Systems-Level Identification of PKA-Dependent Signaling In
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Mechanism of CREB Recognition and Coactivation by the CREB-Regulated Transcriptional Coactivator CRTC2
Mechanism of CREB recognition and coactivation by the CREB-regulated transcriptional coactivator CRTC2 Qianyi Luoa, Kristin Visteb, Janny Concha Urday-Zaaa, Ganesan Senthil Kumara, Wen-Wei Tsaib, Afsaneh Talaia, Kelly E. Mayoa, Marc Montminyb,1, and Ishwar Radhakrishnana,1 aDepartment of Molecular Biosciences, Northwestern University, Evanston, IL 60208; and bClayton Foundation Laboratories for Peptide Biology, Salk Institute for Biological Studies, La Jolla, CA 92037 Contributed by Marc Montminy, November 2, 2012 (sent for review October 8, 2012) Basic leucine zipper (bZip) transcription factors regulate cellular program (10). Sequestered in the cytoplasm under feeding con- gene expression in response to a variety of extracellular signals ditions through phosphorylation by the Ser/Thr kinase SIK2, and nutrient cues. Although the bZip domain is widely known to CRTC2 is dephosphorylated in response to pancreatic glucagon play significant roles in DNA binding and dimerization, recent during fasting, when it translocates to the nucleus and stimulates studies point to an additional role for this motif in the recruitment gluconeogenic gene expression. of the transcriptional apparatus. For example, the cAMP response Recent studies support a conserved role for CRTCs through evolution. Deletion of TORC, the single CRTC homolog in Dro- element binding protein (CREB)-regulated transcriptional coacti- sophila, reduces fat stores and increases sensitivity to starvation vator (CRTC) family of transcriptional coactivators has been pro- (11). CRTCs also seem to be important in aging: RNAi-mediated posed to promote the expression of calcium and cAMP responsive depletion of CRTC1 in Caenorhabditis elegans extends lifespan, in genes, by binding to the CREB bZip in response to extracellular part through down-regulation of the CREB pathway (12). -
W Yang Et Al. Proteomic Approaches to the Analysis of Multiprotein
832 DOI 10.1002/pmic.200700650 Proteomics 2008, 8, 832–851 REVIEW Proteomic approaches to the analysis of multiprotein signaling complexes Wei Yang1, 2, Hanno Steen3 and Michael R. Freeman1, 2 1 The Urological Diseases Research Center, Department of Urology, Children’s Hospital Boston, Boston, MA, USA 2 Departments of Surgery, Biological Chemistry and Molecular Pharmacology, Harvard Medical School, Boston, MA, USA 3 Department of Pathology, Harvard Medical School and Children’s Hospital Boston, Boston, MA, USA Signal transduction is one of the most active fields in modern biomedical research. Increasing Received: July 9, 2007 evidence has shown that signaling proteins associate with each other in characteristic ways to Revised: October 23, 2007 form large signaling complexes. These diverse structures operate to boost signaling efficiency, Accepted: October 23, 2007 ensure specificity and increase sensitivity of the biochemical circuitry. Traditional methods of protein analysis are inadequate to fully characterize and understand these structures, which are intricate, contain many components and are highly dynamic. Instead, proteomics technologies are currently being applied to investigate the nature and composition of multimeric signaling complexes. This review presents commonly used and potential proteomic methods of analyzing diverse protein complexes along with a discussion and a brief evaluation of alternative ap- proaches. Challenges associated with proteomic analysis of signaling complexes are also dis- cussed. Keywords: Cross-linking / Mass spectrometry / Post-translational modification / Quantitative proteomics / Signaling complexes 1 Introduction 1980s, astonishingly rapid progress has been made in understanding the mechanisms of signal transduction. The modern field of cell signaling can be traced back to the Many old concepts have been abandoned or revised and mid-1950s, when it was discovered that reversible phospho- new ones have emerged. -
Genome-Wide Regulatory Roles of the C2H2-Type Zinc Finger Protein
www.nature.com/scientificreports OPEN Genome-wide Regulatory Roles of the C2H2-type Zinc Finger Protein ZNF764 on the Glucocorticoid Received: 09 June 2016 Accepted: 23 December 2016 Receptor Published: 31 January 2017 Abeer Fadda1, Najeeb Syed2, Rafah Mackeh1, Anna Papadopoulou3, Shigeru Suzuki3,4, Puthen V. Jithesh2 & Tomoshige Kino1,3 The C2H2-type zinc finger protein ZNF764 acts as an enhancer for several steroid hormone receptors, and haploinsufficiency of this gene may be responsible for tissue resistance to multiple steroid hormones including glucocorticoids observed in a patient with 16p11.2 microdeletion. We examined genome-wide regulatory actions of ZNF764 on the glucocorticoid receptor (GR) in HeLa cells as a model system. ZNF764- and GR-binding sites demonstrated similar distribution in various genomic features. They positioned predominantly around 50–500 kbs from the transcription start sites of their nearby genes, and were closely localized with each other, overlapping in ~37% of them. ZNF764 demonstrated differential on/off effects on GR-binding and subsequent mRNA expression: some genes were highly dependent on the presence/absence of ZNF764, but others were not. Pathway analysis revealed that these 3 gene groups were involved in distinct cellular activities. ZNF764 physically interacted with GR at ligand-binding domain through its KRAB domain, and both its physical interaction to GR and zinc finger domain appear to be required for ZNF764 to regulate GR transcriptional activity. Thus, ZNF764 is a cofactor directing GR transcriptional activity toward specific biologic pathways by changing GR binding and transcriptional activity on the glucocorticoid-responsive genes. Steroid hormones exert diverse physiologic functions and play central roles in human physiology1,2. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
HCC and Cancer Mutated Genes Summarized in the Literature Gene Symbol Gene Name References*
HCC and cancer mutated genes summarized in the literature Gene symbol Gene name References* A2M Alpha-2-macroglobulin (4) ABL1 c-abl oncogene 1, receptor tyrosine kinase (4,5,22) ACBD7 Acyl-Coenzyme A binding domain containing 7 (23) ACTL6A Actin-like 6A (4,5) ACTL6B Actin-like 6B (4) ACVR1B Activin A receptor, type IB (21,22) ACVR2A Activin A receptor, type IIA (4,21) ADAM10 ADAM metallopeptidase domain 10 (5) ADAMTS9 ADAM metallopeptidase with thrombospondin type 1 motif, 9 (4) ADCY2 Adenylate cyclase 2 (brain) (26) AJUBA Ajuba LIM protein (21) AKAP9 A kinase (PRKA) anchor protein (yotiao) 9 (4) Akt AKT serine/threonine kinase (28) AKT1 v-akt murine thymoma viral oncogene homolog 1 (5,21,22) AKT2 v-akt murine thymoma viral oncogene homolog 2 (4) ALB Albumin (4) ALK Anaplastic lymphoma receptor tyrosine kinase (22) AMPH Amphiphysin (24) ANK3 Ankyrin 3, node of Ranvier (ankyrin G) (4) ANKRD12 Ankyrin repeat domain 12 (4) ANO1 Anoctamin 1, calcium activated chloride channel (4) APC Adenomatous polyposis coli (4,5,21,22,25,28) APOB Apolipoprotein B [including Ag(x) antigen] (4) AR Androgen receptor (5,21-23) ARAP1 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 (4) ARHGAP35 Rho GTPase activating protein 35 (21) ARID1A AT rich interactive domain 1A (SWI-like) (4,5,21,22,24,25,27,28) ARID1B AT rich interactive domain 1B (SWI1-like) (4,5,22) ARID2 AT rich interactive domain 2 (ARID, RFX-like) (4,5,22,24,25,27,28) ARID4A AT rich interactive domain 4A (RBP1-like) (28) ARID5B AT rich interactive domain 5B (MRF1-like) (21) ASPM Asp (abnormal -
The Essential Role of the Crtc2-CREB Pathway in Β Cell Function And
The Essential Role of the Crtc2-CREB Pathway in β cell Function and Survival by Chandra Eberhard A thesis submitted to the School of Graduate Studies and Research in partial fulfillment of the requirements for the degree of Masters of Science in Cellular and Molecular Medicine Department of Cellular and Molecular Medicine Faculty of Medicine University of Ottawa September 28, 2012 © Chandra Eberhard, Ottawa, Canada, 2013 Abstract: Immunosuppressants that target the serine/threonine phosphatase calcineurin are commonly administered following organ transplantation. Their chronic use is associated with reduced insulin secretion and new onset diabetes in a subset of patients, suggestive of pancreatic β cell dysfunction. Calcineurin plays a critical role in the activation of CREB, a key transcription factor required for β cell function and survival. CREB activity in the islet is activated by glucose and cAMP, in large part due to activation of Crtc2, a critical coactivator for CREB. Previous studies have demonstrated that Crtc2 activation is dependent on dephosphorylation regulated by calcineurin. In this study, we sought to evaluate the impact of calcineurin-inhibiting immunosuppressants on Crtc2-CREB activation in the primary β cell. In addition, we further characterized the role and regulation of Crtc2 in the β cell. We demonstrate that Crtc2 is required for glucose dependent up-regulation of CREB target genes. The phosphatase calcineurin and kinase regulation by LKB1 contribute to the phosphorylation status of Crtc2 in the β cell. CsA and FK506 block glucose-dependent dephosphorylation and nuclear translocation of Crtc2. Overexpression of a constitutively active mutant of Crtc2 that cannot be phosphorylated at Ser171 and Ser275 enables CREB activity under conditions of calcineurin inhibition. -
PRMT5 Modulates the Metabolic Response to Fasting Signals
PRMT5 modulates the metabolic response to fasting signals Wen-Wei Tsaia, Sherry Niessenb, Naomi Goebela, John R. Yates IIIb, Ernesto Guccionec,d, and Marc Montminya,1 aThe Clayton Foundation Laboratories for Peptide Biology, Salk Institute, La Jolla, CA 92037; bDepartment of Chemical Physiology, The Scripps Research Institute, La Jolla, CA 92037; cInstitute of Molecular and Cell Biology, Proteos, Singapore 138673; dDepartment of Biochemistry, Yong Loo Lin School of Medicine, National University of Singapore, Singapore 119074 Contributed by Marc Montminy, March 11, 2013 (sent for review February 20, 2013) Under fasting conditions, increases in circulating glucagon maintain sites. The results provide a mechanism to explain how latent cy- glucose balance by promoting hepatic gluconeogenesis. Triggering toplasmic regulators such as CRTC2 may contribute to signaling of the cAMP pathway stimulates gluconeogenic gene expression in the nucleus through their association with chromatin mod- through the PKA-mediated phosphorylation of the cAMP response ifying enzymes. element binding (CREB) protein and via the dephosphorylation of the latent cytoplasmic CREB regulated transcriptional coactivator 2 Results (CRTC2). CREB and CRTC2 activities are increased in insulin resis- In mass spectroscopy studies using epitope-tagged CRTC2 to tance, in which they promote hyperglycemia because of constitu- identify relevant interacting proteins, we recovered the protein tive induction of the gluconeogenic program. The extent to which arginine methyltransferase 5 (PRMT5) (Fig. S1 A and B). We CREB and CRTC2 are coordinately up-regulated in response to glu- confirmed the CRTC2:PRMT5 interaction in coimmunopreci- cagon, however, remains unclear. Here we show that, following its pitation studies with epitope-tagged proteins (Fig. -
PV3320 Certificate of Analysis for Lot 1322684A
Certificate of Analysis MAPK8 (JNK1), Inactive , 100 µg Mitogen-activated Protein Kinase 8 (MAP), Inactive, Histidine-tagged Part Number: PV3320 5781 Van Allen Way Lot Number: 1322684A Carlsbad, CA 92008 Immediate Storage: -80°C Phone: 760.603.7200 Shipping Conditions: dry ice www.thermofisher.com Description: Storage and Handling: Recombinant human full-length protein, inactive, Histidine-tagged, Store at -80°C. At first use, aliquot and store at -80°C to avoid multiple expressed in insect cells. freeze-thaws. If properly stored at -80°C, this product is guaranteed for 6 Specific Activity: months from date of purchase. Approximately 2% activity as compared to the active form of the kinase. Storage Buffer: 50 mM Tris (pH 7.5), 150 mM NaCl, 0.5 mM EDTA, 0.05% Triton® X–100, Can be activated by the upstream kinase MAP2K7, mutant. 2 mM DTT and 50% Glycerol. Concentration: 0.87 mg/mL total protein as measured using the Bradford protein assay with BSA as a standard. Calculated 18,300 nM. Aliases: JNK, JNK1, SAPK1 QUALITY ASSURANCE Activation Test: Gel Information for MAPK8 (JNK1), Inactive The coupled MAPK8 activation assay uses active MAP2K7, mutant to Page Description: The SDS- phosphorylate ATF2 substrate. The assay was setup in two states: 1st PAGE and/or Native PAGE MAPK8 phosphorylation by MAP2K7, mutant without 32P-ATP; and 2nd were run on 4-20% Tris-Glycine ATF2 substrate phosphorylation by activated MAPK8 in the presence of Novex® gels (Catalog #: 32P-ATP. The basal activity of MAPK8 was also assayed in the absence of EC6025BOX). MAP2K7, mutant. Lane 1: Invitrogen™ BenchMark™ Protein Ladder (Catalog #: 10747-012). -
LIM and Cysteine-Rich Domains 1 (LMCD1) Regulates Skeletal Muscle Hypertrophy, Calcium Handling, and Force Duarte M
Ferreira et al. Skeletal Muscle (2019) 9:26 https://doi.org/10.1186/s13395-019-0214-1 RESEARCH Open Access LIM and cysteine-rich domains 1 (LMCD1) regulates skeletal muscle hypertrophy, calcium handling, and force Duarte M. S. Ferreira1, Arthur J. Cheng2,3, Leandro Z. Agudelo1,4, Igor Cervenka1, Thomas Chaillou2,5, Jorge C. Correia1, Margareta Porsmyr-Palmertz1, Manizheh Izadi1,6, Alicia Hansson1, Vicente Martínez-Redondo1, Paula Valente-Silva1, Amanda T. Pettersson-Klein1, Jennifer L. Estall7, Matthew M. Robinson8, K. Sreekumaran Nair8, Johanna T. Lanner2 and Jorge L. Ruas1* Abstract Background: Skeletal muscle mass and strength are crucial determinants of health. Muscle mass loss is associated with weakness, fatigue, and insulin resistance. In fact, it is predicted that controlling muscle atrophy can reduce morbidity and mortality associated with diseases such as cancer cachexia and sarcopenia. Methods: We analyzed gene expression data from muscle of mice or human patients with diverse muscle pathologies and identified LMCD1 as a gene strongly associated with skeletal muscle function. We transiently expressed or silenced LMCD1 in mouse gastrocnemius muscle or in mouse primary muscle cells and determined muscle/cell size, targeted gene expression, kinase activity with kinase arrays, protein immunoblotting, and protein synthesis levels. To evaluate force, calcium handling, and fatigue, we transduced the flexor digitorum brevis muscle with a LMCD1-expressing adenovirus and measured specific force and sarcoplasmic reticulum Ca2+ release in individual fibers. Finally, to explore the relationship between LMCD1 and calcineurin, we ectopically expressed Lmcd1 in the gastrocnemius muscle and treated those mice with cyclosporine A (calcineurin inhibitor). In addition, we used a luciferase reporter construct containing the myoregulin gene promoter to confirm the role of a LMCD1- calcineurin-myoregulin axis in skeletal muscle mass control and calcium handling. -
MAP2K7 Monoclonal Antibody (M04), Clone 2G5
MAP2K7 monoclonal antibody (M04), clone 2G5 Catalog # : H00005609-M04 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Transfected lysate) Description: MAP2K7. Immunogen: MAP2K7 (NP_660186, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLAND GGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEI enlarge Host: Mouse Western Blot (Recombinant protein) Reactivity: Human Immunohistochemistry Isotype: IgG1 Kappa (Formalin/PFA-fixed paraffin- embedded sections) Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Immunofluorescence Western Blot detection against Immunogen (36.63 KDa) . enlarge Storage Buffer: In 1x PBS, pH 7.4 ELISA In situ Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Proximity Ligation Assay (Cell) Instruction: MSDS: Download Datasheet: Download Applications enlarge Western Blot (Transfected lysate) Page 1 of 3 2016/5/21 Western Blot analysis of MAP2K7 expression in transfected 293T cell line by MAP2K7 monoclonal antibody (M04), clone 2G5. Lane 1: MAP2K7 transfected lysate(47.485 KDa). Lane 2: Non-transfected lysate. Protocol Download Western Blot (Recombinant protein) Protocol Download Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlarge this image Immunoperoxidase of monoclonal antibody to MAP2K7 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1.2 ug/ml] Protocol Download Immunofluorescence enlarge this image Immunofluorescence of monoclonal antibody to MAP2K7 on HeLa cell . [antibody concentration 10 ug/ml] Protocol Download ELISA In situ Proximity Ligation Assay (Cell) Page 2 of 3 2016/5/21 Proximity Ligation Analysis of protein-protein interactions between MAPK8 and MAP2K7. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-MAP2K7 mouse monoclonal antibody 1:50. -
Convergent Evolution in the Mechanisms of ACBD3 Recruitment to Picornavirus Replication Sites
RESEARCH ARTICLE Convergent evolution in the mechanisms of ACBD3 recruitment to picornavirus replication sites 1 2 3 1 Vladimira Horova , Heyrhyoung LyooID , Bartosz Ro życkiID , Dominika Chalupska , 1 1 2¤ Miroslav Smola , Jana Humpolickova , Jeroen R. P. M. StratingID , Frank J. M. van 2 1 1 Kuppeveld *, Evzen Boura *, Martin KlimaID * 1 Institute of Organic Chemistry and Biochemistry, Czech Academy of Sciences, Prague, Czech Republic, 2 Faculty of Veterinary Medicine, Utrecht University, Utrecht, The Netherlands, 3 Institute of Physics, Polish a1111111111 Academy of Sciences, Warsaw, Poland a1111111111 a1111111111 ¤ Current address: Viroclinics Biosciences, Rotterdam, The Netherlands a1111111111 * [email protected] (FJMvK); [email protected] (EB); [email protected] (MK) a1111111111 Abstract Enteroviruses, members of the family of picornaviruses, are the most common viral infec- OPEN ACCESS tious agents in humans causing a broad spectrum of diseases ranging from mild respiratory Citation: Horova V, Lyoo H, RoÂżycki B, Chalupska illnesses to life-threatening infections. To efficiently replicate within the host cell, enterovi- D, Smola M, Humpolickova J, et al. (2019) Convergent evolution in the mechanisms of ACBD3 ruses hijack several host factors, such as ACBD3. ACBD3 facilitates replication of various recruitment to picornavirus replication sites. PLoS enterovirus species, however, structural determinants of ACBD3 recruitment to the viral rep- Pathog 15(8): e1007962. https://doi.org/10.1371/ lication sites are poorly understood. Here, we present a structural characterization of the journal.ppat.1007962 interaction between ACBD3 and the non-structural 3A proteins of four representative Editor: George A. Belov, University of Maryland, enteroviruses (poliovirus, enterovirus A71, enterovirus D68, and rhinovirus B14). -
Inhibition of ERK 1/2 Kinases Prevents Tendon Matrix Breakdown Ulrich Blache1,2,3, Stefania L
www.nature.com/scientificreports OPEN Inhibition of ERK 1/2 kinases prevents tendon matrix breakdown Ulrich Blache1,2,3, Stefania L. Wunderli1,2,3, Amro A. Hussien1,2, Tino Stauber1,2, Gabriel Flückiger1,2, Maja Bollhalder1,2, Barbara Niederöst1,2, Sandro F. Fucentese1 & Jess G. Snedeker1,2* Tendon extracellular matrix (ECM) mechanical unloading results in tissue degradation and breakdown, with niche-dependent cellular stress directing proteolytic degradation of tendon. Here, we show that the extracellular-signal regulated kinase (ERK) pathway is central in tendon degradation of load-deprived tissue explants. We show that ERK 1/2 are highly phosphorylated in mechanically unloaded tendon fascicles in a vascular niche-dependent manner. Pharmacological inhibition of ERK 1/2 abolishes the induction of ECM catabolic gene expression (MMPs) and fully prevents loss of mechanical properties. Moreover, ERK 1/2 inhibition in unloaded tendon fascicles suppresses features of pathological tissue remodeling such as collagen type 3 matrix switch and the induction of the pro-fbrotic cytokine interleukin 11. This work demonstrates ERK signaling as a central checkpoint to trigger tendon matrix degradation and remodeling using load-deprived tissue explants. Tendon is a musculoskeletal tissue that transmits muscle force to bone. To accomplish its biomechanical function, tendon tissues adopt a specialized extracellular matrix (ECM) structure1. Te load-bearing tendon compart- ment consists of highly aligned collagen-rich fascicles that are interspersed with tendon stromal cells. Tendon is a mechanosensitive tissue whereby physiological mechanical loading is vital for maintaining tendon archi- tecture and homeostasis2. Mechanical unloading of the tissue, for instance following tendon rupture or more localized micro trauma, leads to proteolytic breakdown of the tissue with severe deterioration of both structural and mechanical properties3–5.