Public Benefits’ $115,000 for a PRIVATE DOG PARK? $112,000 for REQUIRED SEWER SYSTEM? by Mark Noack a Hotel at 2700 W

So much food, so little flavor WEEKEND | 14

JULY 7, 2017 VOLUME 25, NO. 24 www.MountainViewOnline.com 650.964.6300 MOVIES | 17 Cautious high school district holds on to reserves CONSERVATIVE BUDGET EXCLUDES BEHAVIORAL-HEALTH, OTHER INITIATIVES By Kevin Forestieri adopted a spending plan of $82.9 million. During a board study espite talk of launching session in February, board mem- expensive new programs bers considered whether a $2 Dand spending down million reserve fund ought to be reserves earlier this year, the put to use in the upcoming school Mountain View-Los Altos High year; spending options reviewed School District opted to take a included a $500,000 behavioral cautious approach to the budget health program, an initiative to for the 2017-18 school year. reduce school avoidance, new Last week, the high school dis- classroom technology and capital trict’s board of trustees approved projects like new classrooms and a spending plan for the upcoming cafeteria furniture. school year that, by most mea- In the end, the district didn’t sures, is a “boring” budget with include any of those initia- little in the way of new initiatives, tives in the budget, Mathiesen according to Associate Superin- said. Some of the ideas were tendent Mike Mathiesen. Small instead addressed within exist- changes include about $500,000 ing, already budgeted programs, ANA SOFIA AMIEVA-WANG in new retirement costs, addi- but no new big line-item in the THURSDAY NIGHT GETS LIVELY tional teachers to keep up with budget came from the study enrollment and a bigger pool of session. Espe Ndombe dances to music performed by the Cheeseballs at Thursday Night Live on June 29. funds for updating and improv- One goal in this year’s budget Downtown Mountain View’s streets were filled with revelers enjoying the summer concert series and ing the district’s technology. is maintaining the district’s large its many additional diversions, like children’s activities, a classic car show and farmers market food stalls. The district expects to see stockpile of Chromebooks, which Next up is the classic rock sounds of Daze on the Green, playing on July 13. Just head to Castro Street another healthy increase in function as portable laptops for between 5:30 and 8:30 p.m. You can’t miss it. (More photos on Page 10) annual revenues — $84.9 million for the 2017-18 year — and See BUDGET, page 6 Council balks at developer’s proposed ‘public benefits’ $115,000 FOR A PRIVATE DOG PARK? $112,000 FOR REQUIRED SEWER SYSTEM? By Mark Noack a hotel at 2700 W. El Camino Real pointed out that the dog park was with a dense, five-story apartment originally planned for the proj- he insatiable need for more project. Taken altogether, a project ‘SummerHill homes has been very ect’s ground level, but it had to be housing was enough to of that size would be required to prosperous in Mountain View, but I think relocated upstairs to make way for Twin approvals for a 211- contribute $1.73 million in com- a bike path connection that the unit apartment project that will munity benefits, according to city they can pay their fair share here.’ city requested between Del Medio go up along Mountain View’s staff’s calculations. Developers Avenue and Cesano Court in Palo crowded El Camino Real cor- can propose a variety of ways to COUNCILWOMAN PAT SHOWALTER Alto. She noted that the city has ridor. But while the City Council meet this requirement, although full discretion to reject these ame- unanimously endorsed the proj- city officials usually encourage nities. If it does, the money would ect, council members also poked them to focus on affordable closed to the public. a community benefit would send likely be redirected into the city’s holes in its public-benefit package, housing and local neighborhood Both requests were roundly the wrong signal to other develop- affordable housing fund. criticizing the developers for what needs. rejected by council members. ers looking to pad their bottom There were other aspects of they see as trying to game the sys- As part of their pitch, Summer- Taking aim at the wastewater line. the proposed apartment package tem to minimize costs. Hill developers asked city officials system proposal, Councilwoman “SummerHill homes has been that raised concerns. The project At the council’s June 27 meet- to write off nearly $230,000 in Pat Showalter pointed out that very prosperous in Mountain included just 11 units of afford- ing, the Palo Alto-based Summer- public benefits for the project’s the system is a standard feature View, but I think they can pay able housing, which city leaders Hill Housing Group presented wastewater system as well as a required for any development. their fair share here,” she said. plans to replace a restaurant and fifth-floor dog park that would be She worried that letting it pass as City planner Diana Pancholi See COUNCIL, page 7

INSIDE A +E 12 | GOINGS ON 18 | MARKETPLACE 19 | REAL ESTATE 21 THE ADDRESS IS THE PENINSU THE EXPERIENCE IS AIN PINEL

LOS ALTOS $3,195,000 LOS ALTOS $2,998,000 LOS ALTOS HILLS $2,880,000

PALO ALTO $2,488,000 LOS ALTOS $2,199,000 CAMPBELL $1,548,000

MOUNTAIN VIEW $1,298,000 MENLO PARK $1,280,000 SAN JOSE $1,279,000

APR.COM Over 30 Real Estate Offices Serving The Bay Area Including Los Altos 650.941.1111

Square footage, acreage, and other information herein, has been received from one or more of a variety of different sources. Such information has not been veriﬁed by Alain Pinel Realtors®. If important to buyers, buyers should conduct their own investigation.

2 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 Are you missing Voic es a tooth (or teeth)? Have you considered AROUND TOWN Dental Implants? Asked in downtown Mountain View. Photos and interviews by Ana Sofia Amieva-Wang. Dental Implant Do you use Snapchat or other social Consultation media to share your location? FreeA $250 Value!

Are your Wisdom Teeth causing “No. I just didn’t want to show you pain? Do you need your where I am to the public. I Wisdom Teeth removed? prefer to keep my privacy more carefully.” Second opinions welcome. Troy Chang, Sunnyvale Call for your complementary consultation.

Having Trouble With Snoring/Sleeping? We Have The Solution! “I do, I use Google Maps so I can Call Smiles Dental to Learn More! 650.665.5001 coordinate with my girlfriend to just figure out who’s going to get home or where she is and stuff like that. I just discovered that 100 W. El Camino Real, Suite 63A Snapchat has the feature where Mountain View ( Corner of El Camino & Calderon ) you can see where other people SmilesDental.com | 650.665.5001 are.” Steven Xu, Mountain View

“I tried the Snapchat update www.demartiniorchard.com where your emoji shows up in 66 N. San Antonio Rd., Los Altos Open Daily 650-948-0881 your location, but I have myself 8am-7pm hidden so I don’t use that. I’ve Prices Effective Farm Fresh and shared my location with friends 7/5 thru 7/11 Always the Best before but only briefly or for NORTHWEST JUMBO ORGANIC LOCAL LOCALLY GROWN an hour, so I guess I don’t use it HEIRLOOM super often.” WHITE CORN Anna Goldberg, Los Altos CHERRIESTOMATOES IN HUSK JUMBO VERY SIZE YOUNG $ TASTY $ $ AND 00 SWEET 99 99 AND EARS AND COLORFUL TENDER 2 FOR1 “I allow my parents to track me, CRISP 4 LB. 4 SWEET LB. but I put myself on Ghost Mode ORGANIC ORGANIC WINE OF THE WEEK for Snapchat because I just don’t MELONS CHARD LEEKS really want to have random SAMPLE THEM ALL ALL ¢ $ APERTURE people knowing where I am.” EVERYDAY AND FIND KINDS 99 149 YOUR FAVORITE BUN. LB. SAUVIGNON BLANC Kaitlin Chiu, Palo Alto CRENSHAW-GALIA ORGANIC LOCAL ORANGE FLESH-HAMI SHARLYN-TUSCAN SQUASH $ 99 CANARY-SANTA CLAUSE ZUCCHINI CASABA-HONEYDEW 99 AND $ 34 GOLD DEW 1 LB. COLORED Your Everyday Farmers Market “I don’t. I turned off my location, Online at www.DeMartiniOrchard.com because I don’t like people knowing where my location is. I like privacy and it’s not OK to LET’S DISCUSS: have everyone know where I’m at.” Read the latest local news headlines and Ahmad Washington, Los Altos talk about the issues at Town Square at MountainViewOnline.com

HaveHtifHave aa questionquestion forfor VoicesViVoices AAroundAround Town?Town? E-mailEmail itit toto [email protected]@mv-voice.com July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 3 LocalNews Retinal Diagnostic Center VERY is pleased to announce the opening CRIME of a new office in Atherton, CA to REAL Q BRIEFS better serve patients in the bay area RIDER DIES IN MOTORCYCLE CRASH LOCAL A man driving an unreported stolen motorcycle died after the Diagnostics and Therapeutics available include: motorcycle hit a tree in Mountain View early Saturday morning, July 1, a police spokeswoman said. • Optical coherence • A & B scan ultrasound NEWS Officers responded to a report of two people tampering with tomography • Intravitreal injection cars in the 200 block of Dana Street around 1:30 a.m., according • Fluorescein angiography • Retinal laser to Mountain View police spokeswoman Katie Nelson. One of the officers saw a motorcycle leaving northbound Moorpark Way, turned on his red lights and tried to stop the Conditions treated include: Support local motorcycle. The motorcyclist accelerated to around 70 mph and • Macular holes • Diabetic retinopathy journalism with drove away, Nelson said. a print or online Following the department’s pursuit policy, the officer termi- • Flashes and floaters • Retinal vein occlusion nated the attempted traffic stop and turned off his lights and • Age related macular • Epiretinal membranes subscription siren, according to Nelson. degeneration • Retinal detachment starting at only The officer saw sparks in the road from the area where the motorcyclist was last seen. When he drove to that area, he saw $5 /month that the motorcycle had crashed into a tree, Nelson said. The rider Visit: was lying about 40 feet from the motorcycle. MV-Voice.com/user/ Several other officers arrived and performed CPR on the rider, subscribe/ according to Nelson. The rider was taken to Stanford University Medical Center, where he was later pronounced dead. Following the crash, police learned the motorcycle was stolen from a home on the 100 block of Calderon Avenue, Nelson said. As of the Voice’s press deadline on Wednesday, the coroner had yet to release the victim’s name because next of kin hadn’t been notified. —Bay City News Service

See CRIME BRIEFS, page 6 ONLINE

3301 El Camino Real, Suite 101, Atherton, CA QPOLICELOG www.retinaldiagnostic.com 650-257-3861 AUTO BURGLARY California St. & Castro St., 6/29 300 block Hope St., 6/29 300 block Showers Dr., 7/2 All Major Insurances accepted #PressOn W. Evelyn Av. & Franklin St., 7/2 100 block Del Medio Av., 7/3 600 W. El Camino Real, 7/2 100 block N. Rengstorff Av., 7/3 1500 block N. Shoreline Blvd., 7/3 RESIDENTIAL BURGLARY 1600 block Alison Av., 7/3 3300 block Brower Av., 7/1 100 block Franklin St., 7/3 Healthy Teeth and Gums 1100 block N. Rengstorff Av., 7/3 STOLEN VEHICLE 2600 block Terminal Blvd., 7/4 100 block Calderon Av., 7/1 200 block E. Dana St., 7/1 That Last a Lifetime! BATTERY 600 block Cuesta Dr., 7/1 1900 block Latham St., 6/29 200 block Escuela Av., 7/4 1000 block N. Rengstorff Av., 6/30 200 block Castro St., 7/2 VANDALISM Church St. & Franklin St., 6/29 COMMERCIAL BURGLARY 500 block Central Av., 6/29 • Experienced and Gentle 300 block Showers Dr., 7/2 700 block Sylvan Av., 7/1 Dentist, and Friendly Staff 500 block Clyde Av., 7/3 2500 block W. El Camino Real, 7/3 1000 block La Avenida, 7/3 • New Patients Welcome! GRAND THEFT 500 block Ortega Av., 6/28 • Free Consultations and Second Opinions Saturday Appointments • COMMUNITY Available Q BRIEFS TECHNOLOGY SHOWCASE NEXT WEDNESDAY Mountain View’s annual Technology Showcase is set to take place on Wednesday, July 12, from 11:30 a.m. to 3 p.m. Voted Best at the Civic Center Plaza at 500 Castro St. The event is free and open to the public. Dentist Presented by the city of Mountain View and the Mountain

THE View Chamber of Commerce, the showcase will feature

Best of new products and technologies made by local startups and VOICE MOUNTAIN Don’t Wait! Call 650.969.6077 VIEW technology companies. It is sponsored by Google, Intuit, 2014 2016 Linkedin Corporation, and Yamaha Motor Company. for your appointment today!

See COMMUNITY BRIEFS, page 7

Conveniently located 650.969.6077 The Mountain View Voice (USPS 2560) is published every Friday by in Downtown Mountain View dentalfabulous.com Embarcadero Media, 450 Cambridge Ave, Palo Alto CA 94306 (650) 964-6300. 756 California Street, Suite B Periodicals Postage Paid at Palo Alto CA and additional mailing offices. The Mountain View 94041 Mountain View Voice is mailed free upon request to homes and apartments in cross street: Castro, next to Bierhaus Mountain View. Subscription rate of $60 per year. POSTMASTER: Send address changes to Mountain View Voice, 450 Cambridge Ave, Palo Alto, CA 94306.

4 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 MOUNTAINVIEWVOICE QCITY COUNCIL UPDATES LocalNews QCOMMUNITY QFEATURES

Brock Turner judge responds to recall PERSKY: ‘MY ROLE IS TO CONSIDER BOTH SIDES’

By Elena Kadvany organizers maintain show a pattern of judicial bias in sex aron Persky, the Santa crimes against women. Turner Clara County judge who ultimately served half of his Ais facing a recall after sentence for good behavior, his his controversial sentencing of trial, conviction, sentencing and former Stanford University stu- release garnering international dent Brock Turner last summer, attention and sparking the offi- spoke out for the first time on cial campaign to recall Persky. Friday in a statement filed with The statement from the the county Registrar of Voters. Retain Judge Persky campaign Without referencing the Turn- also includes a statement from er case or others he has been retired Santa Clara County criticized for in recent months Judge LaDoris Cordell calling by the recall campaign, Persky the recall “misguided.” said that he “fought vigorously “Judicial recalls over a single for victims” as a prosecutor and decision threaten our inde- MICHELLE LE has followed the law by consid- pendent judiciary and set a Gerald Garrett, left, and Life Moves CEO Bruce Ives do an RV count along Crisanto Avenue near South ering rehabilitation and proba- dangerous precedent,” she said. Rengstorff Avenue on Jan. 25. Currently homeless, Garrett used to live in a motor home in Mountain tion for first-time offenders. “Recalls should be for judges View and is a volunteer helping with the homeless census count. “As a judge, my role is to who have a pattern of bias or consider both sides,” he said. misconduct. Judge Persky has “California law requires every neither.” New census shows Mountain View judge to consider rehabilitation Stanford Law Professor and probation for first-time Michele Dauber, the chair of offenders. the recall campaign, said that homeless population growing “It’s not always popular, but Cordell’s statement is “incon- it’s the law, and I took an oath sistent” with previous public COST OF HOUSING CITED AS MAJOR CAUSE to follow it without regard to comments she’s made criticizing public opinion or my opinions Persky’s handling of other sex- By Mark Noack was last done in 2015. obvious, said Dr. Brian Green- as a former prosecutor.” offense cases. The uptick in people without berg, vice president of LifeM- Persky is mounting his own “The single biggest threat to all it Exhibit A of Sili- stable housing is evident in oves, the homeless-services retain campaign against the judicial independence is a con Valley’s worsening many other South Bay com- nonprofit that organized the recall effort, which is working biased judge like Judge Persky, Chousing crisis: A new munities. For Palo Alto, which new census. More people are to collect signatures to place because bias diminishes public Santa Clara County homeless just last week began cracking now living on the street as the recall on the ballot next confidence in the justice sys- census has found a spike in the down on people living out a direct result of the lack of summer. tem,” Dauber said. “There is a number of people living on the of their cars, the number of affordable housing, he said. His statement Friday was a difference between judicial street in Mountain View and homeless increased by 26 per- “Rents have doubled in Moun- response to a notice of intent independence, on the one hand, several nearby cities. cent. In Cupertino, it went up tain View in the last decade; you the Recall Persky campaign filed and a total lack of accountabil- The 2017 Point-In-Time Cen- by 74 percent. In Morgan Hill, don’t build affordable housing, earlier in the week. ity, on the other. The recall is a sus found that the number of it skyrocketed 379 percent. there’s no shelter in the whole Persky has been widely criti- democratic process that is pro- homeless in Mountain View Approximately one-third of city, and the service jobs only cized for his sentencing of vided for by our constitution jumped by 51 percent. This those people are living out of pay $12 or $13 an hour. Turner — six months in jail for and is designed to hold elected translates to about 130 addi- vehicles. sexually assaulting an uncon- officials accountable to the tional people since the count The source of this problem is See HOMELESS, page 8 scious woman on campus in people they serve.” V January 2015 — as well as other Email Elena Kadvany at sentencing decisions the recall [email protected]

which is one of our four top emissions by 80 percent by 2050. City joins climate-change coalition priorities,” said Mayor Ken To that end, city-run facilities are Rosenberg. “Mountain View switching over entirely to renew- MOVE PROMPTED BY PARIS AGREEMENT WITHDRAWAL will continue to work with local able energy sources, and officials and state officials to support have developed an ambitious long- By Mark Noack addressing the thorniest global across the U.S. that are pledging California’s global leadership in term plan for further actions. issue of modern times. to uphold the Paris Agreement. addressing climate change.” A similar effort is underway by t took nearly 20 years of nego- But last month, President The so-called Climate Mayors For Mountain View, these state governors who opposed tiations, but in December Donald Trump announced he group, now joined by more than actions are largely in line with Trump’s pullout from the Paris I2015 countries worldwide had was pulling the U.S. out of the 330 municipalities, is a move of the city’s efforts that were already Agreement. Califonia Gov. Jerry finally brokered an agreement agreement, despite the country’s symbolic resistance, but it also in place, said Steve Attinger, Brown has partnered with his on tackling climate change. It position as the leading a cumu- commits U.S. cities to carbon- city environmental sustainabil- counterparts in 11 other states to was far from perfect, but the pact lative carbon emitter. reduction targets. ity coordinator. The city’s climate uphold terms of the agreement. V known as the Paris Agreement In response, Mountain View is “We remain committed to action plan approved two years Email Mark Noack at was hailed as a huge milestone for now joining a coalition of cities environmental sustainability, ago aims to cut local carbon [email protected]

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 5 LocalNews Man connected with 2008 MV slayings arrested in Sacramento NICORY SPANN CHARGED WITH ATTEMPTED MURDER AFTER DEPUTY SHOT By Mark Noack with attempted Sheriff’s officials report that Spann pleaded no contest to his Plymouth Avenue home. The murder. Spann’s alleged assault on the dep- charges stemming from a June group ransacked the house. man previously linked to The shoot- uty was unprovoked. It remains 2008 Mountain View home Calls to the Santa Clara County a 2008 double-homicide ing occurred unclear how the suspect managed invasion robbery that resulted District Attorney’s Office were Ain Mountain View was around 6 p.m. to get control of the deputy’s gun. in the slaying of two siblings, not immediately returned. arrested in Sacramento County on June 27, He reportedly fired two shots, one Omar Aquino and Maria Teresa Spann, who was 19 at the time this week for allegedly attacking when Sacra- of which hit Ladwig in the face. Sanchez-Aquino. According to of the killings, was initially listed a sheriff’s deputy and shooting mento County Spann was tracked to a nearby reports, the case involved Spann in criminal filings as the trigger- him in the face with the deputy’s sheriff’s deputy Nicory Spann motel, where he was arrested in a and seven other suspects who man in the murders, but police own gun. Alex Ladwig SWAT team operation. plotted to rob Aquino, whom officials later back-pedaled on The deputy suffered major radioed that a man was attack- At the time, Spann reportedly they knew socially. that theory. He pleaded no con- injuries from the shooting, but ing him at a local transit station. resided in Sacramento, but for One suspect, Fame Thomas, test to charges including being an was reportedly in stable condi- Shortly after the initial call for years he lived in San Jose and then 15, took Aquino out to the accessory after the fact and pos- tion. The suspect, Nicory Mar- help, Ladwig radioed again to was connected with a notorious movies while others prepared session of stolen property. He quis Spann, 27, is being charged report he had been shot. Mountain View killing. to rob him when he returned to served 16 months in prison. V

each year, but the MVLA foun- longer. Annual increases in rev- which assumes that the state percent to 8 percent for 2017-18, BUDGET dation has helped pay the costs, enue are expected to shrink in budget will stop giving out followed by 6 percent growth in Continued from page 1 Mathiesen said. The district has the next few years, Mathiesen one-time discretionary fund- 2018-19. budgeted $140,000 for Chrome- said, and the state’s economy ing to school districts. The state The district’s budget is still students at Mountain View and book refreshment” for the 2017- has been on the upswing for an budget, which was signed by the expected to stow away millions Los Altos high schools. Both 18 school year. The widespread unusually long time. During governor last week, did end up of dollars into the reserve fund campuses have a “bring your use of technology in the class- Gov. Jerry Brown’s revision of including discretionary fund- over the next three years. own device” policy (BYOD) room means that the district the state budget in May, Brown ing amounting to nearly $900 Mathiesen said that reflects the requiring all students to have also needs to spend more money said the state was in the midst of million. district and the board’s goal to access to a personal computer on a robust WiFi network and one of the longest expansionary Mathiesen said the district is maintain a higher level of for class work, and the district better server infrastructure for periods in California’s economic also expecting the double-digit reserves for economic uncer- has to maintain thousands of its schools. history, and the state needs to increases in annual property tainty, and that the goal will be Chromebooks for students to Although the district has seen start planning for a possible tax revenue to level off as soon met by the end of the 2019-20 check out for the year. major boosts in revenue for downturn. as the upcoming school year. school year. V Chromebook replacement is several years straight, signs are This is reflected in the board- Projections estimate property Email Kevin Forestieri at projected to cost about $250,000 showing that it won’t last much approved budget for 2017-18, tax growth will drop from 10 [email protected]

CRIME BRIEFS Continued from page 4

ACUPUNCTURIST CHARGED WITH INSURANCE FRAUD A Los Altos acupuncturist has been charged with fraudulently billing insurance companies for treatments that he never gave, Santa Clara County prosecutors said Monday. According to the district attorney’s office, in December 2014 the California Depart- ment of Insurance received a tip that 53-year-old Aifeng Su had billed insurance companies for treatment visits that never happened. Two of Su’s patients, a husband and wife, later discovered that he had billed their insurance company for treatments they hadn’t received. According to prosecutors, Su received about $12,000 in pay- ments for more than 60 phantom treatments. Su has been charged with two counts of making false or fraudu- lent claims for insurance. The charges carry a maximum prison sentence of six years, prosecutors said. ANA SOFIA AMIEVA-WANG Su is scheduled to be arraigned A GLITTERING FOURTH July 5 in the Hall of Justice in San Jose. Clear skies prevailed for this year’s annual Fourth of July fireworks show over Shoreline Amphitheatre, which drew crowds inside and out. —Bay City News Service For those lucky folks inside, the San Francisco Symphony played songs by Copeland and Sousa, and from “Star Wars” film scores.

6 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 LocalNews

COMMUNITY BRIEFS VA GETS NEW DIRECTOR most importantly, for the veter- Development Program. He is a full range of patient care services Continued from page 4 ans we are honored to serve.” member of the American Hos- with state-of-the art technology. Thomas “Tony” Fitzgerald III Fitzgerald began his career pital Association and American VA Palo Alto maintains one of was selected as the new director with the department in 1988 as College of Healthcare Executives. the top two research programs in The National Aeronautics and of the Veteran Affairs Palo Alto a psychiatric nursing assistant The VA Palo Alto Health the department, with extensive Space Administration, Google Health Care System, an appoint- at the North Chicago VA and Care System is one of the most research centers in geriatrics, Virtual Reality, and the Moun- ment that went into effect June then moved on to a position as complex facilities in the VA mental health, Alzheimer’s dis- tain View High School robotics 25. He will be replacing Lisa housekeeping aide at the facility. system, serving 11 congressional ease, spinal cord regeneration, team Spartan Robotics will Freeman in overseeing the deliv- He started working in the VA districts and 10 counties located schizophrenia and HIV research. participate in the event, along ery of health care to more than Northern California in 2000. in Northern California. It con- It also runs a Rehabilitation with several other technology 93,000 veterans at the Depart- Before joining the department, sists of three inpatient facilities Research and Development companies. ment of Veterans Affairs’ Palo Fitzgerald served in the U.S. located in Palo Alto, Menlo Center and Health Economics Showcase participants can Alto facility. Army for 16 years as a medical Park and Livermore; plus seven Resource Center. The VA Palo view product demonstrations “We are excited to bring Mr. non-commissioned officer. outpatient clinics in San Jose, Alto system is affiliated with and businesses can connect Fitzgerald on board as the new Fitzgerald holds a bachelor’s Fremont, Capitola, Monterey, Stanford University Hospital. to form partnerships. There director of the VA Palo Alto degree in business administra- Stockton, Modesto and Sonora. —Elinor Aspegren will also be food trucks at the Health Care System,” said Sheila tion with a concentration in In 2016, the VA Palo Alto system event to meet participants’ non- Cullen, the director of Veter- health care management from the had 817,448 outpatient visits and tech gustatory needs for the ans Integrated Service Network American InterContinental Uni- 7,416 inpatient stays. Like us on afternoon. 21, in a press release. “His versity in Hoffman Estates, Illi- In addition to health care Visit chambermv.org/tech- sound leadership qualities and nois. He is a graduate of the Lead- services for veterans, the system nology-showcase for more proven experience will be valu- ership VA program, the Health serves as a teaching hospital for www.facebook.com/ information. able assets for the facility, the Care Leadership Development doctors, nurses and allied health MountainViewVoice —Nathalie Camens employees and volunteers, and Institute and the VA Management care professionals providing a

COUNCIL Continued from page 1 pointed out was disappointingly low. But city planners explained that they have little leverage to request more. City rules require housing developers to set aside 10 percent of their new apartments as sub- sidized, below-market-rate housing. But SummerHill developers circumvented these rules by tai- loring their project for a density bonus under state law. In the past, Mountain View officials have blasted the state density program, which has been in place since 1979, for giving developers a loophole for “double dipping” in incentive programs. When compared with local city rules, the state system ends up rewarding developers with a sizable density bonus for building fewer affordable housing units. “We’re only getting 11 (affordable) units and we should be getting 22,” fumed Councilman John McAlister as he reviewed the SummerHill plans. “If there’s a way to figure out how we can get more, we need to do that.” But city planners said there’s little they could do, and it’s not the first time they’ve encoun- tered this problem. Just a block away from the SummerHill site, a 605-unit project by Pro- metheus Real Estate Group also made use of this state density bonus, which frustrated city leaders at the time. The council approved the Sum- merHill apartment project in a 6-0 vote with Mayor Ken Rosen- berg absent. V

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 7 LocalNews

give an inexact picture of the HOMELESS local homeless problem, but Continued from page 5 Weekend fire whipped by wind burns Greenberg emphasized that “This is the natural out- the most important takeaway an acre near Shoreline Park growth of all that,” Greenberg from the report is that the said. homeless problem seems to Firefighters raced to Mountain she and a friend returned to The fire ended up burning a The picture for Santa Clara be worsening. That trend is View’s baylands on Sunday after- their cars after a hike. Smoke couple trees and about 100 yards County as a whole is not as likely to continue until South noon to put out a grass fire that was billowing from the grassy of the field, said Battalion Chief dire. Overall, the county saw Bay cities partner to create a was quickly spreading due to the field and they saw flames spread- Ted Vandenberg of the Mountain a 13 percent increase in home- new service network across the windy weather. ing through the area, she told View Fire Department. The only lessness, or about 850 more area, he said. The fire reportedly burned the Voice. They called the fire property damage reported was people. “Everyone in Silicon Valley about an acre of vegetation near department to report the blaze. a city-owned wooden fence that The report shows a drop needs to step up to the plate,” a Terminal Boulevard parking “In my 25 years of hiking here, was burned. in the county’s number of he said. “It has to be a regional lot by the entrance to Shoreline I’ve never seen anything like Fire officials say they are still homeless veterans and people solution with every community Park. this,” Bachani said. “I’ve never investigating the cause of the with disabling conditions who stepping up.” Mountain View resident Jyoti been that close to a fire like this blaze. A short video of the blaze have been chronically home- Some relief is coming. Last Bachani said she first spotted — it was difficult to breathe from is online at mv-voice.com. less for one year or more, November, voters countywide the blaze around 4 p.m. when all the smoke.” —Mark Noack but an increase overwhelm- in families and ingly approved independent ‘Everyone in a $950 million youth ages 24 bond measure Two-alarm fire destroys MV townhouse and under. Silicon Valley to address low- The homeless income hous- An electric coffee-roaster may Firefighters reportedly arrived started was destroyed. Within census was con- needs to step up ing. Some of that have sparked a two-alarm fire in within minutes, but the fire had about 20 minutes, the fire rag- ducted in Janu- money will be Mountain View on Wednesday already spread to the home’s sec- ing in the attic had damaged ary with an early to the plate.’ doled out in the morning that gutted a Jackson ond floor and attic. the structure to the point that morning street BRIAN GREENBERG, coming months. Park townhouse. The burning townhouse was its roof collapsed. An unspeci- count that cov- VICE PRESIDENT OF LIFEMOVES In March, Mountain View fire officials part of a four-plex of homes that fied number of nearby resi- ered more than Mountain View say they received word just after share adjoining walls; the other dents were evacuated from the 1,300 square leaders dedicated 8:30 a.m. that a fire had started residences remain safe, fire offi- area. miles of the county. Vol- $1 million to fighting homeless- in a house garage in the 400 cials said. Fire officials reported that a unteers and paid homeless ness, including funding new block of Mountain Laurel Court. But the house where the fire resident of the destroyed home guides navigated the streets staffing and providing new said that a coffee roaster in the and tallied individuals and services for people living out of V LET’S DISCUSS: garage started the blaze. The fire families who appeared to be their cars. Read the latest local news headlines and talk about the is under investigation. homeless. Email Mark Noack at issues at Town Square at MountainViewOnline.com —Mark Noack This method will inevitably [email protected]

2017 REMODELING WORKSHOP SERIES Whole House + Additions – Going up or out or both! Two workshop locations to choose from! SATURDAY, JULY 15, 2017 Workshop: 9:00-11:00am Registration and breakfast from 8:30-9:00am Harrell Design Center: 944 Industrial Avenue, Palo Alto Harrell of Los Gatos: 233 North Santa Cruz Avenue, Los Gatos

What our designers see as the top 5 things Functional design ideas to make to consider when planning a remodel the best use of your living space. – whether your home is small or large. ([SORUDWLRQRIPDWHULDOVIURPÁRRULQJWR How to choose a contractor: countertops, cabinetry and more! What to look for and how to hire one.

Our seminar is designed for homeowners who are considering a major remodeling project, such as an addition or whole-house renovation. Meet our team in person, while you learn about the design build remodeling process and see an inspiring array of design ideas for your home.

PRE-REGISTRATION IS REQUIRED AS THESE CLASSES FILL UP QUICKLY! Call us or go online to register today! 650.230.2900 | [email protected] | harrell-remodeling.com

License 8479799

8 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 NOTICE OF DISTRICT DIRECTOR SEAT VACANCY

The El Camino Healthcare District* Board of Directors seeks applicants to ﬁll a vacancy on its Board of Directors for a term through November 2018. Applicants must be registered voters residing within the El Camino Healthcare District.

The District Board will hold an additional Regular Meeting to interview applicants on Wednesday, August 16, 2017 at 5:30 p.m. El Camino Hospital, 2500 Grant Road Ground Floor Conference Rooms E, F and G

Applications must be received by the District on or before August 1, 2017.

To obtain applications: Pick up: Administration, C131, El Camino Hospital, 2500 Grant Road, Mountain View Download: elcaminohealthcaredistrict.org E-mail: [email protected]

Questions: 650-940-7300

*The purpose of the District shall be to establish, maintain and operate, or provide assistance in the operation of one or more health facilities (as that term is deﬁned in the California Health and Safety Code Section 1250) or health services at any location within or without the territorial limits of the District, for the beneﬁt of the District and the people served by the District, and to do any and all other acts and things necessary to carry out the provisions of the District’s Bylaws and the Local Health Care District Law.

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 9 LocalNews

Getting lively on Thursday nights

Photos by Ana Sofia Amieva-Wang

Summertime is for outdoor revelry, and the city of Mountain View-sponsored Thursday Night Live events offer locals the chance to celebrate the season with live music, a custom/classic car show, sidewalk strolling, a farmers’ market and other activities. Castro Street between Mercy and Villa streets in downtown Mountain View close to traffic during the events, from 5:30 to 8:30 p.m. on two nights in July. Last Thursday, the “high-energy” dance band the Cheeseballs performed. On July 13, Daze on the Green is scheduled to perform classic rock, and the rock-and-soul Clockwise from top left: Community members join hands and dance during Mountain View’s Thursday Night Live event Houserockers will rock the downtown on on June 29; the Cheeseballs, a high-energy dance band, performs at the event; a farmers’ market stall offers samples July 27. For more information, call 903-6331 including dried and candied fruits; a ballerina from Western Ballet catches the attention of passersby as she hands out or email [email protected]. flyers; passersby snap photos as the car show comes to a close; a balloon sword battle is underway on Castro Street; master face-painter Susan Worley creates butterfly magic on a young girl’s face.

10 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 LocalNews

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 11 Arts&EventsMOUNTAINVIEWVOICE

A midsummer night’s mash-up by Kaila Prins Theater Review alace intrigue. Mistaken identities. Kidnapping, and unbothered that Shake- Pquarreling lovers and civil speare had a hand in this at all. unrest in the dukedom. Sound The plot is simple: A noble- like Shakespeare? Well, it is and man, Antonio (played by Mark it isn’t — at least, not quite as Vashro) returns from a success- written by the Bard himself. ful diplomatic mission in France “What You Will” (“the Shake- with a beautiful French wife speare play that Shakespeare (LeighAnn Cannon) who can never wrote”) makes its world- speak only a few words of English. premiere run at the Pear Theatre He is received well by the Duke through July 16. Playwright Max (Kevin Hammond), a man who Gutmann borrowed every word prizes honesty above all else, until and phrase from Shakespeare’s the scheming Malvolio (Lauren works and rearranged them to Hayes) and hapless Roderigo create a play that seems as if it (Dan Wilson) turn the Duke very well could have trod the against Antonio and turn poor boards at the Rose or the Globe. Antonio’s world upside down. Gutmann set himself the Or, perhaps the plot is this: A Herculean task of creating a physician (Alyssa Lupo-Zulueta) brand new play by rearranging comes to court to attend to the COURTESY OF THE PEAR THEATRE only words, words, words from Duke, but, when he asks to be “What You Will” playwright Max Gutmann borrowed from Shakespeare’s works to create an entirely new Shakespeare’s texts. Constructed returned to the poor peasants play, with a cast including Alyssa Lupo-Zulueta, Mark Vashro, Amelia Adams , Lauren Hayes and Jim Johnson. like a giant puzzle without a box, in the north, the Duke, through “What You Will” is a thoroughly Malvolio, refuses. The peasants, Duchess discovers that she’s got floor, a couple of moving plat- throughout the play. But it was unique piece of theater with who have no doctor to cure their a thing for Antonio. Will they be forms, and your imagination, Jim Johnson, who plays the a few of Shakespeare’s iconic sick and injured, plan to kidnap able to keep their mate out of the Brown paints entire landscapes. Duke’s attendant and the bum- phrases peppered in as laugh the Duke, but their plot is foiled garden long enough to rendez- The staging, at times, tends to bling peasant Claudio, who had lines. by a case of mistaken identity. vous with their new beloveds? be less Shakespeare and more the audience in stitches with his The prologue warns you Or, the plot is a tale of love OK, maybe the plot isn’t so “Scooby-Doo,” with actors play- completely deadpan delivery not to get too wrapped up in gone awry. The Duchess (Ame- simple. But the playwright has ing multiple characters entering and stoic expression. listening for the Bard in this lia Adams) and the Duke do woven this together so well that and exiting in pursuit of one The entire ensemble is a well- stage work. I found it difficult not love each other, but they’re you won’t have too much trouble another, but with a few simple oiled machine, turning the small to heed that warning at first, both very jealous. The Duke, a keeping the story lines straight. costume pieces and recogniz- theater-in-the-round into a world trying to spot the “Lear” or “lecherous monkey,” can’t seem The direction, by William J. able character affectations, they where comedy, intrigue, and the “Hamlet” in each line, but to keep his hands off the young Brown III, also has a hand in become easy to discern. confusion reign and the audience a few scenes in, I found myself women of the court, includ- keeping you grounded in the Even though this play is not becomes co-conspirator. So, to becoming utterly immersed ing Antonio’s wife, while the plot: With just a simple wood Shakespeare, per se, it’s clear that see or not to see? This fun, funny, all of the actors have facility with and complex play is a can’t-miss his language. This is no small midsummer night’s dream. feat. Their emotions, intentions, and characters all shine through And if their shadows have the antiquated-seeming text, so offended, you need not be a Shakespeare Think but this, and all is mended: buff to enjoy the show. It may This production shall but linger take a few minutes to tune your here ear to the Elizabethan turns of And it might be on you to brush phrase, but after a scene or two, up your Shakespeare. V you’ll be firmly invested in the characters’ plights. Freelance writer Kaila Prins The actors all handle the dif- can be emailed at kailaprins@ ficult task of portraying mul- gmail.com. tiple characters convincingly with ease, although the acting was a bit lopsided, with some QINFORMATION characters portrayed earnestly, as was Vashro’s Antonio, and What: “What You Will” others in over-the-top carica- Where: The Pear Theatre, 1110 tures, like Adams’ Duchess. For La Avenida St., Mountain View the realistically portrayed char- When: Through July 16, acters, Hayes is a standout as Thursday-Saturday at 8 p.m. and Malvolio, her acting subtle, yet Sundays at 2 p.m. convincing, and Hammond’s COURTESY OF THE PEAR THEATRE Duke is almost uncomfortably Cost: $28 - $32 “What You Will” playwright Max Gutmann borrowed every word and phrase from Shakespeare’s works realistic, as he chases after the Info: Go to thepear.org and rearranged them to create an entirely new play, with a cast including Lauren Hayes and Dan Wilson. female-presenting characters

12 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 A + E Lean on us. Treading water DRAGON OFFERS A TENSE, WELL-ACTED PRODUCTION OF ‘THE NORTH POOL’

by Karla Kane

high school student and his vice principal engage Ain an escalating game of We’re here to help older adults and their families with cat-and-mouse in Rajiv Joseph’s “The North Pool,” currently resources and programs for positive aging: presented at the Dragon Theatre. • Transportation Assistance • Aging-in-Place Support In this two-man show, set in 2007, it’s a battle of wills at the • Information & Counseling • Handyman Services start of spring break between Sheffield High administrator Dr. • Health & Wellness Programs • Volunteering Opportunities Danielson (Edward Hightower) • Personal Growth Activities • Adult Day Care and Syrian-born, internationally raised Khadim (Salim Razawi), an 18-year-old senior who trans- For more information, visit us ferred in mid-September from at www.avenidas.org or call (650) 289-5400. an elite prep school under mys- terious circumstances. Daniel- son calls him into his office for TOOLS FOR POSITIVE AGING equally vague reasons, at first LANCE HUNTLEY jovially grilling him on how he’s Edward Hightower and Salim Razawi play a vice principal and a getting along academically and high-schooler engaged in mental warfare in the Dragon Theatre’s socially, acting all buddy-buddy production of “The North Pool.” and playing the fool. Khadim, for his part, plays dumb, too, giving typical surly-teen shrugs and but, despite her importance to eye rolls to Danielson’s question- Theater Review the plot, not sufficiently fleshed ing and attempts at establishing out in order to give a sense of trust. pacing, which do not disappoint. who she really was. As the one-act, one-room Hightower is particularly excel- The play, it should be noted, play rolls on, Danielson and lent in the surprisingly complex has local roots: It made its pre- Khadim’s interactions intensify, character of Danielson, who at miere with TheatreWorks in and they attempt to outsmart, first appears to be a swaggering 2011 (TheatreWorks has pro- outmaneuver and one-up each buffoon, a clueless, cringeworthy duced a number of other Joseph other, ramping up the accusa- adult who still clings to his own works as well). According to tions and revealing that they high-school glory days while Dragon’s artistic director Mere- both know a lot more than either wanting desperately to be liked dith Hagedorn, “North Pool” one was at first willing to admit. and respected. His students, director Montellato and star Was Khadim called into the he says, are the lost sheep to Razawi both, separately, pre- office simply for ditching class? his benevolent shepherd. And sented the idea to produce a ver- Perhaps he’s under suspicion peppered into his persona are sion through Dragon’s Second in connection with a string of unpleasant undertones of racism Stage program, which supports pranks and vandalism? Or is and misogyny, and even accusa- the passion projects of emerging he connected to on-campus tions of sexual misconduct. artists in the community. Their drug dealing? Could there be It’s easy, initially, to root for eventual collaboration has something even darker at stake, Khadim in this standoff: the vic- proved highly successful. This something related to the sex timized minority student being production is well-crafted and scandal and resulting suicide of bullied by a power-hungry, petty riveting, even as the plot itself another student who has ties to dictator in a post-9/11 world continues to deal in ambiguities, both characters? where Muslim-Americans are leaving the audience with more Fans of the classic play and under unfair persecution. But questions than answers. Drag- film “Sleuth” (or, for more mod- it becomes clear that Khadim is on’s version of “The North Pool” ern audiences, of the Netflix more of a wolf in sheep’s cloth- is a captivating look at two char- series “13 Reasons Why”) will ing. He’s smug and arrogant, acters who are treading water, find a similar squirmy pleasure used to getting what he wants trying to keep from drowning in in watching the unraveling mys- thanks to his parents’ wealth the deep end. V teries of “The North Pool” and and worldly connections. And Arts & Entertainment Editor feeling the tension crackling he has seemingly little remorse Karla Kane can be emailed at between the leads. for some of the disgusting acts [email protected]. While this may not be in which he’s allegedly become Josephe’s all-time finest work (he entangled. On the other hand, was nominated for the Pulitzer maybe he is just a kid, trying to INFORMATION Prize in 2010 for “Bengal Tiger find a place for himself in a cut- Q at the Baghdad Zoo”), his mas- throat world. What: “The North Pool” terful skill in crafting realistic The audience is continually Where: Dragon Theatre, 2120 dialogue and building suspense torn, pulled between sympathy Broadway St., Redwood City is on display in this psychologi- and suspicion for both charac- cal thriller. ters as the interrogation devel- When: Through July 16, Thurs- A two-person show relies, of ops (ultimately, though, after days-Saturdays at 8 p.m.; Sundays course, heavily on the chemis- some revelations about animal at 2 p.m. try and skill of the two actors, cruelty, I was not left with many Cost: $27-$35 Hightower and Razawi, along kind feelings toward Khadim). with Joseph’s script and direc- A third character, the deceased Info: Go to dragonproductions. tor Jacquelyn Montellato’s brisk student, Lia, is often mentioned net

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 13 VOICE MOUNTAINVIEW QRESTAURANT REVIEW We ekend QMOVIE REVIEWS QBEST BETS FOR ENTERTAINMENT

So much food, Falafel served on mixed greens with toppings like pickled turnips, so little flavor beets, cucumber tomato salad, and tahini sauce at Sajj Mediterranean. Q RESTAURANTREVIEW Hit or miss Mediterranean ajj Mediterranean in nondistinctive. The Arabic with three steps listed. Another Mountain View feels more music that pipes at a comfort- monitor streams a football fast-casual food at Sajj Slike a fueling station than ably low level through the game on mute. A big arrow a restaurant. With two food sound system is the only clue as and the word “start” tells you in Mountain View trucks, five restaurant locations to the type of food served here. where to begin, but if you arrive (and more to come), it has done Ordering is intimidating and during lunch, it will be hidden to Mediterranean food what confusing if it’s your first time, behind the line of people. Chipotle has done to Mexican even though the restaurant, Just like at Chipotle, you food — made it fast, customiz- located at the San Antonio choose your meal first and pay REVIEW BY ALISSA MERKSAMER able and, too often, forgettable. Center on El Camino Real, tries last. Rows of metal containers PHOTOS BY VERONICA WEBER The restaurant’s gleaming to help. A TV monitor flashes filled with shawarma, falafel, brushed-metal counters, met- back and forth between a scene hummus and more than 20 al trays and matching chairs of Mediterranean food and vegetable sides demand a quick are as functional as they are instructions on how to order scan if people are waiting behind

14 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 Weekend

Mayeli Olvera, manager of Sajj Mediterranean in Mountain View, prepares a chicken shawarma bowl. you. Point to what you want, quantity over flavor. pickled onions dusted with and someone scoops the various If you choose every vegetable sumac could be regular raw items into your tortilla wrap, rice side — which you can do free onions, their sharpness almost bowl, or salad bowl (between of charge, except for the gua- fully intact. An Israeli salad of $8.50 and $10.50, depending on camole (yes, there’s guacamole chopped tomatoes and cucum- the protein you choose). here) — you’ll have plenty of bers offers merely the flavors Both the allure and down- food for two meals. Yet many of its respective ingredients, side of Sajj is that the restau- of those sides are bland. rant often gives priority to Close your eyes and the Continued on next page A side dish of pita bread or pita chips comes with hummus.

2017 REMODELING WORKSHOP SERIES

Designing & Remodeling Your Perfect Kitchen or Bathroom WEDNESDAY, JULY 19, 2017 Workshop: 6:00pm-8:00pm Registration and dinner from 5:30pm-6:00pm Harrell Design Center: 944 Industrial Avenue Palo Alto

Creating a beautiful, yet highly functional :KDWLVXQLYHUVDOGHVLJQHQHUJ\HIÀFLHQW kitchen or bathroom with proper space low maintenance design and remodeling? planning, cabinetry layouts, and storage :KRGRHVQ·WZDQWDORZPDLQWHQDQFH ideas and inspirations. high style kitchen and bathroom!

Hear about the latest trends in color, Small or large, you will learn how to FRXQWHUWRSVÁRRULQJFDELQHWU\DQGWLOH maximize your space and so much more!

PRE-REGISTRATION IS REQUIRED AS THESE CLASSES FILL UP QUICKLY! Call us or go online to register today! 650.230.2900 | [email protected] | harrell-remodeling.com

License 8479799

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 15 Weekend

QDININGNOTES

Sajj Mediterranean 2580 W El Camino Real, Mountain View 650-941-7255 sajjstreeteats.com Hours: Sunday-Thursday, 11 a.m. to 9 p.m.; Friday-Saturday, 11 a.m. to 10 p.m.

Credit Cards Alcohol Children Takeout Noise Level low Parking lot

Continued from previous page while tiny cubes of purple beets taste as if they were poured straight from the can. While the shredded cabbage provides great crunch, it tastes solely of Steak shawarma wrap with turmeric rice, pickled turnips, cucumber tomato salad, lettuce and hummus spread. shredded cabbage. During one visit, cauliflower stained pur- better. The falafel was crunchy, falafel. The falafel balls are fried “With most hummus, people ple from sumac was so over- but dry. Zaib Ayoub, the presi- frequently throughout the day, add preservatives,” said Alhin- cooked it limped like injured dent of Falafel Inc., which owns but they’ll dry out if they sit ‘With most di, but Sajj keeps it simple with soldiers. Sajj, admits that it’s hard to get for too long. Sajj doesn’t want dried garbanzo beans, olive The proteins could also be the timing right when cooking to make customers wait for a hummus, people add oil and tahini. Sajj’s tzatziki, falafel to be freshly fried. (Note: preservatives, but Sajj or yogurt dip, is cool, creamy I would gladly wait.) and rife with crunchy cubes of Other proteins are hit-and- keeps it simple with cucumber. An off-white garlic miss. During one visit, the dip teems with crushed garlic steak shawarma had a bizarre, dried garbanzo beans, that feels pleasantly gravelly on almost liver-like consistency, the tongue. Another vegetable though Ayoub said it doesn’t olive oil and tahini.’ side, spicy peppers, may trigger contain any liver. The chicken SAJJ CHEF LOUIE ALHINDI a sweat response, so counter it shawarma tasted like plain with a bite of soft yellow rice. grilled chicken — perfectly Sajj’s sauces also excel. A acceptable if not memorable. hormone-free as well as halal. bright green cilantro mint Pomegranate chicken carried Everything is prepped in a chutney reminiscent of Indian a touch of sweetness, but it was commercial kitchen in Menlo chutney brightened everything chopped into such tiny pieces Park and then cooked on-site it touched. The tahini sauce was that it was sometimes difficult at the various restaurants. creamy yet pourable, tasting to identify as meat. Not everything is ordinary at purely of the ground sesame None of this is to say that the Sajj. The hummus is fantastic. seeds from which it’s made, ingredients aren’t good quality. It’s thick and earthy, made in while a pale pink tahini spiked According to Ayoub, the veg- small batches by chef Louie with the Arabic hot sauce shatta etables come from local farms Alhindi, who oversees all the tingled more than it burned. and the meat is antibiotic- and cooking at the central kitchen. Would I go back to Sajj? If I want a lot of food for not a lot of money, sure. A visit during lunchtime proves the restaurant has quite a follow-

THE ing. Ayoub and Sajj co-owner

Best of VOICE MOUNTAIN Mashar Sakhouri must have Happy Hour VIEW 4pm-9pm Sun-Thurs 2016 figured out that this is what the public wants. (Sakhouri +TIZSM¼[*]ZOMZ[̆ WЄ was the former food and bev- .ZMVKP.ZQM[̆ WЄ erage director for the Hyatt WЄIVaLQVVMZ hotels, and his family owns • Kids 12 & under - buy 1 get 1 free* Bay Area chain Crepevine *item from kids menu of equal or lessersser value Restaurant.) NOW HIRING applications @clarkes.com Yet one has to wonder if Sajj th year and Restaurant — and fast-casual restaurants 70 like it — are doing customers a ANNIVERSARY! disservice by dumbing down Open 7 days Clarkes.com flavor in favor of convenience Lunch & Dinner 11am-9pm; Fri ’til 10pm and low cost. V Breakfast on Weekends 8am-2pm Freelance writer Alissa MountainMountain VViewiew • 615615 W. El Camino Real • (650) 967-0851 Merksamer can be reached at [email protected].

16 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 Weekend

QMOVIEOPENINGS Web design upgrade “SPIDER-MAN: HOMECOMING” GOES BACK TO SCHOOL 000 (Century 16 & 20) We’re deep enough into the workers afloat, Toomes turns his age of comic-book movies that business into an arms trade, his “Spider-Man: Homecoming” in secret weapon being a flying suit. some ways feels like a throwback. Toomes keeps running afoul of Conspicuously kid friendly, the Parker, a conflict that comes to a first Spider-Man movie to be head on the night of the Home- produced by Marvel Studios — coming Dance. as a part of the Marvel Cinematic “Homecoming” gets plenty Universe — not only doesn’t shy right. Keaton makes a great from being goofy, but it cheer- Vulture, and the character’s COURTESY OF COLUMBIA PICTURES fully embraces the cartoony. conception here as the working- Peter Parker (Tom Holland) tries to balance life as an ordinary high school student while fighting crime as his Director Jon Watts’ first shot at class villain to Peter’s “working- superhero alter ego, Spider-Man, in “Spider-Man: Homecoming.” Spidey lands close enough to the class hero” proves dramatically The film’s first act struggles a nothing without the suit, then superhero formula or its corpo- summer-movie sweet spot that effective, especially as goosed by bit to nail down its tone and pac- you shouldn’t have it.” A diverse rate sheen, but it works nicely any quibbles feel a bit churlish. a certain third-act reveal. The ing, a probable result of at least ensemble adds value: Jacob Bata- within those parameters as an Tom Holland’s Peter Parker, characterization of Spider-Man six screenwriters leaving their lon as “man in the chair” Ned, action-packed, beat-the-heat first seen in “Captain America: as a snarky teen in science-nerd prints on the script. Another Laura Harrier as love interest Liz, distraction. Civil War,” remains beholden to T-shirts — as unmistakably a arguable problem with “Spider- Zendaya as hilariously deadpan Rated PG-13 for sci-fi action billionaire Tony Stark (Robert kid — also feels fresh. Twenty Man: Homecoming,” if a guaran- smart-girl Michelle, and Tony violence, some language and brief Downey Jr.), with whom the at the time of filming, Holland teed box-office smash can be said Revolori as bully Flash Thomp- suggestive comments. Two hours, 15-year-old is serving an “intern- looks and sounds considerably to have one, is that everyone is son. Ultimately, “Spider-Man: 13 minutes. ship.” But Peter finds himself more like a teenager than Tobey Iron Man. The crazy amount of Homecoming” can’t shake off — Peter Canavese held at arm’s length, not a good Maguire and Andrew Garfield technology Stark affords to Park- place to be for someone of his (both asssumed the role in their er, a kid from Queens, functions NOW bouncing-of-the-walls, chomp- late 20s). like a plot crutch for much of the Q SHOWING ing-at-the-bit energy. Director Jon Watts makes a film’s first two acts—although it 47 Meters Down (PG-13) Century 20: Fri. - Sun. The rubber meets the road credible leap into blockbuster sets up a third-act reversal. Then 9 To 5 (PG) Century 20: Sunday when the economically needy filmmaking following his break- there’s the Vulture, with his high- salvage crew of Adrian Toomes through indies “Clown” and “Cop tech flying suit and, of course, All Eyez on Me (R) Century 16: Fri. - Sun. (Michael Keaton) gets screwed Car.” Though there’s plenty of the tricked-out Iron Man. Baby Driver (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. by the government, prompting action excitement throughout, The story doesn’t afford much Beatriz at Dinner (R) +++1/2 Century 20: Fri. - Sun. Toomes to begin stealing Chi- three well-staged major set piec- emotional depth, but it does tauri technology left over from es—each within or adjacent to a score points by noting Park- The Beguiled (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. the alien invasion in “The Aveng- recognizable American landmark er’s sacrifices and having Stark The Big Sick (R) +++ ers.” To keep his family and his — effectively crank up tension. teach him the lesson “If you’re Century 20: Fri. - Sun. Palo Alto Square: Fri. - Sun. Cars 3 (G) +++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. Despicable Me 3 (PG) Century 16: Fri. - Sun. Century 20: Fri. - Sun. BEATRIZ AT DINNER some character or other remind us every 1/2 five minutes that “The whole world’s at Guardians of the Galaxy Vol. 2 (PG-13) ++1/2 000 Century 16: Fri. - Sun. Century 20: Fri. - Sun. QMOVIEREVIEWS Screenwriter Mike White and director stake,” unless a few choice humans can Miguel Arteta — frequent collaborators, ally with a few good Autobots and save The Hero (R) Aquarius Theatre: Fri. - Sun. most recently on HBO’s “Enlightened” — the day. But Bay makes it very, very difficult THE BIG SICK 000 to care. “The Last Knight” is all mirthless The House (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. “The Big Sick” is a romantic comedy make our nation’s political intractability the stuff of comedy and drama in their jokes and thrill-less mayhem. RatedPG-13 The Little Hours (R) Aquarius Theatre: Fri. - Sun. Kumail Nanjiani (“Silicon Valley”) co-wrote for violence and intense sequences of sci-fi with his wife, Emily V. Gordon. The film is provocative new film “Beatriz at Dinner,” Maudie (PG-13) Aquarius Theatre: Fri. - Sun. which dramatizes the spiritual exhaustion action, language, and some innuendo. Two essentially the true story of Nanjiani and hours, 29 minutes. — P.C. The Mummy (PG-13) +1/2 Century 20: Fri. - Sun. Gordon’s relationship, starring Nanjiani of our time.Happenstance sets the table for middle-class holistic healer Beatriz The Music Man (Not Rated) Stanford Theatre: Fri. - Sun. as himself. We see Nanjiani working the CARS 3 room at Chicago’s comedy clubs, hanging Luna (Salma Hayek) when one of her 000 Rough Night (R) Century 20: Fri. - Sun. with fellow comedians, struggling to rich clients (Connie Britton) invites her to Pixar’s “Cars 3” gets the franchise back Spider-Man: Homecoming (PG-13) please his Pakistani-American family, stay for dinner within the walls of a gated on track with a story that U-turns to the +++ and wooing Emily (Zoe Kazan). All of this community. The dinner celebrates an heart of the 2006 original. This time, Century 16: Fri. - Sun. Century 20: Fri. - Sun. business works as engaging high-spirited impending business deal, and the guest of champion race car Lightning McQueen Tammy and the Bachelor (Not Rated) Stanford Theatre: Fri. - Sun. “honor” is a hotel-owning mogul named (Owen Wilson) faces stiff competition slice-of-life material, with Kazan and Transformers: The Last Knight (PG-13) 1/2 Nanjiani charming with their comic banter. Doug Strutt (John Lithgow). Strutt quickly from smack-talking Jackson Storm (Armie Century 16: Fri. - Sun. Century 20: Fri. - Sun. But the rub is in that title: “The Big Sick” proves racist, callous and smug. It’s no Hammer), a sleek, custom-built “Next- refers to the unavoidable spoiler that Emily great leap to see Strutt as Trumpian, but Gen” Piston Cup Racer. After a series of The Women’s Balcony (Not Rated) Guild Theatre: Fri. - Sun. “Beatriz at Dinner” has bigger fish to fry losses, Lightning begins to wonder: is it unexpectedly finds herself incapacitated Wonder Woman (PG-13) than any one figure. White and Arteta’s time to retire? It’s a bumpy road, and soon +++ by a health crisis. That crisis not only winds Century 16: Fri. - Sun. Century 20: Fri. - Sun. up ultimately bringing the lovers together big picture frames the troubling way of Lightning’s being encouraged by Rust-Eze’s new owner Sterling (Nathan Fillion) to for good (see the screenwriting credits) but the world under American hegemony, Aquarius: CineArts at Palo Alto Square: sets the stage for Kumail to meet Emily’s the smokestacks and oil spills idealists “cash in” and become a “brand” through 430 Emerson St., Palo Alto 3000 El Camino Real, Palo Alto lovably loving parents, Beth and Terry, can’t wish away. The meeting of Luna product endorsements. It’ll all come down (For recorded listings: 327-3241) (For information: 493-0128) played by Holly Hunter and Ray Romano. and Strutt contrasts healing and nurturing to the Florida 500: if Lightning wins, he can tinyurl.com/Aquariuspa tinyurl.com/Pasquare keep racing for Rust-Eze. If he loses, he’s Nanjiani and Gordon also do a nice job to destruction and a killer instinct (Strutt Century Cinema 16: Guild: done. “Cars 3” sets up the expectation, 949 El Camino Real, of laying out an arc of acceptance within concludes, “The world is dying. What are 1500 N. Shoreline Blvd., Menlo Park (For recorded listings: Nanjiani’s immediate family, despite his you going to do?...You should try to enjoy then, that it is a latter-day “Rocky” story, a Mountain View 566-8367) tinyurl.com/Guildmp yourself”).Rated R for language and a comeback journey for an aging competitor tinyurl.com/Century16 choices of a comedy career and a non- Stanford Theatre: Pakistani woman (since more-or-less scene of violence. One hour, 23 minutes. who’s still got life left in him. That’s not wrong, but it turns out that what “Cars Century 20 Downtown: 221 University Ave., Palo Alto arranged marriage is the norm). This — P.C. 825 Middleﬁeld Rd, Redwood City (For recorded listings: 324-3700) boilerplate romantic-comedy is consistently 3” is really about is the role of a great tinyurl.com/Century20 Stanfordtheatre.org amusing and possessed with charming TRANSFORMERS: teacher, or mentor. The turns of the final race cleverly integrate both halves of the leads, and also serves as a heartwarming THE LAST KNIGHT 1/2 0Skip it For show times, plot synopses, drama. Rated R for language including movie into a surprisingly satisfying whole, “Transformers: The Last Knight,” Michael another entertaining and meaningful 00Some redeeming qualities trailers and more movie some sexual references. One hour, 59 Bay’s fifth movie about shape-shifting alien 000A good bet info, visit www.mv-voice.com minutes. — P.C. G-rated win for Pixar. Rated G. One hour, robots, tries to whip up tension by having 49 minutes. — P.C. 0000Outstanding and click on movies. July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 17 VOICE MOUNTAINVIEW QHIGHLIGHT ‘WHAT YOU WILL’ Pear Theatre’s season concludes with “What You Will,” a “Shakespearean travesty” by Max Gutmann. Kidnapping, cross-dressing and adultery combine in this madcap comedy, written by rearranging thousands of snippets cut from the plays of William Shakespeare into a completely new plot. June 23-July 16, times vary. $10, previews; $35, opening; $32, regular. The Pear Theatre, 1110 La Avenida, Mountain View. thepear.org

THEATER Merola Opera Program: Schwabacher French Country Dance Workshop and Free Mock ACT Test Students in grades 8 Los Altos Library, 13 South San Antonio Road, Summer Concert Some of opera’s greatest Party Start celebrating Bastille Day a week through 12 can try a full-length mock ACT test Los Altos. sccl.org “The Four Immigrants: An American moments come to life as the Merola Opera early! Instructors will help teach and lead French and receive guidance to increase their test score. Hiking with WWC Hike with Women Who Musical Manga” TheatreWorks Silicon Program’s young artists perform staged country dances to the live music of Fete Musette Test-takers must bring pencils and calculator. Code to take a break away from computers, talk Valley presents the world premiere of “The Four vignettes from Mascagni’s “Cavalleria in addition to couple dances, mixers and line Seats are limited. July 8, 1-5 p.m. Free, RSVP about coding and have fun. Meet at the lower Immigrants: An American Musical Manga.” Set Rusticana,” Moore’s “The Ballad of Baby Doe,” dances from Alsace, Brittany, Central France and requested. ThinkTank Learning, 4856 El Camino right parking lot of the preserve for a roughly to an infectious ragtime and vaudeville score by Massenet’s “Thais,” Weber’s “Der Freischutz,” Gascony, ending with a delightful waltz. July 7, 8 Real, Suite 200, Los Altos. eventbrite.com two-hour hike. July 9 and Aug. 13, 9-11 a.m. local composer/lyricist Min Kahng, the comic Donizetti’s “Lucrezia Borgia” and more, p.m. $12 at the door; half-price for students; free Free. Rancho San Antonio County Park and musical follows four Japanese immigrants in accompanied by a full orchestra with English for children. First Baptist Church Event Hall, 305 COMEDY Open Space Reserve, 22500 Cristo Rey Drive, turn-of-the-20th-century San Francisco. July supertitles. July 9, 2:30 p.m. $30-$40. Bing N. California Ave., Palo Alto. meetup.com Comedians at Red Rock Bay Area comedian Los Altos. meetup.com 12-Aug. 5, times vary. Discounts for educators, Concert Hall, 327 Lasuen St., Stanford. events. Thursday Night Live The Thursday Night Kevin Wong will host his monthly comedy Hike at Monte Bello Open Space seniors, and patrons 35 and under. Lucie Stern stanford.edu/events/ Live Series in Downtown Mountain View takes showcase at Red Rock Coffee. This comedy Preserve A strenuous, moderately paced, out- Theatre, 1305 Middlefield Road, Palo Alto. Russian Movie Club With the art critic Boris place on Castro Street between Mercy and Villa event is held on the third Saturday of each month and-back 11-mile hike. Route will go down the theatreworks.org Vladimirsky, viewers will watch new and old streets, which will be closed to traffic so the through the end of the year, 8:30-10:30 p.m. Bella Vista trail to Black Mountain and continue ‘The North Pool’ “The North Pool,” by Rajiv movies with the foreword of the Docent and public can walk the street to enjoy restaurant Free, donations welcome. Red Rock Coffee, 201 on to the Ridge Winery for an extended lunch Joseph and directed by Jacquelyn Montellato, following discussion with participation of all dining, shopping, children’s activities, a farmer’s Castro St., Mountain View. kevinwongcomedy. break and wine tasting. July 9, 9:30 a.m. $10, follows Khadim, a Syrian-born student in a who will be present. Boris Vladimirsky many market, live music and a custom/classic car show. com/shows/ four wine tastings; $20, exclusive wines. Monte large U.S. high school who is called into the vice years managed the Art and Concert Department July 13 and 27, 5:30-8:30 p.m. Free. Downtown Comedy Night at O’Malley’s All are Bello Open Space Preserve (Parking Lot), 4185 principal’s office to discuss recent absences; he of Palo Alto JCC, edited the monthly magazine Mountain View, Castro Street, Mountain View. invited to enjoy some laughs as they see some Page Mill Road, Los Altos. meetup.com soon becomes caught in a web of lies about crimes “Vstrecha”, staged performances of the group mountainview.gov/thursdaynightlive of best comedians in the Bay Area as they work he may (or may not) have committed. Through “Baby Boomers & Co” and gave lectures on out new material. The even is for ages 21 and TEENS FESTIVALS & FAIRS over, and there is no cover charge. It’s hosted July 16, Thursday-Saturday, 8 p.m.; Sunday, 2 p.m; literature and art. This is for Russian Speakers. Cube Club Cubing experts share the excitement by Wes Hofmann. Sundays, July 2-30, 8-10 $15-$35. Dragon Theatre, 2120 Broadway St., Third Tuesday of the month, 7-9:30 p.m. $12, 2017 ACGA Palo Alto Clay and Glass of solving the cube and friends help friends. p.m. Free. O’Malley’s Sports Pub, 2135 Old Redwood City. dragonproductions.net/activities/ general. Oshman Family JCC, 3921 Fabian Way, Festival Celebrating 25 years, this fabulous Program open to students in third through 12th Middlefield Way, Mountain View. facebook.com/ mondaynight.html Palo Alto. brownpapertickets.com/event/ festival celebrates clay and glass art. More grades. Participants asked to bring their own cube comedynightatomalleys/ TheatreWorks: Hershey Felder, Train Chart-topping San Francisco locals Train are than 140 local artists will display the finest or borrow one from the library. No registration Beethoven TheatreWorks Silicon Valley hitting the road on their “Play That Song Tour” in in handcrafted glass and ceramics. Take part FOOD & DRINK required. July 13, 4-5 p.m. Free. Mountain completes its 2016/2017 season with the celebration of their latest album, “A Girl, a Bottle, in fun activities such as clay, glass, raku and View Library, 585 Franklin St., Mountain View. regional premiere of a newly-revised work a Boat,” including this home show at Shoreline ikebana demonstrations. Free admission; valet Off the Grid: Mountain View @ The mountainview.gov/depts/library/ parking available. July 8-9, 10 a.m.-5 p.m. Palo Computer History Museum by acclaimed performer/playwright Hershey Amphitheatre. Jam band O.A.R. and British pop Off the Grid: Knit & Crochet Club Learn something new, Alto Art Center, 1313 Newell Road, Palo Alto. Mountain View @ Computer History Museum Felder. Following his triumph as Irving Berlin singer Natasha Bedingfield open the concert on get answers to questions or just bring a project clayglassfestival.com returns in partnership with the Computer History at TheatreWorks, Felder will bring Ludwig van the peninsula. July 8, 7 p.m. Ticket prices vary. and enjoy the company of other knitters. Supplies Summer Youth Camps These one-week Museum. There will be 10 food trucks, live music Beethoven to life through the eyes of a Viennese Shoreline Amphitheatre, 1 Amphitheatre Parkway, provided for beginners. Open to all skill levels, camps are for kids ages 7-12 and 10-14. They and additional amenities. This is a kid-friendly doctor who spent his boyhood by the Maestro’s Mountain View. facebook.com/events/ ages 8 and up. Fridays, June 30-July 21, 1-4 p.m. offer Intro to Video Production, Claymation and event. Fridays, ongoing, 5-9 p.m. Free. Computer side in “Hershey Felder, Beethoven.” June 7-July Free. Mountain View Library, 585 Franklin St., Field Production. Each camp is one week from History Museum, 1401 N. Shoreline Blvd., 9, times vary. $45-$105. Mountain View Center MUSIC Mountain View. mountainview.gov/depts/library/ 10 to 4 p.m. Summer, ongoing, June 12-Aug. Mountain View. facebook.com/events/ for Performing Arts, 500 Castro St., Mountain Classical Guitarist Yuri Liberzon All are My Digital TAT2 Presents: Digital View. theatreworks.org/calendar/2016-2017- 11. $350-$475. KMVT Community Television, invited to enjoy this summer evening featuring 1400 Terra Bella Ave., Suite M, Mountain LESSONS & CLASSES Dialogue Join the founders of My Digital TAT2, season/beethoven/ Yuri Liberzon, an internationally acclaimed Erica Pelavin and Gloria Moskowitz-Sweet, View. kmvt15.org/learn/youthactivities. Animation Camp Using industry standard concert classical guitarist and recording artist. who will use a lively, informative and interactive html#summercamp animation software, students will learn to create CONCERTS Wine and light refreshments will be provided format. This workshop brings tweens and parents 2D animations and special effects for movies. Concert on the Plaza All are invited to join for further enjoyment. July 13, 7-8:30 p.m. $10. together to facilitate and improve communication TALKS & LECTURES Kids plan, design and storyboard their projects. friends and neighbors and bring a blanket or Museum of American Heritage, 351 Homer Ave., around safe, responsible, and conscious digital Astronomer Andrew Fraknoi The Menlo This camp is suitable for grades 6 to 9. July 10-14, lawn chair to the Civic Center Plaza for a variety Palo Alto. use. July 13, 7-8:30 p.m. Mitchell Park Community Park Library will host astronomer Dr. Andrew 9 a.m.-3 p.m. $450. Midpen Media Center, 900 Center, 3700 Middlefield Road, Palo Alto. of musical performances. There will also be food Federspiel (“Austriafest”) This seven- Fraknoi, who will entertain & educate with an San Antonio Road, Palo Alto. midpenmedia.org/ brownpapertickets.com trucks, a “Pop Up Park” area for children and — piece ensemble redefines brass-band music. All illustrated, nontechnical talk about the upcoming youth/digiquest/#Animation-Camps for adults — beer and wine. First Friday of the are invited to join for Austrian-themed food, drink Python for Tweens and Teens This four- full solar eclipse. There will be a book signing ESL Conversation Club The ESL month, 6-7:30 p.m. Free. Mountain View Civic and fun in Bing’s Gunn Atrium. July 8, 7:30 p.m. week class will teach students how to code in afterwards, with Kepler’s Books making copies Conversation Club will help participants practice Center Plaza, 500 Castro St., Mountain View. $20. Bing Concert Hall, 327 Lasuen St., Stanford. Python, an object-oriented, popular and easy available for sale. July 13, 7-8:30 p.m. Free. English through casual conversation with mountainview.gov/plazaevents events.stanford.edu/events/ Menlo Park Library, 800 Alma St., Menlo Park. friendly company. All levels, everyone welcome. to learn programming language. Students need menlopark.org/adults No registration required. Tuesdays, July 11-25, to bring their own laptops but may reserve a loaner in advance. Saturdays, July 8-29, 3-5 p.m. Bonnie Rochman Bonnie Rochman, award- 5-6 p.m. Free. Mountain View Library, 585 Free. Mountain View Library, 585 Franklin St., winning journalist and former health and Franklin St., Mountain View. mountainview.gov/ Mountain View. mountainview.gov/depts/library/ parenting columnist for Time.com and staff writer depts/library/ Inspirations Read Quest Tween: Realistic Fiction for Time magazine, discusses her compelling Fitness with the YMCA This class helps to work, “The Gene Machine: How Genetic develop balance, flexibility, strength, posture, Explore popular genres and topics in tween Technologies Are Changing the Way We Have coordination and fall prevention. It is appropriate literature. The program includes goofy games, cool a guide to the spiritual community Kids--And the Kids We Have.” July 13, 7-9 p.m. for all levels and backgrounds in partnership crafts, and crazy charades while participants share Free. Books Inc. Palo Alto, 74 Town & Country, and led by instructors from the YMCA. Please their favorite books around the theme of realistic 855 El Camino Real, Palo Alto. booksinc.net bring your own Yoga mat or towel. Wednesdays, fiction. July 7, 3-4 p.m. Free, RSVP requested. To include your Family Love Letter: Vital Information July 5-July 26, noon-1 p.m. Free, registration Mountain View Library, 585 Franklin St., Mountain Church in for Your Family This presentation addresses required. Mountain View Library, 585 Franklin St., View. mountainview.gov/depts/library/ items that are not normally included in a family Mountain View. mountainview.gov/depts/library/ BUSINESS will or trust. Family Love Letter is a system which Kids Read Kids Read is a program for Inspirations helps to reduce confusion and stress and provide Kindergarten, First and Second graders who Burritos and Startups A monthly meeting Please call families with tools. July 11, 7-8:30 p.m. Mountain would like to practice their reading with a Middle to discuss all things startup and what is involved View Public Library, 585 Franklin St., Mountain or High School buddy. The program is free and in becoming a startup co-founder. Participants Blanca Yoc View. mountainview.gov no registration is required. July 9, 3:30-4:30 p.m. asked to bring your questions, hopes, and Residential Curbside Food Scraps Free. Mountain View Library, 585 Franklin St., dreams. July 13, noon. Free. Una Mas, 1040 at 650-223-6596 Program Learn about Mountain Viewís new Mountain View. mountainview.gov/depts/library/ Grant Road, Mountain View. meetup.com or email residential food scraps program for residents Monthly mixer: find your startup who have curbside trash and recycling service OUTDOOR RECREATION co-founder Attendees can receive help with [email protected] (individual carts). A pilot for apartment residents A Hike on Shaky Ground A hike in the business basics; participate in networking will be developed in 2017 for implementation in Santa Cruz Mountains near the San Andreas activities and choose co-founders; find marketing 2018. July 10, 6-7 p.m. Mountain View Library, Fault. The route will go through grasslands, resources and strategic partners; seek investors 585 Franklin St., Mountain View. mountainview. woodlands, a riparian corridor and an old orchard and raise venture capital; and get access to MOUNTAIN VIEW CENTRAL SEVENTH-DAY ADVENTIST CHURCH gov/depts/library/ before visiting the Los Trancos earthquake trail. advisory boards and mentors, as well as improve July 9, 10 a.m.-2 p.m. $100. Montebello and Los entrepreneurship skills in various training Sabbath School: 9:30 a.m. FAMILY Trancos Open Space Preserves, 4185 Page Mill programs. July 12, 12:15 p.m. Free. Techcode, Saturday Services: Worship 10:45 a.m. Dads at Play in the Park Elisabeth Stitt of Road, Los Altos. eventbrite.com 1172 Castro St., Mountain View. meetup.com Joyful Parenting Coaching has a mission to bring Design-It Yourself Native Plant MV Technology Showcase The Technology Wednesday Study Groups: 10-11 a.m. joy to parenting and a key tool for that is being Garden Learn the principles of garden design, Showcase is a one-day outdoor event where more playful. This workshop provides a chance for including how to remove a lawn in order to local tech companies and startups showcase Pastor Kenny Fraser, B.A.M. DIV dads and kids to play together, putting into action save water, decrease maintenance time and their latest products/technologies. The event is 1425 Springer Rd., Mtn. View - Office Hrs. M-F 9am-1pm tips and games and activities that can be modified create habitat. See an example of a design from presented by the City of Mountain View and the www.mtviewda.adventistfaith.org Phone: 650-967-2189 and played in all kinds of settings. July 8, 4:30- start to finish, learn about free online designs Chamber of Commerce. July 12, 11:30 a.m.-3 5:30 p.m. Free, RSVP requested. Cuesta Park, 615 available to download and modify and get ready p.m. Free. Civic Center Plaza, 500 Castro St., Cuesta Drive, Mountain View. eventbrite.com to put pencil to paper. July 12, 7-8:30 p.m. Free. Mountain View. chambermv.org 18 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 fogster.com THE PENINSULA’S FREE CLASSIFIEDS WEBSITE Combining the reach of the Web with Marketplace print ads reaching over 150,000 readers! PLACEPLACE AN AD fogster.com is a unique website offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in the Palo Alto Weekly, The Almanac and the Mountain View Voice. ONLINE fogster.com PREGNANT? Engineering Program Manager Silvia’s Cleaning CONSIDERING ADOPTION? Call us first. 235 Wanted to Buy Resp. for eng’g dvlpmt cycle of co.’s We don’t cut corners, we clean them! Bulletin Living expenses, housing, medical, and WANTED! prdcts from initial reqmt setting to Bonded, insured, 22 yrs. exp., service E-MAILE-MAIL continued support afterwards. Choose Old Porsche 356/911/912 for restora- release. MS or equiv. deg. in CS, Comp. guaranteed, excel. refs., free est. adoptive family of your choice. Call 24/7. tion by hobbyist 1948-1973 Only. Any Eng., EE, Eng. or equiv. field. 2 yrs exp. as 415/860-6988 [email protected]@fogster.com 1-877-879-4709 (Cal-SCAN) condition, top $ paid! PLEASE LEAVE Eng Prog Mgr, Prog Mgr, Eng or equiv. 2 MESSAGE 1-707- 965-9546 (Cal-SCAN) Board Safe Step Walk-In Tub! yrs concurrent exp. with: Prgrm Mgmt, 748 Gardening/ PHONE Alert for Seniors. Bathroom falls can be incl. Agile Scrum methodologies, sprint fatal. Approved by Arthritis Foundation. 245 Miscellaneous goals, Scrum tools, such as Version One, Landscaping 650.326.8216 115 Announcements Therapeutic Jets. Less Than 4 Inch Step- Nice Crock Pot! Works Great! - $15.00 JIRA & Microsoft Prjct; Creating & defin- LANDA’S GARDENING & In. Wide Door. Anti-Slip Floors. American ing PMO methodology & best practices, LANDSCAPING A PLACE FOR MOM. Made. Installation Included. Call such as acceptance criteria, entry & exit *Yard Maint. *New Lawns. *Clean Ups Now you can log on to The nation’s largest senior living refer- 1-800-799-4811 for $750 Off. (Cal-SCAN) Mind criteria & milestone tracking; Prep’g & *Irrigation timer programming. ral service. Contact our trusted,local rvw’g Test Plans, envrnmt config., app 20 yrs exp. Ramon, 650/576-6242 fogster.comfogster.com, day or experts today! Our service is FREE/ Social Security Disability? installations & tst’g schedules, conduct- [email protected] night and get your ad no obligation. CALL 1-800-550-4822. Up to $2,671/mo. (Based on paid-in ing risk-based tst’g & rvws, Build & (Cal-SCAN) amount.) FREE evaluation! Call Bill Release mgmt & defect mgmt; Creating 751 General Gordon & Associates. 1-800-966-1904. & Body started immediately online. DID YOU KNOW comprehensive Governance roadmap Mail: 2420 N St NW, Washington DC. for Prcss, compliance & audits & metrics, Contracting Most listings are free and Information is power and content is Office: Broward Co. FL., member TX/NM King? Do you need timely access to implementing Change Ctrl Mgmt for Bar. (Cal-SCAN) s/w releases w/ tools like SVN & Bugzilla; includeinclude a one-lineone-line frfreeee public notices and remain relevant in 405 Beauty Services A NOTICE TO READERS: today’s highly competitive market? Gain Switch to DIRECTV. ELIMINATE CELLULITE Forex Mrkts, foreign exchng principles printprint ad in our Peninsula & FIX (Finc’l Info. eXchange) protocols; It is illegal for an unlicensed person an edge with California News Publishers Lock in 2-Year Price Guarantee ($50/ And Inches in weeks! All natural. Odor to perform contracting work on any Association new innovative website month) w/AT&T Wireless. Over 145 free. Works for men or women. Free Wrkg w/ RDBMS: Oracle 9i, SQL Srvrs newspapersnewspapers with the & UI Dsgn lang. such as HTML, DHTML, project valued at $500.00 or more in capublicnotice.com and check out the Channels PLUS Popular Movie Networks month supply on select packages. Order labor and materials. State law also optionoption of photosphotos and Smart Search Feature. For more informa- for Three Months, No Cost! now! 1-844-703-9774. (Cal-SCAN) XML & JavaScript; Web Srvrs such as IIS & NT; Rprt’g tools such as Oracle requires that contractors include additional lines. ExemptExempt tion call Cecelia @ (916) 288-6011 or Call 1- 800-385-9017 (Cal-SCAN) their license numbers on all advertis- www.capublicnotice.com (Cal-SCAN) Rprts, JIRA/Version One, Data Rprts & are employment ads, Water Damage to Your Home? Salesforce. Jobsite: Palo Alto, CA. Mail ing. Check your contractor’s status DID YOU KNOW Call for a quote for professional cleanup resume: Position VC072017 Integral at www.cslb.ca.gov or 800-321-CSLB whichwhich includeinclude a wwebeb 7 IN 10 Americans or 158 million U.S. & maintain the value of your home! Set Development Corp., 850 Hansen Way, (2752). Unlicensed persons taking Adults read content from newspaper an appt. today! Call 1-855-401-7069 Palo Alto CA 94304 jobs that total less than $500.00 listinglisting charge. Home media each week? Discover the Power (Cal-SCAN) must state in their advertisements that they are not licensed by the Services and Mind & Body of Newspaper Advertising. For a free Astronomer Andrew Fraknoi Jobs Newspaper Delivery Routes brochure call 916-288-6011 or email Contractors State License Board. Services requirerequire contact FREE BOOK GIVEAWAY Available [email protected] (Cal-SCAN) Deliver the award-winning Palo Alto withwith a CustomerCustomer SalesSales DID YOU KNOW HUGE USED BOOK/CD/DVD SALE 500 Help Wanted Weekly to curbside racks and local Representative.Representative. Information is power and content is Literature Book Club: TECHNOLOGY businesses every Friday morning. 771 Painting/ King? Do you need timely access to Routes pay approx. $80 each. Own Stanford music theory for all Informatica LLC has the following job So, the next time you have public notices and remain relevant opportunity available in Redwood vehicle, driver’s license, insurance and Wallpaper in today’s hostile business climate? Stanford music tutorials City, CA: Development Architect familiarity with the Palo Alto area are STYLE PAINTING Gain the edge with California News required. Email an item to sell, barter, give Vintage Mountain View Gifts (VS-CA): Ensure sound design and Full service interior/ext. Insured. Lic. Publishers Association new innovative implementation of big functional areas [email protected] 903303. 650/388-8577 away or buy, get the perfect website capublicnotice.com and check for more details. 120 Auctions for Informatica’s core products. Submit combination: print ads in out the FREE One-Month Trial Smart resume by mail to: Attn: Global Mobility, 775 Asphalt/ Search Feature. For more information DID YOU KNOW Informatica LLC, 2100 Seaport Blvd., SCIENCE your local newspapers, call Cecelia @ (916) 288-6011 or 144 million U.S. Adults read a Newspaper Redwood City, CA 94063. Must reference DNAnexus, Inc. has job opp. in Concrete www.capublicnotice.com (Cal-SCAN) print copy each week? Discover the job title and job code: VS-CA. Mountain View, CA: Genomic Scientist. reaching more than 150,000 Power of Newspaper Advertising. For a Roe General Engineering DISH NETWORK. Dvlp & implmt data analysis systms for free brochure call 916-288-6011 or email ENGINEERING Asphalt, concrete, pavers, tiles, sealing, readers, and unlimited free TV for Less, Not Less TV! FREE DVR. FREE genomics data. Mail resumes refernc – [email protected] (Cal-SCAN) Informatica LLC has the following posi- artificial turf. 36 yrs exp. No job too web postings reaching Install (up to 6 rooms.) $49.99/mo. tion available in Redwood City, CA: Req. #GNM17 to: Attn: K. Green, 1975 W small. Lic #663703. 650/814-5572 PLUS Hi-Speed Internet - $14.95/mo 133 Music Lessons Senior Engineer, Cloud Operations El Camino Real, Ste 101, Mountain View, hundreds of thousands (where available.). Call 1-855-734-1673. (VN-CA): Participate in the operations CA 94040. (Cal-SCAN) additional people!! Christina Conti Piano automation project. Develop operation Software Engineer Real DONATE YOUR CAR, TRUCK OR BOAT Private piano lessons for all levels, all harness suite. Submit resume by mail to: Software Engineer – Programmable TO HERITAGE FOR THE BLIND. FREE ages. In your home or mine. Attn: Global Mobility, Informatica LLC. Voice, Twilio, Inc.; BS in Computer 3 Day Vacation, Tax Deductible, Free Bachelor of Music, 20+ years exp. 2100 Seaport Blvd. Redwood City, CA Science or related + 2 yrs exp as a Towing, All Paperwork Taken Care of. 650/493-6950 94063. Must reference job title and job Software Engineer or related. Worksite Estate INDEX Call 1-800-731-5042 (Cal-SCAN) code (VN-CA). is 399 W El Camino Real, Mountain View, CA 94040. Resume to HR at 375 Beale EVERY BUSINESS Hope Street Music Studios ENGINEERING Q BULLETIN BOARD St., Suite 300, San Francisco, CA, 94105. Now on Old Middefield Way, MV. ItsOn, Inc. accptg resumes for Senior Has a story to tell! Get your message out Reference Job #333 801 Apartments/ 100-199 with California’s PRMedia Release – the Most instruments, voice. Network Security Engineer in only Press Release Service operated by All ages and levels 650-961-2192 Redwood City, CA. Provide dsgn, Condos/Studios Q FOR SALE the press to get press! For more info www.HopeStreetMusicStudios.com implmt’n, & spprt of IT & Prdctn Ops Menlo Park 1B/Near Dwtn 200-299 contact Cecelia @ 916-288-6011 or ntwrk & security infrastructure. Mail Business $2000 Per Month. Includes Utils, frplc, http://prmediarelease.com/california 145 Non-Profits resume: ItsOn, Inc., HR Recruiting, 3 gar.,sm patio. 1BR/1BA. Q KIDS STUFF (Cal-SCAN) Lagoon Dr, Ste 230, Redwood City, CA Call 650 322-2814. Needs 94065. Must Ref. #SNSE-AM. GET CASH FOR CARS/TRUCKS!!! San Carlos, 1 BR/1 BA - $2,200.00 330-399 DONATE BOOKS/HELP PA LIBRARY Services All Makes/Models 2000-2016! Top $$$ ENGINEERING Q MIND & BODY Paid! Any Condition! Used or wrecked. Highfive Technologies, Inc. is accept- 805 Homes for Rent Running or Not. Free Towing! Call For 150 Volunteers ing resumes for the position of Device Menlo Park, 2 BR/1 BA - $3750 400-499 Offer: 1- 888-417-9150. (Cal-SCAN) ASSIST IN FRIENDS BOOKSTORE Software Engineer in Redwood City, 624 Financial CA. Design, implement, test and deploy Got an older car, boat or RV? ASST SECTION MGRS FOR FOPAL Do you owe over $10,000 QJOBS software for audio/video applications To the IRS or State in back taxes? Our 809 Shared Housing/ Do the humane thing. Donate it to the written in C and C++. Mail resume to 500-599 Humane Society. Call 1- 800-743-1482 FRIENDS OF MENLO PARK LIBRARY firm works to reduce the tax bill or zero Rooms Highfive Technologies, Inc., Staffing it out completely FAST. Call now (Cal-SCAN) FRIENDS OF THE PALO ALTO LIBRARY Redwood City, 1 BR/2 BA - 1200.00 Dept., 500 Arguello Street, Suite 200, 855-993-5796. (Cal-SCAN) QBUSINESS Got Knee Pain? JOIN OUR ONLINE STOREFRONT TEAM Redwood City, CA 94063. Must reference SERVICES Back Pain? Shoulder Pain? Get a pain- Stanford Museum Volunteer Ref. DSE-MT. 810 Cottages for relieving brace -little or NO cost to you. 600-699 Medicare Patients Call Health Hotline Home Rent Now! 1-800-796-5091 (Cal-SCAN) Los Altos Hills, 1 BR/1 BA - $2850/mo QHOME KC BUYS HOUSES SERVICES FAST - CASH - Any Condition. Family Services 845 Out of Area 700-799 owned & Operated . Same day offer! NORTHERN AZ WILDERNESS RANCH (951) 805-8661 For Sale $197 MONTH - Quiet secluded 37 acre Q FOR RENT/ WWW.KCBUYSHOUSES.COM (Cal-SCAN) 715 Cleaning off grid ranch set amid scenic moun- Lowest Prices tains and valleys at clear 6,200’. Near FOR SALE On Health & Dental Insurance. We have Fogster.com is a historic pioneer town & large fishing 210 Garage/Estate Services lake. No urban noise & dark sky nights REAL ESTATE the best rates from top companies! Call unique website offering Isabel and Elbi’s Housecleaning Now! 888-989-4807. (Cal-SCAN) amid pure air & AZ’s best year-round cli- 800-899 Sales Apartments and homes. mate. Evergreen trees /meadowland OXYGEN Menlo Park, 1340 Crane St, Sat July 8, FREE postings from Excellent references. Great rates. blend with sweeping views across QPUBLIC/LEGAL Anytime. Anywhere! No tanks to refill. No 8am-2pm 650/670-7287 or 650/771-8281 uninhabited wilderness mountains and deliveries. The All-New Inogen One G4 communities throughout the NOTICES Mountain View, Xxxxx, Call for time valleys. Self-sufficiency quality garden is only 2.8 pounds! FAA approved! FREE Bay Area and an opportunity Orkopina Housecleaning loam soil, abundant groundwater & 995-997 info kit: 1-844-359-3976. (Cal-SCAN) Palo Alto, 50 Embarcadero Road, July Cleaning homes in your area since maintained road access. Camping & 8, 9-3 for your ad to appear in The 1985. Last minute calls! 650/962-1536 RV’s ok. No homeowner’s Assoc. or deed restrictions. $22,900, $2,290 dn. Free The publisher waives any and all claims or Almanac, the Palo Alto Weekly, brochure with additional property consequential damages due to errors. Embarcadero To place a Classified ad in The Almanac, The Palo Alto Weekly FOGSTER.COM descriptions, photos/ terrain map/ Media cannot assume responsibility for the claims or and the Mountain View Voice. weather chart/area info: 1st United performance of its advertisers. Embarcadero Media or The Mountain View Voice call 326-8216 or visit us at fogster.com Place an ad or for more info has the right to refuse, edit or reclassify any ad Realty 800.966.6690. (Cal-SCAN) solely at its discretion without prior notice. GO TO FOGSTER.COM TO RESPOND TO ADS WITHOUT PHONE NUMBERS July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 19 MARKETPLACE the printed version of THE PENINSULA’S FREE CLASSIFIEDS WEBSITE TM TO RESPOND TO ADS WITHOUT PHONE NUMBERS fogster.com GO TO WWW.FOGSTER.COM Public Notices

SING-ALONG STORY TIME KELLY’S HEALING MASSAGE 995 Fictitious Name FICTITIOUS BUSINESS NAME STATEMENT FICTITIOUS BUSINESS NAME STATEMENT Statement File No.: FBN630731 File No.: FBN630873 The following person (persons) is (are) The following person (persons) is (are) EUROPEAN WAX CENTER doing business as: doing business as: FICTITIOUS BUSINESS NAME STATEMENT Sing-Along Story Time, located at 23 Kelly’s Healing Massage, located at 714 File No.: FBN630604 Mercy St., Apt. 7, Mountain View, CA Villa St., Mountain View, CA 94041, Santa The following person (persons) is (are) 94041, Santa Clara County. Clara County. doing business as: This business is owned by: An This business is owned by: Married European Wax Center, located at 1039-L Individual. Couple. El Monte Avenue, Mountain View, CA The name and residence address of the The name and residence address of 94040, Santa Clara County. registrant(s) is(are): the registrant(s) is(are): HUBERT C. This business is owned by: A KRISTEN NOELLE CASTANEDA WAPLES GOTUACO Corporation. 23 Mercy St. Apt. 7 60 Wilson Way Spc. 23 The name and residence address of the Mountain View, CA 94041 Milpitas, CA 95035 registrant(s) is(are): Registrant began transacting business ZHIXING T. GOTUACO TCT VENTURES INC. under the fictitious business name(s) 60 Wilson Way Spc. 23 303 Sacramento Street, listed above on 05/01/2017. Milpitas, CA 95035 3rd. Floor This statement was filed with the Registrant began transacting business San Francisco, CA 94111 County Clerk-Recorder of Santa Clara under the fictitious business name(s) Registrant began transacting business County on June 8, 2017. listed above on 05/09/2016. under the fictitious business name(s) (MVV June 16, 23, 30, July 7, 2017) This statement was filed with the listed above on 06/11/2012. County Clerk-Recorder of Santa Clara This statement was filed with the WE HANDLE ALL YOUR LEGAL PUBLISHING County on June 12, 2017. County Clerk-Recorder of Santa Clara NEEDS ࠮7\ISPJ/LHYPUN5V[PJL࠮9LZVS\[PVUZ࠮ (MVV June 23, 30, July 7, 14, 2017) County on June 5, 2017. )PK5V[PJLZ࠮5V[PJLZVM7L[P[PVU[V(KTPUPZ[LY (MVV June 16, 23, 30, July 7, 2017) ,Z[H[L࠮3PLU:HSL࠮;Y\Z[LL»Z:HSL;OL4V\U[HPU =PL^=VPJL

Do You Know? • The Mountain View Voice is adjudicated to publish in the County of Santa Clara. • Our adjudication includes the Mid-Peninsula communities of Palo Alto, Stanford, Los Altos and Mountain View. • The Mountain View Voice publishes every Friday.

Deadline: 5 p.m. the previous Friday

To assist you with your legal advertising needs Call Alicia Santillan (650) 223-6578 or email: [email protected]

WE MEASURE QUALITY BY RESULTS Is Quality Important to You? Yvonne Heyl Power of Two! Direct (650) 947-4694 Cell (650) 302-4055 [email protected] BRE# 01255661 Jeff Gonzalez THE PENINSULA’S FREE CLASSIFIEDS WEB SITE Direct (650) 947-4698 Cell (408) 888-7748 COMBINING THE REACH OF THE WEB WITH PRINT ADS REACHING OVER [email protected] 150,000 READERS! BRE# 00978793 [email protected] 496 First St. Suite 200 www.yvonneandjeff.com THINK GLOBALLY, Los Altos 94022

SHOP LOCALLY YOUR SUCCESS IS OUR BUSINESS! CERTIFIED RESIDENTIAL SPECIALISTS

Now you can log on to Fogster.com, day or night, and get your ad started immediately CERTIFIED RESIDENTIAL BROKERS (except for employment and business ads) free of charge online. You automatically get ALICE NUZZO a one-line free print ad in our Peninsula newspapers with the option of photos and (650) 504-0880 additional lines. [email protected] CalBRE # 00458678 So, the next time you have an item to sell, barter, give away or buy, get the perfect combination: print ads in your local newspapers, reaching more than 150,000 readers and ALICIA NUZZO unlimited free web postings reaching hundreds of thousands additional people! (650) 504-2394 ONLINE E-MAIL PHONE [email protected] fogster.com [email protected] 650/326-8216 CalBRE # 01127187

20 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 214 GLADYS AVENUE #A & #B, MOUNTAIN VIEW

214 GLADYS AVENUE #A 214 GLADYS AVENUE #B TWO UPDATED HOMES ON ONE LOT CLOSE TO DOWNTOWN • 3 bedrooms and 2 bathrooms • 2 bedrooms, 1 bath, plus 2 bonus rooms • Approximately 1,189 square A unique opportunity to own two homes in the heart of Silicon Valley, feet of living space • Approximately 900 square feet of living space across the street from Google daycare and Slater Elementary (re-opening in • Paneled front door opens 2019), close to transit at Whisman Station, and just one mile from downtown to living room with gleaming • Tiled foyer opens to freshly Mountain View. Residence A has 3 bedrooms and 2 bathrooms and features hardwood floors and wood- painted living room with an updated chef’s kitchen. Residence B, ideal as a rental property or guest burning fireplace with tiled laminate wood flooring, lighted cottage, has 2 bedrooms, 2 bonus rooms, and 1 bathroom, plus a full-sized surround ceiling fan, and large front-facing window kitchen and laundry room. Each home also has its own private, fully-fenced • Dining area has recessed outdoor space. Truly a rare opportunity! lighting, a lighted ceiling fan, and • Kitchen with white cabinetry, hardwood floor black granite countertops, and vinyl flooring OFFERED AT $1,699,000 • Remodeled chef’s kitchen WWW.214GLADYS.COM features hardwood floors, maple • Appliances include GE 5-burner cabinetry, granite countertops, gas range and a Kenmore and a built-in workstation refrigerator • Appliances include: Thermador • Two bedrooms each feature 4-burner gas range, Panasonic laminate wood flooring, center microwave, Bosch dishwasher, light, and wardrobe closet and Amana refrigerator • Additional bedroom/office has • Master bedroom suite has new its own exterior entrance and a carpeting, a center light, a wall of lighted ceiling fan closets plus a walk-in closet, and a sliding glass door that opens • Flexible-use room is located to the side yard; en suite bath between the living room and is tiled with a glass-enclosed bedroom 3 shower • Full bathroom has a single-sink • Two additional bedrooms, each vanity and tub with overhead with new carpeting, center light, shower and wardrobe closet, are served • Laundry room with washer and by tiled hallway bath with tub dryer and overhead shower • Fully-fenced rear yard features a • Attached 1-car garage with paved patio and large shed laundry hook-ups • Electronic gated driveway has • Paved and privately fenced patio parking for 4 vehicles

DIANE SCHMITZ CRAIG GORMAN (650) 947-2955 (408) 313-8411 CalBRE # 01235034 CalBRE # 01080717

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 21 20545 BEGGS ROAD Hope you had a great 4th of July! Los Gatos Now claim your own Independence with Real Estate.

A Dream Home that balances the demands of work and provides the serenity of nature and family! Stunning home with mountain views and tech upgrades, minutes from downtown Los Gatos.

Q 6 Bedrooms, 4.5 Bathrooms, with Q 3 Bedrooms All on the Same Level 7,561 Square Feet of Living Space for Coziness Q 2.21 Acre Lot with an Amazing Q Basement Houses an In-law View! Suite at 2,488 Square Feet with a Q Built in 2007- 10 Years Young! Bedroom, Bathroom, Living and Bonus Rooms! Q Dual Living Rooms and Family Rooms Q Seconds to the Main Road, 5 minutes to Highway 17 and just 12 Whether buying or selling, calling me is your move Q Massive Open Floor-plan from the Family Rooms, Kitchen and Dining minutes to Downtown Los Gatos in the right direction Rooms Surrounded by Views of the Redwood Forest Tori Ann Atwell T ORI ANN Broker Associate Alain Pinel Realtors ATWELL

(650) 996-0123 Cell: (408) 313-4352 BRE #00927794 www.alanwangrealty.com | CalBRE #01380385 www.ToriSellsRealEstate.com Dream Vacation Home at an Affordable Price

New Listing

Do you want to have a vacation dream spot on Pelican Point in Pajaro Dunes right on the sand? This is a 1/5 fractional sale Faith Sackett with 4 other partners. This is a CA, General Partnership for only $275,000 where you can go almost 3 months of the year hassle Realtor free. BRE # 01502244 7KLV EHDXWLIXO EHGURRP EDWK JURXQG ñRRU FRQGRPLQLXP is fully furnished and has all your necessities like kitchenware Cell: (831) 251-1557 DQGOLQHQVLQFOXGHG%HDXWLIXOñDWVFUHHQWHOHYLVLRQVDQGDSDWLR Direct: (831) 465-7015 to BBQ or listen and watch the white-water waves crash right Fax: (831) 464-0565 from the living area. This is just a small part of this wonderful e-mail: [email protected] YDFDWLRQVSRWDQGWKHDPHQLWLHVWKDWWKLVKDVWRRσHU www.faithsackett.cbintouch.com Call Faith Sackett for more details.

22 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017 Your home is where our heart is

THE TROYER GROUP

1971 W Middleﬁ eld Rd #10 MOUNTAIN VIEW

BRIGHT END-UNIT TOWNHOME WITH MEDITERRANEAN STYLE

EXTENDED HOURS: FRIDAY, 9:30AM – 5:00PM SATURDAY & SUNDAY, 1:00 – 5:00PM

3 BEDS 2.5 BATHS HARDWOOD FLOORS GRANITE-APPOINTED CHEF’S KITCHEN GAS FIREPLACE WITH CRUSHED GLASS EXPANSIVE BALCONY REAR DECK & YARD 2-CAR GARAGE ONE BLOCK TO SHOPPING & DINING EXCELLENT MOUNTAIN VIEW SCHOOLS

1971WMIDDLEFIELD10.COM $1,398,000

DAVID TROYER CalBRE# 01234450

650.440.5076 | [email protected] | DAVIDTROYER.COM A Berkshire Hathaway Affiliate

July 7, 2017 Q Mountain View Voice Q MountainViewOnline.com Q 23 Open Saturday / Sunday

Remodeled Cul-de-Sac Home in Sought-After Waverly Park Privately located at the end of a cul-de-sac, this Monterey Colonial has been extensively remodeled and expanded to offer incredible space with resort-like grounds in sought-after Waverly Park. Thoughtfully re-constructed and unified by behind-the-scenes media wiring and solar-powered electricity, this home exemplifies casual everyday living boosted by modern day engineering. Public rooms include a living room with stacked stone fireplace, elegant dining room, and inviting family room, all catered by a richly appointed gourmet kitchen. The home has 5 bedrooms, an office, and 5 full baths, including a main-level bedroom ideal for guests and an expansive upstairs master suite. The lower level, with 9-foot ceilings and abundant natural light, is designed for recreation and play with integrated media, a full bar, and temperature-controlled wine cellar. Outside, the gorgeous rear yard awaits entertaining with a pool, spa, fire pit, and tremendous pergola-covered outdoor kitchen. Just blocks away from Cooper and Cuesta Parks, a quick drive via Highways 237 and 85 to all of Silicon Valley, plus access to excellent Mountain View schools – this home has it all! Offered at $3,250,000

Jim Nappo Jimmy Nappo Alain Pinel Realtors – Los Altos Alain Pinel Realtors – Los Altos Cell - 650-906-5775 Cell - 650-861-7661 email: [email protected] email: [email protected] website: www.nappo.com website: www.nappo.com

24 Q Mountain View Voice Q MountainViewOnline.com Q July 7, 2017