft. on deep water. www.HouseAuction- •McGraw-Hill Construction Dodge Plan Rooms in Raleigh dents unrivaled management experience. Company.com 252-729-1162. NCAL#7889 and Charlotte, NC •Carolinas AGC, Inc. Plan Rooms in Raleigh, Greensboro HEALTH PRODUCTS and Charlotte, NC In addition, the Navy Medical Reserve is a team LOSE UP TO 30 POUNDS in 60 Days! •Construction Market Data offices in Cary, NC made up of professionals facing unique experiences Once daily appetite suppressant burns fat and boosts •Hispanic Contractors Association of the Carolinas in that will improve your skills and increase your energy for healthy weight loss. 60 day supply - $59.95. Raleigh, NC Call: 800-478-1109 •Reed Construction Data Center in Raleigh, NC knowledge, which is something you won't be able to find in the civilian world. Plus, you can get this ex- M/WBE businesses may view plans at the following loca- perience while living at home, or just about any place MEDICAL SUPPLIES tions: Got Knee Pain? Back Pain? Shoulder Pain? Get a pain-re- •NC Institute of Minority Economic Development at 114 W. around the world, on a schedule that fits your life. lieving brace -little or NO cost to you. Medicare Patients Parrish Street, Durham Call Health Hotline Now! 1- 800-958-6167 •City of Durham, Dept. of Equal Opportunity/Equity Assur- As you contemplate the future years of schooling ance at 302 Pettigrew Street, Durham Safe Step Walk-In Tub. Alert for Seniors. Bathroom falls can you'll need to complete your medical degree, con- be fatal. Approved by Arthritis Foundation. Therapeutic Jets. Less Than 4 Inch Step-In. Wide Door. Anti-Slip Floors. Signed: Jon Long, Executive Director sider how serving in the Navy Medical Reserve can American Made. Installation Included. Call 800-807-7219 Construction & Capital Planning influence your career. You'll discover high respect Durham Public Schools, Durham, North Carolina for $750 Off. and admiration from the nation for your service. AROUND THE WWW.TRIANGLETRIBUNE.COM TRIANGLE The Triangle RALEIGH TRIBUNE MUSEUM N.C. Museum of SUNDAY, JANUARY 11, 2015 – PAGE 5B History will host Time for Tots: Skates, Skis and Sleds Jan. 13, 10-10:45 a.m. for ages 3-5. Call 807-7979. LifeBOOK & Arts ACTION PLAN Raleigh will hold two public meetings on five- The Nigga year action plans: • Jan. 13, 6-8 p.m. – Method Community Center, 514 Method Road Project • Jan. 15, 6-8 p.m. – Chavis Community Center, 505 MLK Blvd. Experience PARENT ACADEMY By Kimetha Hill A parent seminar will THE SAN DIEGO VOICE & VIEWPOINT be held at the Community Parent Nigger. A very abrasive word. A Academy at the Family very volatile word. A very powerful Resource Center, Jan. 15, 6:30-8 p.m., 108 S. word. A word that has caused gen- Harrington St. RSVP to erations of damage to an entire cul- (919) 431-7704. ture of people. The word comes from very dark roots, MLK EVENTS but has somehow • Jan. 16 – Wreath-lay- “conformed” to the lik- ing ceremony at ing of many, many Memorial Gardens black folks. • Jan. 19, 11 a.m. – MLK Memorial March Now a “term of beginning at Capitol HTTP://WWW.ROROSITE.COM/ endearment,” the Building; Noon – word “nigga” is thrown Ecumenical Observance; around like “hello” 5:30 p.m. – MLK musical Nianda among circles of young celebration, Duke people. Mulemvo Energy Center for Nianda, documentary filmmaker Performing Arts and sociology student, grew frus- For Carolina Panthers trated with the use of the word, DISCOVERY DAY ECPI University will especially among the younger gen- host Campus Discovery erations, and developed a short Day Jan. 17, 10 a.m. to 4 documentary. p.m. at 4101 Doie Cope “The motivation behind it was all Road. Contact: Mika Heyl lovers:The Carolina Panthers are still Games,in the playoffs and what better activities the negativity I saw going on with at 571-0057. way to keep the kids busy while mom and dad watch the game is the N-word,” Nianda said. He the GO PANTHERS Activity Book. describes how the word is littered CARY The 48-page team book includes games, mazes, puzzles, word among popular rap songs of stars AWARDS searches, crosswords and much more. A portion of all proceeds Town of Cary is including Nicki Minaj and other is donated for activity books to children in local hospitals. artists who choose to utilize limit- accepting nominations ABOUT THE AUTHOR: Hall resides in Vestavia, Alabama, with for the Parks, Recreation ed vocabulary in their expressions. her husband and four children. She has donated hundreds of GO PANTHERS Activity Book & Cultural Resources By Darla Hall “All of these songs are coming out, Volunteer Awards. Visit books to children in local hospitals. In The Sports Zone, LLC, 14.99 HC and nobody was really saying any- www.townofcary.org or thing or giving an alternative to it. call 469-4061. Deadline: So I felt that I should take it upon Jan. 16. myself to put out an alternative for MLK EVENTS FILM REVIEW: the young people to look at.” • Jan. 16, 7 p.m. – Inspired by his black studies Women of Action class, Nianda set out to interview Gathering, Page-Walker people at random in a “man on the Arts & History Center street” type setting to capture reac- • Jan. 17, noon-3 p.m. tions to the word “nigga” on cam- – Dream of Community, era. The Cary Theater Thus, The Nigga Project • Jan. 18, 3 p.m. – An Arts Tribute to Martin, Experience was birthed. Page-Walker “The demand was high for it so I did Part II,” he said. MORRISVILLE The project is an extension of a MLK EVENTS research project on which Nianda • Jan. 19 – sign up for worked during his studies. Diving a day of service with into the community and asking United Way. Visit questions was something that http://unitedwaytrian- gle.galaxydigital.com. came naturally to him. In Part I, Nianda felt it best to randomly MLK EVENTS select people for responses to the • Jan. 17, 7:30 p.m. – word. Some were classmates, some Durham Symphony were old, very few were young, but Orchestra tribute, Duke his selection was random. University’s Baldwin “I tried to target young men, but Auditorium. Call 684- a lot of the younger men didn’t 4444. • Jan. 18, 3 p.m. – N.C. want to get on camera. The older NAACP President generation was more willing to be William J. Barber II is the on camera and talk about it and keynote speaker at how they felt. In Part I, I only have Duke’s MLK commemo- one or two young people in it ration in Duke Chapel. David Oyelowo (back row, center) and an ensemble cast star in the historical drama. because they didn’t want that face • Jan. 19, 6 a.m. – MLK time.” Triangle Interfaith By Dwight Brown (David Oyelowo, “Middle movie when Edgar Hoover are dying in the street for The reactions to the word were Prayer Breakfast, NATIONAL NEWSPAPER of Nowhere”) and one of has sent incriminating this. Punished for want- interesting, and Nianda points to Sheraton Imperial Hotel, PUBLISHERS ASSOCIATION SCLC’s chief strategists, tape recordings of two ing, for needing, to partic- 4700 Emperor Blvd; R.I.P. Dr. Martin Luther the emotion the word provoked in Hosea Williams (Wendell people having sex to ipate in the American many who were interviewed. 10:30 a.m. – Unity March King Jr. Your story has King’s stalwart wife & Rally beginning at NC Pierce, The Wire) to Selma. political process. It cannot “The majority of the responses been told. Your legacy A change is gonna come. Coretta (Carmen Egojo). wait, sir.” Mutual, 411 W. Chapel passed on. Your strategies were not necessarily positive. But Hill St. King and his inner circle That moment when she Oyelowo was born for with the young people, I found that for non-violent demon- plan a 50-mile march from confronts her husband is the role. He looks like strations shared. Your they were more accepting of it,” RECYCLING Selma to Montgomery to one of the most dramatic, Martin, especially after said Nianda as he cites the uses The next e-waste recy- ability to change hearts, bring attention to the intimate and upsetting adding a few pounds, a that can be heard in younger gener- cling and paper shred- minds, and laws has been plight of blacks who are moments in the movie. pencil mustache and ding event is Jan. 17, 8 well documented. ation circles. “That’s my nigga, denied the right to vote. It shows the depths to razor haircut. The voice. that’s my homie; that’s my broth- a.m. to 2 p.m. at Durham Selma, in the most which the FBI was willing County Stadium, 750 Meanwhile, he has been in The movements. The ora- er.” inspiring way, relays talks with President to go to destroy King. It tory skills. It’s as if MLK Stadium Dr. MLK’s state of grace. It is a But he says, “With the older gen- Lyndon B. Johnson (Tom demonstrates that a entered his soul. Egojo is eration, 35 and up, it’s more so like CHAPEL HILL worthy homage befitting Wilkinson, Michael strong love between a the essence of Coretta in of America’s most iconic a negative word, a term that we LECTURE Clayton), pressuring him husband and wife can appearance and nuance. shouldn’t be using. A lot of them A seminar on families civil rights leader. A mon- to push Congress to pass a even endure sabotage. It When she talks, you feel want to eradicate the word, but and individuals living umental achievement. Voting Rights Act. also reveals that the man like she is telling secrets with disabilities is Jan. In 1965, African- they don’t really know how to.” Johnson doesn’t take who led this country out from the past. As the project grew, the genera- 13, noon to 2 p.m. at Americans, though guar- from the shadows of seg- UNC School of Social kindly to the pressure, The casting of King’s tion divide was made clear to anteed the right to vote in and is waiting for the regation and influenced inner circle is excellent: Work, Tate-Turner- the 1870s under the 15th Nianda. The word provokes emo- Kuralt Auditorium. “right time.” King looks civil rights movements for Cuba Gooding Jr. as civil Amendment, were rou- tions of pain and hurt for older Contact: Barbara Leach for ways to force decades to come, was sim- rights attorney Fred Gray; generations, emotions that seem to at (919) 966-0396. tinely denied the privi- Johnson’s hand. The two ply human. He had Common as social activist lege, and given literacy be lacking among the conscious- engage in a war of wills as foibles. He had regrets. James Bevel; André ness of youth. But Nianda felt BLOOD DRIVE and civic tests filled with Selma is about to explode Yet, his irrepressible spirit Holland (from the film Delta Sigma Theta trivia few would know. In instead of condemning the youth, on the 6 o’clock news. endured. “42”) as Andrew Young; education on the word must hap- Sorority Chapel Hill- Selma, Alabama, Annie It helps that the produc- Carrboro Chapter will Providence brought Stephan James as John pen. Lee Cooper (Oprah director Ava DuVernay on ers and screenwriter Paul Lewis, one of the last sur- host its annual MLK/ARC Winfrey) prepared herself “A lot of them [youth] don’t know Blood Drive on Jan. 19, board for this ambitious Webb, with re-writes by viving Freedom Riders. for the dehumanizing poll the history behind the word, and 1-5:30 p.m. at Hargraves project. Her family hails DuVernay, chose to show These days, as demon- when they do know it’s still kind of Recreation Center, 216 tax experience, but even from Hayneville, Alabama, just one major achieve- strators fill the streets for she couldn’t answer all the like, ‘That doesn’t have anything to N. Roberson St. Call 800- a small town between ment in MLK’s life. The various causes, some- do with me. That was then.’ They 733-2767 questions and was denied Selma and Montgomery. March on Washington, times it’s important to put her right to vote. She was- don’t really have an emotional con- She directed David Nobel Peace Prize and events into perspective. nection to the word. And that was n’t alone. In Alabama, Oyelowo in the intimate assassination are not in To gauge what will hap- there were whole counties another goal of The Nigga Project – romantic indie drama this film. Most location pen next, you have to look to emotionally connect the youth where no black person Middle of Nowhere. She shots are in Selma or the back in time. Unrest had ever been allowed to to the origin behind the word – the knew how to help him White House. You focus brings progress. Protest real intent behind the word. A lot of For the latest vote. Something had to be inhabit MLK’s persona. on the stops, starts, set- brings awareness. Unity done. them don’t know that it’s negative. news and She knew how to tell a per- backs and triumphs of an brings hope. The sacri- And if they do know it’s negative, The Student Nonviolent sonal, humane story. She historic march and the fices we make today may information Coordinating Committee they don’t really care that it’s nega- took those strengths and hopeful passage of the not be felt for years to tive. So if I could emotionally con- affecting the had been organizing masterfully added them Voting Rights Act. come. But Selma teaches peaceful demonstrations nect them to the original intent African- to one of the most land- The dialogue between us that when we strive, behind it, I felt that would give for voting rights for years, mark moments in MLK and his disciples, his things change. to no avail. The Rev. them a standpoint to go from.” American American history. wife and the president are MLK knew that better Nianda’s documentary has been Frederick Reese (E. Roger Even with all those big often electric. Especially then anyone. community, Mitchell, Flight), head of shown at several venues around events on her plate, the sparring between LBJ Visit NNPA San Diego, California, as his aim is visit us online: the Selma Teachers DuVernay uses her skills and MLK over Johnson’s Film Critic Dwight Association, invites to spark as much discussion about triangletribune directing relationships to snail-pace movement Brown the word as possible. Christian Leadership pay special attention to towards justice: “I came at .com Conference President (Read the entire article on our King’s personal life. here prepared to talk to DwightBrownInk.com. website.) Martin Luther King Jr. There’s a scene in the you about people. People orship WWW.TRIANGLE TRIBUNE.COM The Triangle Wriefs TRIBUNE DURHAM SUNDAY, JANUARY 11, 2015 PAGE 6B BNORTH EAST 3204 Hwy 55 Derrick Tucker will deliver his initial sermon Jan. 11 at 3 p.m. Call 544-2142. Religion KING’S PARK INT’L 1305 Odyssey Drive A youth program honoring Martin Luther King Holiday is Jan. 16 at 4 p.m. All youth are invited. WATTS STREET 800 Watts Street Mel Williams, coordinator of End Poverty Durham, will dis- cuss Dr. King’s legacy Jan. 18 at 11 a.m. Williams is Watts’ retired senior minister after a 24-year career. Lunch will fol- low. Reserve your space at 688-1366. The leadership in the Connectional AME Church designated Dec. 14 as "Black Life Matters Sunday." All AME church members were asked to wear COVENANT PRESBYTERIAN black to show solidarity for human kind. Emmanuel AME Church is always willing to support the cause of social justice. 2620 E. Weaver Street Youth Sunday is Jan. 18 at 11 a.m. Michelle Laws, execu- tive director of the N.C. NAACP, is the guest speaker. PEACE MISSIONARY 2608 Apex Highway MLK annual religious service is Jan. 19 at 6 p.m. Bishop George W. Brooks of Mt. Zion Baptist in Greensboro will Raleigh Diocese breaks preach. Send your church news to: The Triangle Tribune, 115 Market Street, Suite 360G, THE ASSOCIATED PRESS rent cathedral, which was home for all the faithful in "I promise we will build which covers eastern North Durham, NC 27701; e-mail groundRALEIGH – The Catholic originally built ason a parish the diocese.cathedral A beautiful and only what the people of Carolina. [email protected]; or Diocese of Raleigh broke church and seats about 320 spacious church whose God will allow us to do," The diocese has grown fax 688-2740. Deadline: ground Saturday on a people. The only smaller doors will be open to all. A Burbidge said. "No loan, from 6,000 Catholics to Tuesday by noon. cathedral that will seat cathedral in the U.S. is in place where sacred music nothing beyond our 500,000 people since it was about 2,000 people, Juneau, Alaska, Bishop will be heard and lectures means. Faithful steward- founded 90 years ago, he almost seven times what Michael Burbidge said. will be conducted," Burbidge ship." said. the current building can The groundbreaking for told reporters before the cer- The new cathedral will "We will do everything pos- seat. the Holy Name of Jesus emony. replace Sacred Heart sible to make this entire com- The new cathedral will Cathedral included prayers, The $41 million cathedral Cathedral in downtown munity proud by making be built on 39 acres in singing and Burbidge and will take about two years to Raleigh. sure our cathedral is a power- Atlanta Raleigh that used to house other church leaders in their complete. The diocese had Burbidge said it is an ful reminder of God's pres- diocese offices and flowing vestments and hard thought about building a especially proud day for ence in our midst," Burbidge Cardinal Gibbons High hats, turning over dirt. church that cost twice as him after dedicating 11 said. "The one who calls us to School. "We are building a worthy much, but backed away from new churches during his love and to serve Him and fire chief It will replace the cur- drawing place for God - a the idea, Burbidge said. nine years in the diocese, one another." fired over By James wants to debate me on this Christ’s sake, I delight in attack by old friends. It is Lord and Savior. I guess what RefreshWashington by bringing up thewith lives of weaknesses, inPaul insults, in also not unusual for new I’m really saying is when the HOUSTON FORWARD TIMES the 12 apostles, I have con- hardships, in persecutions, Christians to come under going gets extremely tough, book sidered them as well as the in difficulties. For when I am the attack of the world, check Paul. Like Christ, he’s By David Roach I remember reviewing prophets, and I’m just one of weak, then I am strong.” (2 since it is in the world that been through and has experi- BAPTIST PRESS the letters of Paul in Bible those who is in awe of Paul. A Corinthians 12:8-10.) This Satan has some degree of enced the worst that life has study. In doing so, I was very large part of the Bible is kind of thinking and belief power. I think Paul’s good to offer. But because of his ATLANTA – Atlanta Fire constantly reminded that devoted to Paul’s building of led to the eventual prolifera- news is there is a place of belief system, he’s experi- Chief Kelvin Cochran has been one cannot look at Paul the early church at a time tion of the church world- refuge for all of us when enced the best of God’s terminated following a city without really seeing when who you worshipped wide. It also makes the point this happens. He uses him- promises. It’s like a refresher investigation into a book he Jesus’ amazing handi- was a life-and-death deci- of how the lives of so few self as an example to fol- course, and I just wanted to wrote that calls homosexual work. sion. have impacted and influ- low. let you know where I go dur- behavior immoral. But Now you need to know Paul himself says in his let- enced so many in the world If I surrender my weak- ing difficult times. You might Cochran said the investiga- that I think Paul is an awe- ters to the church in Corinth then, and also in the world as nesses to the power of also find some answers tion, which has not been some person when it that there indeed was a point we know it today. Christ and subjugate my there. released to the public, pro- comes to the story of his to his suffering and persecu- Forgive me if I find this a will to that of the Lord’s, The point I’m trying to duced no evidence of wrong- life. I haven’t found a tion, and the basis for most, rather fascinating fact. Paul then I become empowered make is that in the eyes of doing. biography or autobiogra- if not all, of what he went is who he is because of his to deal with whatever is God, one’s weaknesses are Allegations of discrimina- phy of anyone in or out- through was a byproduct of unique one-on-one thrown my way. Life, the welcome opportunities for tion against homosexuals side of the “good book” his faith in Jesus Christ. It’s encounter with Christ. That Christian life, is funny that God to show up and show were "completely unfounded," who comes close to my another perspective of one encounter changed him and way. out. Have you ever wondered Cochran said Jan. 6. "The admiration for Paul; Jesus of my favorite scriptures: ultimately the world in which It places what I have why those who have been investigation shows that there notwithstanding. Because “But He said to me, ‘My grace we live. If that be true, then described as a bull’s eye through so much are able to is no evidence. Under no cir- the two are so closely is sufficient for you, for my our individual encounters on your back, designed to stand and witness mightily cumstances have I been dis- associated with one power is made perfect in with Christ should also have distinguish you from those for Christ? Re-examine the criminatory or hateful another, I can’t help but weakness.’ Therefore I (Paul) a profound effect on us and non-believers around you. reality of God’s grace, and towards any member of the consider the impact of will boast all the more gladly the world in which we cur- It, your faith, also sets you just might get your department in the LGBT com- this tandem on human about my weaknesses, so rently live. you up and apart to do answer. munity or a member of the history. that Christ’s power may rest It is not unusual for new great things in the name of May God bless and keep LGBT community at large." Just in case someone on me. That is why, for Christians to come under Jesus Christ, my personal you always. Cochran is a deacon, Sunday School teacher and Bible study leader at Atlanta's Elizabeth Baptist Church, a cooperating church with the Georgia Baptist Convention. A two- time Atlanta fire chief, Cochran also served as U.S. Fire Administrator under President Obama from 2009- The nerve of some people to 10. Cochran's 162-page self- published book, "Who Told You That You Are Naked?" seeks to help Christian men overcome feelings of guilt and disrespectBy Judy Bates building on fire? Did I missworshipthe one singing rules condemnation over past sins. THE BAPTIST PRESS an evacuation warning? No. I along with the It discusses homosexuality for merely sat in the balcony invitation. What DORA, Ala. – I wit- less than half a page, includ- where I had a bird's-eye view do I need to nessed a stampede the ing a mention of uncleanness of what was happening. The repent of? other day that might rival as the "opposite of purity; nerve of some people! I was So ... You're a grand opening sale, but including sodomy, homosexu- appalled. saying it's my in this case, it was a mass ality, lesbianism, pederasty, As others sat and prayed focus. While exodus of churchgoers bestiality, and all other forms for those being ministered to these other peo- leaving during the invita- of sexual perversion." and the decisions being ple were headed tion. Yes during, not Cochran told Fox News that made, the actions of these out the door, my after, the invitation. someone within the fire folks clearly said that the mind was fol- While our choir, praise department obtained a copy traffic or their lunch took lowing right team and congregation of the book and gave it to precedence over all else. along with sang "Let Faith Arise," an openly-gay city council mem- And, yes, I'm sure there were them. Instead of astounding number of ber Alex Wan. LGBT activists a few people who had legiti- praying for the people did just that: They responded to the book by call- mate reasons for their early decisions being rose. And then they ing for Cochran to be fired. departure but certainly not made, I was departed. Mayor Kasim Reed said the whole lot of them. fuming over the As people were trying JCochran's failure to obtain Why couldn't they stay in throng who to come forward to the proper city permission to pub- their seats a few minutes were departing. altar, they were battling lish the book and his refusal longer and pray for the deci- I see now, the flow of outgoing to remain silent about the sions being made? Or pray Lord. Staying in church folks who were matter during the city's inves- for those who were wavering place may make eager to beat the traffic tigation contributed to the fir- in indecision? Those me look more out of the parking lot or I must have some nerve. for others as I would want ing. moments could very well reverent, but if my mind has the Methodists to Cracker Forgive me, Father. Help me them to pray for me. In November Cochran was determine some people's already left the service, I Barrel. to spend my time in church Thank You for not giving suspended without pay for a eternal destiny. might as well not be there, I'm not certain which in real worship. Help me to up on me, Jesus. I'm a work in month and ordered to under- What's that, Lord? I need to either. Yes, I've read that it's was the case, but they repent of my own faults progress; and I have a long, go sensitivity training. repent of my own attitude? easier to see the speck in were sure in a hurry. instead of getting side- long way to go before I'm What do You mean? I was your brother's eye even when Was this an extraordi- tracked by any kind of dis- remotely what You would the one staying in place. I was you've got a log in your own. nary instance? Was the traction. And help me to pray have me to be.