LILLSTREET ART CENTER 10-Week Classes Begin September 14. 5-Week Classes Begin September 14 & October 19. FALL CATALOGUE

save ly and ear up n- ig Pay in full by S August 31 and receive $20 off your 10-week class and $10 off your 5-week class.

CONTENTS

First-Time Artist 3 Ceramics 4 Metalsmithing 6 & Jewelry Painting & Drawing 8 Kidstreet Special Section 11 Policies & Procedures 14 Glass 15 Printmaking 16 Textiles 18 Full Schedule 22 REGISTER TODAY! Gallery Information 24 VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 THIS IS YOUR ART CENTER When you take a class as Lillstreet Art Center, you'll enjoy professional instruction from our outstanding faculty. But being a student here means so much more. Many of your materials are included in your class fee, you'll have access to our facilities during generous open studio hours, and you'll be part of a unique community of artists sharing experiences and techniques with one another. You won't find a better value!

Pay in full by August 31 and receive $20 off your 10-week class and $10 off your 5-week class.

Book Your Holiday Party Here! Create a memorable event at Lillstreet. Choose from casual cocktail hours in the gallery, to hands-on workshops with projects to take home. Bring in your own caterer or select from First Slice's delicious options. Evenings and weekends available. Call 773-769-4226 for details.

FIRST SLICE PIE CAFE‘ Stop by First Slice Pie Cafe before or after your class! Enjoy a cup of coffee with your friends, a quick snack, or a complete meal, and support this great nonprofit organization that helps fight hunger while satisfying yours.

MEMBERSHIP BENEFITS Be a part of the Lillstreet Community by becoming a member today. You will join a supportive and friendly art community and have access to all the great benefits listed below:

Household Membership: $75/ year (for 2 people) Artist Membership: $40/ year Receive all the benefits of an Artist Membership plus: • Discounts on classes and workshops • Attend an available workshop and receive a 2-for-1 offer (one per year) • VIP membership card • Members’ price on children’s camps (for 2 people) • Discounts at participating art supply stores and other community services Family Membership: $110/ year (for 3 or more people) • Invitations to exciting and unique workshops and events Receive all of the benefits above plus: • Free gift • One free family workshop per year, subject to availability • 10% off of gallery purchases • Member’s price on children’s camps (entire family)

Please note that the membership discounts only apply to the person or people whose names are on the membership card.

2 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) FIRST-TIME ARTIST Explore a new medium in a no-pressure environment. Each of our adult departments offers five-week introductory classes for beginning students with no previous experience. Unleash your creativity!

FIRST-TIME POTTER FIRST-TIME GLASS FIRST-TIME FIRST-TIME SEWING A five-week introductory sampler: BEADMAKING SCREENPRINTING ON Learn how to operate and control try your hand at a variety of clay Make beautiful glass beads using FABRIC a sewing machine, and the basics techniques. You’ll have fun learning basic techniques for shaping and Prepare a screen, shoot, and of materials and construction. the basics of handbuilding and decorating with twisties, dots, finally print an image on cloth. Work on two projects from start to wheelthrowing before you choose and stringers. A $30 materials fee Most materials provided, students finish. Machines and materials are your focus. Includes 12 lbs. of clay. includes assorted colors of glass provide their own ink and cloth provided. and mandrels. Closed-toe shoes after first night. Tuesday 1:30-4:30pm Tuesday 2-5pm required. Saturday classes are Mary Drabik Monday 10am-1pm Amy White open to ages 14 and up. Session I: Starts September 15 Andrea Myers Session I: Starts September 15 Session II: Starts October 20 Monday 6:30-9:30pm Session I: Starts September 14 Session II: Starts October 20 John Landin Session II: Starts October 19 Thursday 6:30-9:30pm Thursday 6:30-9:30pm Session I: Starts September 14 Les Orenstein Thursday 6:30-9:30pm Amy White Session II: Starts October 19 Session I: Starts September 17 Camille Canales Session I: Starts September 17 Session II: Starts October 22 Thursday 2-5pm Session I: Starts September 17 Session II: Starts October 22 Sunday 10am-1pm Judy Zeddies Session II: Starts October 22 LAC Members $160 Session I: Starts September 17 Chris Chaney Wednesday 2-5pm Non-members $165 Session II: Starts October 22 Session I: Starts September 20 Andrea Myers Session II: Starts October 25 Saturday 10am-1pm Session I: Starts September 16 FIRST-TIME PAINTER LAC Members $160 Jenny Sider Session II: Starts October 21 Session I: Starts September 19 You’ll be introduced to line, value Non-members $165 LAC Members $160 Session II: Starts October 24 and color using charcoal and Non-members $165 paint. Expect to work from still life FIRST-TIME LAC Members $160 as well as abstractly. All materials Non-members $165 SCREENPRINTING ON PAPER FIRST-TIME KNITTING provided. Prepare a screen and print an Learn to knit, purl, work in the Monday 6:30-9:30pm image on paper using stencils and FIRST-TIME JEWELER round, rib, cast on, bind off, Annie Davis photo-emulsion. Most equipment Sample basic skills including decrease, and fix mistakes while Session I: Starts September 14 and inks provided. Students supply saw piercing, texturing, cold making a scarf and a hat. Session II: Starts October 19 their own paper after the first night. connections, and a soldering a Tuesday 10am-1pm Saturday 10am-1pm Dress for mess. band ring. Most materials included. Patrick Miceli Meryl Kleiman Silver and additional materials may Session I: Starts September 15 Saturday 10am-1pm Session I: Starts September 19 be purchased from the instructor. Session II: Starts October 20 Tom Lucas Session II: Starts October 24 Session I: Starts September 19 Wednesday 6:30-9:30pm Thursday 6:30-9:30pm Sunday 10am-1pm Session II: Starts October 24 Molly Schafer Tamra Gentry Lisa Whiting Session I: Starts September 16 Sunday 5-8pm Session I: Starts September 17 Session I: Starts September 20 Session II: Starts October 21 Matt Ginsberg Session II: Starts October 22 Session II: Starts October 25 Session I: Starts September 20 Sunday 10am-1pm Friday 10am-1pm LAC Members $160 Session II: Starts October 25 Steve Amos Judy O’Connell Non-members $165 Session I: Starts September 14 LAC Members $160 Session I: Starts September 18 Session II: Starts October 19 Non-members $165 Session II: Starts October 23 FIRST-TIME DRAWING Sunday 2-5pm LAC Members $160 Steve Amos Non-members $165 Work from still life to learn line, value and how to find proportions Session I: Starts September 20 using charcoal. All materials Session II: Starts October 25 Save 10% with our Collaborator's Discount. Just tell your friends to mention provided. LAC Members $160 that you referred them when they register for a class, and we'll discount Monday 6:30-9:30pm Non-members $165 your next class. Got lots of friends? Earn an additional 10% off for every Steve Amos person that takes a class through your recommendation. Session I: Starts September 14 Session II: Starts October 19

Saturday 10am-1pm Tony Porter Session I: Starts September 19 Session II: Starts October 24 LAC Members $160 Non-members $165

REGISTER TODAY! VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 3 CERAMICS Lillstreet’s long-established clay department offers classes for all skill levels in wheelthrowing, handbuilding, and sculpture. Advanced students can fine-tune their work or experiment with soda firing. Take advantage of over 200 glaze combinations, firing, and state-of-the-art equipment in our generous open studio hours--included with all classes! Beginner/ Advanced BEGINNING/ SURVEY OF PRINTMAKING FUSION: Handbuilding and Beginner ADVANCED BEGINNING TECHNIQUES ON CLAY Wheelthrowing WHEELTHROWING The first weeks of this beginning- Make functional or sculptural Explore the mystery of the potter’s level class will be spent in the ceramic forms by throwing and/ or FIRST-TIME POTTER wheel as you develop the funda- Printmaking Department to handbuilding. Experiment in both (5 weeks) mental techniques of throwing a learn techniques such as relief, functional and sculptural directions A five-week introductory sampler: pot. Learn to center, throw, and trim lithography and screenprinting working with thrown cylinders, try your hand at a variety of clay a variety of functional forms includ- on clay. Then we’ll move to the slabs, and coils. Try various exterior techniques. You’ll have fun learning ing cups, bowls, and plates. Embel- Ceramics Department and use expression such as altering, the basics of handbuilding and lish the surface of your work with different slips, stains and glazes faceting, carving, inlaying, and wheelthrowing before you choose slips, washes, glazes, and applied to apply those techniques to painting. This course will have class your focus. Includes 12 lbs. of clay. elements. Move at your own pace. greenware. A materials list discussions, slide presentations, Tuesday 1:30-4:30pm Returning students will continue to will be provided the first day of and demonstrations such as Mary Drabik refine technique and create more class. Includes access to both throwing, handbuilding and surface Session I: Starts September 15 complex forms. the Ceramic and Printmaking decorations. Departments facilities. Session II: Starts October 20 Monday 6:30-9:30pm Wednesday 7-10pm Thursday 6:30-9:30pm Chris Chaney Thursday 6:30-9:30pm Yong Hyun Chung Les Orenstein Starts September 14 Tom Lucas Starts September 16 Starts September 17 Session I: Starts September 17 Tuesday 7-10pm LAC Members $350 Session II: Starts October 22 Gary Jackson LAC Members $350 Non-members $360 Sunday 10am-1pm Starts September 15 Non-members $360 Chris Chaney Wednesday 10am-1pm HOME & GARDEN POTTERY Session I: Starts September 20 Karen Avery HOME ACCENTS: Serving This intermediate-to-advanced Session II: Starts October 25 Starts September 16 Dishes and Casseroles class will use stoneware for LAC Members $160 Wednesday 7-10pm Few things are as rewarding as functional forms and terra cotta for Non-members $165 David and Sharon Hartshorne serving food to family and friends the garden. Demonstrations will Starts September 16 in pottery you have made with your include throwing tableware, large BEGINNING/ INTERMEDIATE Thursday 10am-1pm own two hands. Make casseroles, sectional urns, and handbuilding HANDBUILDING Lorin Klein Costolo platters, or centerpiece serving planters. Beginning handbuilders Starts September 17 bowls as you throw bigger, wider, are welcome. Learn creative ways of working and taller. Learn how handles Saturday 10am-1pm Monday 1:30-4:30pm with slabs, coils and pinching to compliment the form. Prerequisite: Catherine Tweedie Karen Avery create virtually any form you can Intermediate Wheelthrowing. dream up. Experiment with a wide Starts September 19 Starts September 14 range of color and texture using Sunday 2-5pm Monday 7-10pm LAC Members $350 slips, stains and glazes on your David Trost Karen Avery Non-members $360 functional or sculptural artworks. Starts September 20 Starts September 14 This class is appropriate for all skill LAC Members $310 LAC Members $350 levels. Non-members $360 All classes are Non-members $320 10-weeks unless Tuesday 1:30-4:30pm Lisa Harris DREAMS, MYTHS AND otherwise noted. Starts September 15 Multilevel STORIES Sunday 10am-1pm Students will identify and discuss Glynnis Lessing dreams, narratives, and symbols Starts September 20 CERAMIC TILES important to their lives and LAC Members $330 Design and produce tiles using experiment with ways to represent Non-members $340 patterning, carved relief, molds, them in clay. Basic handbuilding and stamps. We’ll discuss technique will be taught. Dialogue Dress for Mess sculptural verses painting among class members at each Open Studio techniques on both decorative and stage of the process will enrich the Take advantage of our functional tiles. overall experience. generous open studio time. Come in 12 hours per day, 7 Thursday 7-10pm Monday 7-10pm days per week! Mike Skiersch Corinne Peterson Starts September 17 Starts September 14 LAC Members $350 LAC Members $350 Non-members $360 Non-members $360

4 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) CERAMICS

techniques using of clay sculpting tools, clay hollowing, and firing techniques. We will study basic human anatomy and proportion while working with a live model. Wednesday 6:30-9:30pm Vincent Hawkins Starts September 16 LAC Members $380 Non-members $390 by glaze. Tuesday 6:30-9:30pm Tom Lucas Session I: Starts September 15 Session II: Starts October 20 (B) Direct and Indirect Screenprinting on Clay In the direct process, images are printed on flat slabs then clay works can be made afterwards. With the indirect method, we print onto paper first then transfer the images to clay. Both techniques offer an infinite range of image, pattern and color possibilities utilizing slips and glazes on top of the print. We will focus on hand cut stencils and photo-emulsion. The techniques work best on greenware, but there are developing approaches on bisque. Saturday 2-5pm Tom Lucas Session I: Starts September 19 Session II: Starts October 24 LAC Members $350 Non-members $360 FIGURE SCULPTURE Learn classical figure sculpture NEW! THE CERAMIC PRINT:Mix and Match Classes For intermediate-to-advanced students who have taken printmaking and/ or ceramics. You choose two five-week class sessions (A and/ or B) in the order of your choice, to customize your experience. Take one of each or two of the same. Classes include access to both the Ceramic and Printmaking Departments facilities. (A) Lithographic Transfer Decal, Relief and Texture on Clay Specifically for the greenware stage, these techniques utilize specially mixed oil-based ceramic ink that allows you to print on flat clay slabs or tiles as well as vessels and sculptural forms. With Relief printing, you will carve into linoleum plate, Styrofoam or PVC in order to print onto clay. Explore a wide range of color using slips combined with printing, followed

VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 5 Students whomore have sessions taken enrolltwo of orSoda in any Firingpay ceramics themay $60 class labwork feeand soda to havefiredavailable). their(no Member Studentsshare price the are loading requiredthe soda and tokiln. unloading of TECHNIQUES This is a free-form figure class with emphasis on experimentation. The focus will be on working from nature and contemporary themes. We will explore the use of different clay bodies and handbuilding techniques and work with a live model. Thursday 10am-1pm Vincent Hawkins Starts September 17 LAC Members $380 Non-members $390 TEA AND SODA Learn about the function and creation of tea-related accessories. We will examine both Eastern and Western teapots and the teas brewed with them, while utilizing the soda firing process. Intermediate-to-advanced. Thursday 6:30-9:30pm Chris Chaney Starts September 17 Soda Firing Lab Fee: $60 LAC Members $350 Non-members $360 ADVANCED HANDBUILDING Build upon handbuilding principles to produce more complex and varied objects and functional wares. Special attention will be paid to refining handbuilding techniques to better implement your artistic vision of form, function, and surface treatment. Both potters and sculptors are welcome. Wednesday 10am-1pm Momoko Usami Starts September 16 Wednesday 6:30-9:30pm David Trost Starts September 16 Saturday 10am-1pm Momoko Usami Starts September 19 LAC Members $350 Non-members $360 FIGURE SCULPTURE

REGISTER TODAY!

sigilata, and glazes to create work that pushes the limits of clay. A willingness to experiment is a key component of the class, and all experience levels are welcome. Monday 6:30-9:30pm David Trost Starts September 14 LAC Members $350 Non-members $360 ADVANCED TOPICS Fine tune your work. Research a topic such as historical period pottery, glaze testing and surface treatments, handles and additions, lidded forms, etc. Saturday 10am-1pm Lisa Harris Starts September 19 LAC Members $350 Non-members $360 LOW FIRE GLAZE Use slips, underglazes, terra This class will concentrate on developing a place setting. Demos will cover traditional place setting components as well as salt and pepper and cream and sugar sets. Developing and articulating one’s own style through their forms and surfaces will be emphasized. All demonstrations are wheel-based. Tuesday 7-10pm Katie Biderbost Starts September 15 LAC Members $350 Non-members $360 Super-Size Me Create larger pieces using brain and brawn. Projects include platters, stacked vases and bowls using multiple pieces. Students should bring a small hairdryer to speed up drying. Thursday 10am-1pm Lisa Harris Starts September 17 LAC Members $350 Non-members $360 SURFACE INVESTIGATIONS:Anatomy of a Place Setting FORM AND SURFACE:

LAC Members $350 Non-members $360 Starts September 15 Saturday 10am-1pm David Trost Starts September 19 Starts September 15 Tuesday 6:30-9:30pm Karen Avery Prerequisite: two sessions of Beginning Wheelthrowing. Tuesday 10am-1pm Lisa Harris Throw taller and bigger with nuance. Try more advanced glazing techniques. Learn to look at your work for function and visual poise. INTERMEDIATE WHEELTHROWING the soda kiln. Intermediate/ Advanced pay the $60 labwork fee soda to havefiredavailable). their(no Member Studentsshare price the are loading required and to unloading of Students whomore have sessions taken enrolltwo of orSoda in any Firing ceramics may class and Starts September 20 Soda Firing Lab Fee: $60 LAC Members $350 Non-members $360 Starts September 14 Sunday 11am-2pm Catherine Tweedie experience working with clay and permission of instructor. Monday 7-10pm Yong Hyun Chung will participate in all stages of the process: glazing, kiln loading, firing and unloading (outside of class time). Prerequisite: at least one year unpredictable results! Simply Soda will make the soda firing process very accessible and understandable. Class members different look to your work whether handbuilt or thrown. Be prepared for flashes of color, textured surfaces and the excitement of SIMPLY SODA: BeginningSoda Soda firing will create an entirely CERAMICS Non-members $35 Non-members $30 Members LAC Usami Momoko 2-4pm 11, October Saturday, wet! not but moist are they sure Make decorate. to pots greenware Bring underglazes. vs. slip and clays, three the between differences the pots, your to slip apply to times ideal the about talk will We slip. inlaid and surfaces, positive and negative explore pots, your to decoration suface Add slip. scratched is Sgraffito day) (1 SGRAFFITO $35 Non-members $30 Members LAC Usami Momoko 2-4pm 17, October Saturday, pattern. a create to slips the manipulate then color, another add wet, still it’s while and, slip base a add We’ll break. and water much too absorb will it dry, too is it If trimmed. and hard leather are that plates or bowls with prepared come should Students technique. Japanese traditional a is This day) (1 SUMINAGASHI $145 Non-members $140 Members LAC 19 September Starts Hawkins Vince 1-4pm Saturday class.) casting bronze wax lost upcoming an to prelude a as offered being is class (This notebook. a bring should Students work. cast your chasing and (coloring) patination for techniques basic Explore bronze. or copper in works art scale small decorative cast to bone cuttlefish Use weeks) (4 Casting Bone Cuttlefish I: CASTING BRONZE Workshops weeks five for $225 required. is instructor the of Permission both. to convenient time a at set mandatory; is instructor the with meeting weekly A term. the within weeks consecutive five choose You class. Potter Time First- a for overqualified are and class ten-week a for allow not does situation life whose students advanced and intermediate For FIVE CHOOSE 6 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 6

Starts September 14 September Starts Robinson Pam 6:30-9:30pm Monday fee. nominal a for caster production a to brought be can work or class in castings two do will We sculpture. miniature or charms, rings, pieces: small two complete to expect can Students modeling. for waxes soft and carving for waxes hard working of possibilities dimensional three the explore will class multilevel This CASTING AND WAX WITH WORKING $165 Non-members $160 Members LAC 23 October Starts II: Session 18 September Starts I: Session O’Connell Judy 10am-1pm Friday 22 October Starts II: Session 17 September Starts I: Session Gentry Tamra 6:30-9:30pm Thursday instructor. the from purchased be may materials additional and Silver included. materials Most ring. band a soldering and connections, cold texturing, piercing, saw including skills basic Sample JEWELER FIRST-TIME Beginner Advanced Beginner/ classrooms. jewelry and othertechniquestohelpyoucreateuniquedesignsinourfourfully-equipped Make awearablepieceofart!You’ll learnpropersawing,piercing,soldering,texturing, JEWELRY & METALSMITHING Non-members $325 Non-members $315 Members LAC 16 September Starts Robinson Pam 2-5pm Wednesday otherwise noted. otherwise 10-weeks unless unless 10-weeks All classes are are classes All

fluctuating cost of silver). Locker Locker silver). of cost fluctuating the to due change to subject (Price $40. of fee additional an for class of day first the on instructor the from purchase for available be will and course this for required is kit materials beginning A projects. three to one complete to Expect included. be will stones set bezel and techniques forming simple and covered, be will polishing and soldering, texturing, sawing, as such skills Basic brass. and copper, silver, in jewelry create and Design METALSMITHING BEGINNING Non-members $200 $200 Non-members $190 Members LAC 16 September Starts Zemans Rebecca 4-6pm Wednesday instructor. from purchased be may materials additional and Silver included. materials Some covered. be will ring band soldered a and connections cold texturing, Saw-piercing, know. already they ones the improve or metalworking basic of fundamentals the learn to want who jewelers young for designed is class This 10-14) (Ages METALS TWEEN $325 Non-members $315 Members LAC 20 September Starts Franker Susan 10am-1pm Sunday 19 September Starts Schafer Anne 10am-1pm Saturday 16 September Starts Ewoldt Darlys 6:30-9:30pm Wednesday 15 September Starts Mathes Jesse 6:30-9:30pm Tuesday 14 September Starts Kraus Neil 6:30-9:30pm Monday 14 September Starts O’Connell Judy 11am-2pm Monday session. per $10 for studio the in available rental

Tuesday 1-4pm 1-4pm Tuesday session. per $10 for studio the in available rental Locker approval. instructor or Metalsmithing Intermediate one and Beginning sessions 2-3 of Completion Prerequisite: skills. technical advanced more of development and design on Focus attention. individualized receive and projects on independently more Work METALSMITHING MULTILEVEL Multilevel Non-members $165 $165 Non-members $160 Members LAC 17 September Starts Prieto-Velasco Laura 6:30-9:30pm Thursday fee. additional an for purchase for available be will casting for Metal levels. All introduced. be will finishing and connections, cold soldering, Basic piece. finished the personalize will introduced materials and techniques Other pendant. wearable a in used be then can castings The materials. natural of casting basic learn will students class this In weeks) (5 STONES AND STICKS $325 Non-members $315 Members LAC 15 September Starts Robinson Pam are required in the the in required are Closed-toe shoes shoes Closed-toe classroom.

METALSMITHING & JEWELRY

chokers, earrings and belts! Bring two pairs of flat-nosed pliers or purchase a set from the instructor ($18). $40 materials fee. No experience necessary. Wednesday 6:30-9:30pm Kat Wisniewski Starts September 16 LAC Members $150 Non-members $165 SILVER BEADS AND MORE(5 weeks) For those with previous metal clay experience: learn how to fabricate small, large or complex hollow fine silver forms (such as beads) using metal clay. Learn how to create and work with latex molds to reproduce small objects in fine silver. Stone-setting, embellishing and firing options will also be discussed. Silver metal clay available for purchase from instructors. Monday 6:30-9:30pm Marco Fleseri Starts October 19 LAC Members $160 Non-members $165 Chain Maille CHAIN MAILLE (5 weeks)Use jump rings and pliers to make several spiral chain and European weaves and combinations. Create non-soldered chains and flat weaves for bracelets, necklaces, JUNK IN THE TRUNK (5 weeks) Breathe life into an old piece of old costume jewelry by deconstructing and reconstructing it into something unique and contemporary. Use these components to recreate the piece based on formal decisions such as color, material and size. Value of material will take a back seat to strong design composition. Traditional techniques such as stone setting, soldering, and riveting, bonding, and chemical adhesion will be taught. Expect to make at least 3 pieces of jewelry in this class. Silver and other materials may be purchased from instructor for an additional fee. Thursday 6-9pm Laura Prieto-Velasco Starts October 22 LAC Members $160 Non-members $165

VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 7 materials included. Silver and other materials may be purchased from instructor. Tuesday 6:30-9:30pm Tamra Gentry Starts October 20 LAC Members $160 Non-members $165 ANCIENT LOOP-IN-LOOPCHAINMAKING (5 weeks) Learn the fine art of loop-in-loop chainmaking. Wrap, cut and fuse wire links, then form and weave them together to create a classically styled chain. Come the first day with a half-ounce of 22 gauge fine silver wire. Wire will also be available for purchase from instructor. Prerequisite: two sessions of Beginning Metals. Tuesday 6:30-9:30pm Tamra Gentry Starts September 15 LAC Members $160 Non-members $165 YOU GOT ME GOING IN CIRCLES (5 weeks) Explore one of the most widely used shapes in jewelry making: the circle. Come up with a variety of designs for projects using circles, including bracelets, necklaces, rings and earrings. You will be encouraged to use everything from cold-connections, basic soldering, drilling, saw piercing, metal forming and shaping. There will be a class critique at the end. Most FORGING AND FORMING:Moving Metal with Hammers Wield a hammer to coax metal into flowing lines and sensuous forms. Create new shapes for your work not easily achieved by other techniques. Forge wire or rod into linear earrings, rings, or flatware. Transform metal sheet into bracelets or even a teapot – the possibilities are endless! Prerequisite: two sessions of Beginning Metals or instructor approval. $15 materials fee. Additional materials may be purchased from the instructor. Thursday 6:30-9:30pm Darlys Ewoldt Starts September 16 LAC Members $315 Non-members $325

REGISTER TODAY!

Sarah Chapman Starts October 20 LAC Members $145 Non-members $150 texture to metal. Work with your own drawings or copyright-free designs and experiment with two techniques to photo-transfer designs. We’ll begin with “low- tech” options by using readily available etchant solutions and direct drawing methods and work up to photo etching with nitric acid solutions to etch sterling silver, brass and copper. Supply list will be discussed at the first class session. Most materials will be included. Silver and additional materials may be purchased from the instructor. Tuesday 6:30-9:30pm Sarah Chapman Starts September 16 Thursday 10am-1pm Sarah Chapman Starts September 17 Saturday 10am-1pm Pam Robinson Starts September 19 LAC Members $315 Non-members $325 ETCHING ON METAL (5 weeks) Explore exciting ways to add INTERMEDIATE METALSMITHING Working on projects that will enhance your ability to solder, create three-dimensional forms, set stones and much more! Design, craftsmanship and refining techniques will be discussed. Prerequisite: Two sessions of Beginning Metalsmithing or instructor approval. Locker rental available in the studio for $10 per session. Wednesday 6:30-9:30pm Intermediate/ Advanced

Marco Fleseri Starts September 14 LAC Members $160 Non-members $165 from $20-100 based on project/ metal chosen. Monday 6:30-9:30pm more decorative items; boxes & napkin rings. We’ll fire and finish our projects using a variety of techniques. Material fee varies the different varieties work and design options for each. Using silver, bronze or copper, students can make pendants & earrings to Intro to Metal Clays For those with or without previous metalsmithing skills, you will learn what metal clays are, how LAC Members $185 Non-members $190 YES IT’S REAL METAL: Wednesday 6:30-9:30pm Jesse Mathes Starts October 21 Silver and other materials may be purchased from instructor for an additional fee. No prior experience necessary. knitting and crocheting for jewelry or small sculpture. Finishing techniques will be discussed. Most materials included in class fee. techniques that can be adapted for metals. Using a very thin gauge wire and sheet metal, learn weaving, coiling, spool WEAVING WITH METAL (5 weeks) Survey the different fiber/ textile METALSMITHING & JEWELRY Non-members $80 Non-members $75 Members LAC 14 & 7 November Wisniewski Kat 2-5pm Saturday welcome. Beginners photographs. with instructions full-color tape, masking cabochons, semi-precious of assortment gauges, various in copper or plate silver in wire artistic metal base includes: $25 of fee Materials technique. your maximize will which tools the of overview detailed a given be and cabochons different for sizing calculate to how learn also will You pendant. cabochon elaborate an sculpt to thicknesses varying in wire, of tempers and shapes different 3 to up Use glues. or soldering tools, of lot a using without stone cabochon a Set day) (2 PENDANT CABOCHON WRAPPED WIRE $65 Non-members $60 Members LAC 25 October Gentry Tamra 11am-2pm Sunday Metals. Beginning Prerequisite: included. be will materials Most etc. scuffs, and scratches eliminating work, hammered and sawn both on edges perfecting and filing flashings, and burs eliminating disappear, seams solder making including techniques perfecting and finishing using by jewelry hand-fabricated of quality the improve to Learn day) (1 CRAFTSMANSHIP YOUR IMPROVING FOR TECHNIQUES Workshops $165 Non-members $160 Members LAC 21 October Starts Speicher Leslie 6:30-9:30pm Wednesday fee. materials $25 ($18). instructor the from set a purchase or pliers flat-nosed of pairs 2 Bring approval. instructor or Maille Chain Prerequisite: advanced. intermediate-to- For weaves! invented newly several including patches, sample 4-8 creating by possibilities weave explore thoroughly or class, in pieces 2-3 Complete Byzantine. versatile the of expertise your Expand weeks) (5 VARIATIONS BYZANTINE 8 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 8

Non-members $385 Non-members $375 Members LAC Gualtieri Jack 10am-4pm Sunday Saturday, Friday, www.zaffirojewelry.com winning designs. recognized nationallyfortheiraward andare creating granulatedjewelry years combinedexperiencein his wife,Elizabeth,haveover30 karat goldgranulation.Heand goldsmith specializinginhigh isa Jack GualtieriofZaffiro included. Metalsmithing skills.Lunchis stone. Prerequisite:Intermediate their own10x12mmcabochon student willcreatearingusing granulate in22kt.yellowgold.Each learn howtofabricate,fuse,and working atthebench.Studentswill dedicated todemonstrationsand experience, alotoftimewillbe granulation issuchahands-on technique ofgranulation.Since Focus ontheancientdecorative days) (3 GRANULATION GOLD otherwise noted. otherwise 10-weeks unless unless 10-weeks All classes are are classes All

Tuesday 10am-1pm 10am-1pm Tuesday 19 October Starts II: Session 14 September Starts I: Session Davis Annie 6:30-9:30pm Monday provided. materials All abstractly. as well as life still from work to Expect paint. and charcoal using color and value line, to introduced be You’ll PAINTER FIRST-TIME Beginner Advanced Beginner/ gouache, oils,pastels,pen&ink,orencaustictechniques. watercolor,Express yourselfintwodimensionswithacrylics, DRAWING & PAINTING Non-members $165 Non-members $160 Members LAC 24 October Starts II: Session 19 September Starts I: Session Porter Tony 10am-1pm Saturday 19 October Starts II: Session 14 September Starts I: Session Amos Steve 6:30-9:30pm Monday provided. materials All charcoal. using proportions find to how and value line, learn to life still from Work DRAWING FIRST-TIME $165 Non-members $160 Members LAC 25 October Starts II: Session 20 September Starts I: Session Amos Steve 2-5pm Sunday 19 October Starts II: Session 14 September Starts I: Session Amos Steve 10am-1pm Sunday 21 October Starts II: Session 16 September Starts I: Session Schafer Molly 6:30-9:30pm Wednesday 20 October Starts II: Session 15 September Starts I: Session Miceli Patrick

Starts September 18 September Starts Miceli Patrick 10am-1pm Friday medium. watercolor the to effects special fun, as well as representation and glazing blending, watercolor, to introduction an provide will class the beginner, the For abstracts. improvisational more and sketches fluid loose, to work representational tight, from expression of range a artist the allows that medium painting versatile a is Watercolor WATERCOLOR BEGINNING * Price includes live model live includes Price * $310 Non-members $300 Members LAC 19 September Starts Miceli Patrick 2-5pm Saturday 17 September Starts Miceli Patrick 7-10pm Thursday composition. abstract to figure, and portrait life, still from range will matter Subject texture. develop to order in applications knife palette and brush basic Learn medium. painting use and colors, mix palette, a out lay to how of basics the learn will students techniques, painting oil fundamental on Focusing Drawing. Beginning completed have who students for Recommended I PAINTING OIL $310 Non-members $300 Members LAC Dress for Mess! for Dress

PAINTING & DRAWING

* Price includes live model taken Beginning Oil, Oil Painting I, or who have similar experience. Class projects will be both traditional and contemporary approaches to painting. Monday 10am-1pm Patrick Miceli Starts September 14 LAC Members $300 Non-members $310 INTERMEDIATE AND ADVANCED WATERCOLOR For those with some experience, the class will add to the students understanding of watercolor, blending, glazing and representation as well as fun, special effects to the watercolor medium. Sunday 2-5pm Tom Dieschbourg Starts September 20 LAC Members $300 Non-members $310 Intermediate/ Advanced ACRYLIC PAINTING II This class is for those who have taken Acrylic I (or Beginning Painting). Class demonstrations will cover both traditional and contemporary approaches to painting, and the use of different products as they apply to the medium. Tuesday 6:30-9:30pm Jeriah Hildwine Starts September 15 Friday 2-5pm Jeriah Hildwine Starts September 18 LAC Members $300 Non-members $310 OIL PAINTING II This class is for those who have

VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 9 functional canvas floorcloths. We will use water-based paints and varnish exclusively. The course fee includes the canvas floorcloth material ($25 each). A complete supply list will be available two weeks prior to the start date. Sunday 2-5pm Jenny Learner Starts September 20 LAC Members $170 Non-members $175 LIFE JOURNEYS INTO JOURNALSLIFE (5 weeks) Using a variety of media, you’ll tell your story in images and words of your choosing. We’ll discuss favorite places, people and events of your journeys and organize them into your own individual “chapters”, which we’ll assemble into colorful and creative books. A complete supply list will be available two weeks prior to the start date. Sunday 2-5pm Jenny Learner Starts October 25 LAC Members $160 Non-members $165 FIGURE DRAWING This class offers an in-depth study of the human figure, stressing an understanding of anatomical structures, proportion, and tonal values. Students of all levels can explore drawing techniques in charcoal, pencil, and pastels. Learn about head lengths, construction line drawing, bone structure, and more. Please bring a newsprint pad and a drawing pencil to the first class. Thursday 6:30-9:30pm Sarah Kaiser Starts September 17 LAC Members $340 Non-members $350 PAINTED FLOORCLOTHS (5 weeks) This course will offer the step- by-step process from design concept to painting decorative and

REGISTER TODAY!

color, compositions and themes will be explored. Recommended for students who have completed beginning-level courses. Wednesday 6:30-9:30pm Melanie Brown Starts September 16 LAC Members $300 Non-members $310 advanced.* Wednesday 10am-1pm Bob Horn Starts September 16 LAC Members $340 Non-members $350 INTUITIVE PAINTING ANDDRAWING Develop your own language of mark-marking. Learn to trust your intuition while generating original ideas and expressing the unconscious. A development of equipment will be provided. Tuesday 10am-1pm Tom Lucas Starts September 15 LAC Members $290 Non-members $300 DRAWING AND PAINTING THE NUDE FIGURE Work from a model in poses scheduled for 2 weeks. Choose your medium from charcoal to pastels to oil paint, and come to the first class prepared to work in that medium. Beginner through BETWEEN PAINT AND PRINT Painters can explore the possibilities of integrating screenprinted imagery directly into the painted surface, and working with acrylic printing inks, resists and transfers to alter and organize. Expect a wide range of results utilizing texture, photography, graphics, pattern and color. We will go through the process of preparing a screen, creating different styles of stencils and photoemulsion. Screenprinting Multilevel

Non-members $175 Liz Chisholm Session I: Starts September 20 Session II: Starts October 26 LAC Members $170 Association. Credit: 15 CPDUs. Non- teachers are also welcome. Sunday 10am-1pm classroom use and student portfolio development. This class is sponsored by the Northeast Council of the Illinois Art Education traditional and contemporary. Develop teacher skills and learn to motivate students. All methods will be directly applicable to human figure. Proportion, mark making, volume, and line will be investigated through a variety of materials and techniques, both FIGURE STUDIO FOR TEACHERS (5 weeks) This studio intensive will focus on drawing the clothed and nude LAC Members $340 Non-members $350 and eventually pastels.* Saturday 10am-1pm Bob Horn Starts September 19 figure from a live model. Emphasis will be on observation, proportion, measuring, and anatomy. Students begin with charcoal, move to conté, INTRODUCTION TO FIGUREDRAWING This beginning level class provides the fundamentals of drawing the LAC Members $340 Non-members $350 Saturday 2-5pm Tony Porter Starts September 19 beginner, and the primary focus is placement and how the various facial features come into play in creating a portrait drawing. BEGINNING PORTRAIT DRAWING This course is designed for the PAINTING & DRAWING Non-members $310 Non-members $300 Members LAC 18 September Starts Learner Jenny 2-5pm Friday 16 September Starts Holmes Holly 6:30-9:30pm Wednesday medium. based wax- pigmented, this of technique age-old the with paint to how Learn it. does still Johns Jasper it. did Rivera Diego it. did Egyptians The PAINTING ENCAUSTIC $350 Non-members $340 Members LAC 14 September Starts Hildwine Jeriah 6:30-9:30pm Monday tones.* flesh of mixing the cover will day first The like. they as abstractly or academically as work may Students types. body and tones skin different on focus to row a in weeks two scheduled be will models of variety A colors. expressive with model nude the painting on focus will class This day. first the to canvas and paints oil your Bring OIL IN PAINTING FIGURE $310 Non-members $300 Members LAC 19 September Starts Miceli Patrick 10am-1pm Saturday paintings. their into wax and paste modeling pumice, as such mediums and brushes, knife, palette a collage, with Work Pollock. and Hoffman Hans Kooning, De as such modernist early of way the in painting abstract Explore PAINTING ABSTRACT $350 Non-members $340 Members LAC 19 September Starts Porter Tony 6-9pm Saturday, you. for works that etc.) pastel pencils, color (charcoal, medium a choosing in level comfort your find you help will course This seeing. of art the and techniques, shading in-depth various placement, as such drawing, portrait to approaches fundamental Learn DRAWING PORTRAIT 10 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 10

may choose personal themes themes personal choose may Students existing. refine and independently work to want who students for is course This PRACTICES STUDIO $310 Non-members $300 Members LAC 16 September Starts Horn Bob 2-5pm Wednesday Advanced. Intermediate-to- canvas. 16x20 a with oils in work to prepared class first the to Come recommended. is experience drawing and Painting skills. painting oil your improve help will context historical in projects Directed work? own your impact Manet of brushwork the or Chardin, of composition the Vermeer, of mood the Rembrandt, of lighting the can How MASTERS THE FROM LEARNING $350 Non-members $340 Members LAC 18 September Starts Horn Bob 10am-1pm Friday Advanced.* Intermediate-to- medium. your in work to prepared class first the to Come oils. or pastels in work can Students recommended. is figure the from work Previous narrative. of use the and drapery clothing, under revealed figure the depict to how Learn developed. fully be can painting a that so weeks 3 and 2 for scheduled be will Poses head. portrait the on concentrate or figure full the from Work FIGURE COSTUMED THE DRAWING AND PAINTING Non-members $310 Non-members $300 Members LAC 16 September Starts Miceli Patrick 10am-1pm Wednesday medium. of choice your in work to prepared Come interest. personal and drawings landscape, people, of images life, still photos, as such matter, subject own their and composition color, medium, of choice through

have previous experience working working experience previous have who students those for is class intermediate-to-advanced This FIGURE ADVANCED $310 Non-members $300 Members LAC 18 September Starts Horn Bob 2-5pm Friday Intermediate-to-Advanced. canvas. 16x20 a with oils in work to prepared class first the to Come figure. the to life still from subjects depict better to you enable will values and edges composition, mixing, color in Projects painting. oil to them apply to how you teach and skills observational your develop will course This paint? oil in see you what describe you do How Painting Oil Representational DESCRIPTION: OF ART THE Non-members $310 Non-members $300 Members LAC 18 September Starts Horn Bob 10am-1pm Thursday Intermediate-to-Advanced. canvas. 16x20 a with oils in work to prepared class first the to come Please painting. representational of skills core the Improve projects. individual and projects directed on work will Students equivalent. its or Masters the from Learning taken have who those painting: oil in experience previous have who students those for is class This OIL PAINTERS FOR SOLVING PROBLEM $350 Non-members $340 Members LAC 19 September Starts Horn Bob 2-5pm Saturday choice.* your of medium the in work to prepared class first the to Come developed. fully be can drawing or painting a so weeks 2 for scheduled be will Poses model. nude the from

our Painting & Drawing Drawing & Painting our Visit www.lillstreet.com for for www.lillstreet.com Visit ENCAUSTIC 101 ENCAUSTIC Workshops $165 Non-members $160 Members LAC 17 September Starts Brown Melanie 10am-1pm Thursday provided. be will materials All experience. painting prior with students for Appropriate depth. physical or emotion, light, of quality a express to used be can color how understand deeply more to reproductions and life from both paint will We hues. and tones close of ground subtle more the into delve then and charts, color paint and theory color basic with Begin it. control to how learn let’s color; a is Mud weeks) (5 MIXING COLOR * Price includes live model live includes Price * $50 Non-members $45 Members LAC Learner Jenny 10am-1pm 28, November Saturday, bookmark. a for suitable paper watercolor of panels 6” four Includes experience. hands-on for time of plenty be will There collage. and transfer, scribing, embedding, sgraffito, textures, surface monoprinting, glazing, painting, cover: Demonstrations fusing. of techniques fundamental and tools, materials, palettes, safety, encaustics, of history brief a you give will workshop This comeback! huge a making is form art ancient this why out Find more information about about information more Certificate program Certificate

KIDSTREET Young artists will build confidence and critical thinking skills while creating astounding works of art in classes for ages 2+. Holiday camps are a great way to keep learning when school’s out. And Kidstreet is a great place to hold your child’s next birthday party! Visit www.lillstreet.com for more information.

Ages 18-30 Months TODDLER CLAY & AGES 3 1/2-6 A parent or babysitter stays with MULTIMEDIA Children enjoy these classes on the child in these classes. In order Can’t decide whether to explore their own, however parents may to provide the best quality time clay or paint? In this class, we stay for the first class. Classes are with your child, we ask that you get to do both plus a lot more. limited to 10 children. refrain from bringing other children Work together and independently to class. Class size limited to 8 painting and building with clay children. and other materials. Exploration, MULTIMEDIA ART rather than the end product, is Play with lines, shapes, colors, emphasized. patterns, and textures using a COLORED TEXTURES variety of materials, such as paper, Wednesday 10-11am Soft yellow, bumpy red, and paints, Sculpey, and clay. At the Susan Tecktiel scratchy blue! In this new class same time, develop creativity, Session I: Starts September 16 we’ll discover different textures and motor skills, and self-expression. Session II: Starts October 21 WILD THINGS colors while building language, fine Wednesday 4-5:30pm Want to create your own menagerie motor skills, and creative thinking. LAC Members $75 Jen Hadland of animals, bugs, and monsters? We’ll use our hands, tools, textured Non-members $80 Session I: Starts September 16 We’ll use clay and other media to paint, and clay to create messy Session II: Starts October 21 create animals and their fantastic masterpieces. Dress for mess! PAINT, SONG & STORIES LAC Members $85 environments! Wednesday 9:30-10:15am Discover new rhythms, tunes and Non-members $90 Wednesday 2-3:30pm Melanie Brown movements through sounds and Susan Tecktiel Session I: Starts September 16 songs. Each class begins with a Session I: Starts September 16 Session II: Starts October 21 KINDER-GARDENER half-hour of music and continues Session II: Starts October 21 LAC Members $70 with painting with fingers, brushes Make creations for your garden LAC Members $85 Non-members $75 and sponge stamps. Come ready whether it’s indoors or out. Make Non-members $90 to work alongside your child flowerpots and grow seedlings, throughout the class. stepping stones for outside, and creatures to live among your Ages 2-4 Tuesday 10-11:30am STRAY SOCKS plants! In all toddler classes, a parent or Bobbe Schlessinger/ Got socks? Let’s make stray sock babysitter stays with the child. In Sue Fisher-Yellen Monday 2-3:30pm animals and give them a good order to provide the best quality Session I: Starts September 15 Susan Tecktiel home. We’ll adorn them with time with your toddler, we ask that Session II: Starts October 20 Session I: Starts September 14 buttons, collars, and smiles. you refrain from bringing other Session II: Starts October 19 LAC Members $85 Thursday 2-3:30pm children to class. Class size limited Non-members $90 LAC Members $85 Roz Adams to 8 children. Non-members $90 Session I: Starts September 17 Session II: Starts October 22 CLAY, SONG & STORIES LAC Members $85 TODDLER CLAY Discover new rhythms, tunes and KINDERCLAY Non-members $90 Discover clay as a wonderfully movements through sounds and Each week will provide an expressive and creative material songs. Each class begins with a opportunity for creative expression for the young child! This class half-hour of music and moves through the shaping of clay. BUILD IT UP! provides special time for parent This class will provide individual than on to a clay experience of We’ll build with clay, corks, and child to work in clay, together, attention and enable each child to shaping, painting and fun. Come cardboard, and recyclables to and independently. The process of develop his or her personal style. ready to work alongside your child create buildings, cities, mountains, exploring with clay, rather than the The emphasis is on making unique throughout the class. and creatures. How far up can your end product, is emphasized. pieces rather than all the children Monday 10-11:30am imagination take you? In this class, making the same project. Thursday 10-11am Susan Tecktiel/ Sue Fisher-Yellen we’ll aim for the stars and build Vicki Willard Session I: Starts September 14 Friday 4-5:30pm it up. Session I: Starts September 17 Madeline Novak Session II: Starts October 19 Friday 2-3:30pm Session II: Starts October 22 Session I: Starts September 18 LAC Members $85 Roz Adams Session II: Starts October 23 LAC Members $75 Non-members $90 Session I: Starts September 18 Non-members $80 LAC Members $85 Session II: Starts October 23 Non-members $90 LAC Members $85 Read the Kidstreet Blog! Non-members $90 www.kidstreetchicago.blogspot.com

REGISTER TODAY! VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 11 KIDSTREET Non-members $95 Non-members $90 Members LAC 19 October Starts Tecktiel Susan 4-5:30pm Monday included. are developing and Cameras creations! art multimedia in use to photos of lots have we’ll back comes film the When outside. and indoors both surroundings our photograph and cameras disposable and eye artistic our use We’ll PLAY PHOTO $90 Non-members $85 Members LAC 14 September Starts I: Session Tecktiel Susan 4-5:30pm Monday more. and hats, masks, create to media other and fabric use We’ll costumes. head-to-toe make Let’s coming! is Halloween PIRATES AND PRINCESSES $90 Non-members $85 Members LAC 19 October Starts II: Session 14 September Starts I: Session Castro-Palanyk Marian 4-5:30pm Monday underglazes. colorful and textures using techniques decorative learn and handbuilding in skills new these explore We’ll forms. and shapes interesting become coils and slabs how Discover possibilities. creative of world new whole a offers clay of lump A CLAY IN HANDBUILDING 5-8 Ages 12 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 12

Non-members $90 Non-members $85 Members LAC 22 October Starts II: Session 17 September Starts I: Session Adams Roz 4-5:30pm Thursday imagination! your Bring ideas. new and materials artistic of variety a explore will we week Each you! for is class this Then more? and wood prints, paints, with yourself express or clay with play to want you whether decide Can’t MULTIMEDIA & CLAY $90 Non-members $85 Members LAC 21 October Starts II: Session 16 September Starts I: Session Tecktiel Susan 4-5:30pm Wednesday own. your of world a invent and Come environments. and buildings fantastic construct to media mixed and clay use We’ll architect! junior the For CONSTRUCTION UNDER $90 Non-members $85 Members LAC 20 October Starts II: Session 15 September Starts I: Session Hadland Jen 4-5:30pm Tuesday inspiration. for artist new a at look will we week Each ideas. our for imagination inner our and world outside our both to look We’ll methods. and textures different of variety a using printmaking and painting of world the Explore PRINTMAKING & PAINTING

prerequisite. only the is Imagination dreams! wildest your beyond creatures create to paint and materials, recycled clay, use We’ll class. multimedia this in creatures fun other and robots monsters, Create FRIENDS AND ROBOTS, MONSTERS, $90 Non-members $85 Members LAC 23 October Starts II: Session 18 September Starts I: Session Adams Roz 4-5:30pm Friday more! and bags, pillows, special own your Create art. wearable and sculptures soft create to multimedia and sewing, fabric, use We’ll WHAT SEW 8-12 Ages Non-members $90 Non-members $85 Members LAC 15 September Starts Svoboda Allison 4-5:30pm Tuesday paint. acrylic and watercolor, pastel, charcoal, with working of experience tactile the of joy the discover and ways new in color see to Learn PAINTING INTO DRAWING $90 Non-members $85 Members LAC 19 October Starts II: Session 14 September Starts I: Session Davis York Anne 4-5:30pm Monday techniques. cartooning and drawing incorporating characters, individual own your develop to get You’ll animals. and friends book comic and TV favorite our cover will We cartooning! of world the Explore CARTOONING & DRAWING $90 Non-members $85 Members LAC 21 October Starts II: Session 16 September Starts I: Session Novak Madeline 4-5:30pm Wednesday

Tuesday 4-5:30pm 4-5:30pm Tuesday color. and shading of use expressive with angles all from face human the draw to how learn You’ll everyone! draw friends, your draw yourself, Draw PORTRAITS PAINTING AND DRAWING Non-members $200 $200 Non-members $190 Members LAC 16 September Starts Zemans Rebecca 4-6pm Wednesday instructor. from purchased be may materials additional and Silver included. materials Some covered. be will ring band soldered a and connections cold texturing, Saw-piercing, know. already they ones the improve or metalworking basic of fundamentals the learn to want who jewelers young for designed is class This METALS TWEEN 10-14 Ages $190 Non-members $180 Members LAC 17 September Starts Mansfield Karen 4-6pm Thursday sculpture! unique and pots great making while wheel, the onto move then handbuilding, of techniques basic the learning time spend will We clay. at hand your try to opportunity great a is class This weeks) (10 WHEELTHROWING & HANDBUILDING $90 Non-members $85 Members LAC 20 October Starts Svoboda Allison

KIDSTREET

Birthday Parties Call for details, Host your child’s next 773.769.4226 CUSTOM CLASSES Our teachers and staff will work with you to create a custom class tailored to your interests and availability. For more information call the front desk at: 773-769- 4226, or contact Melanie Brown: [email protected]. Parents Workshop NURTURING YOUR CHILD’SCREATIVITY (1 day, adultsonly) FREE! Come participate in these open discussions regarding children’s creativity led by our Artist in Residence, Quinn Hunter McGonagle, and Kidstreet teachers. We will discuss process vs. product, ways to talk about art, and ideas for bringing art into your home. Learn from our teachers and your fellow parents as we get out own creativity going, working with art materials yourself. Dress for mess! Friday, November 6, 6-8pm Free, but advanced registration required. Limit 20. birthday party at Lillstreet!

VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 13 Non-members $130 CLAY AND MULTIMEDIA CAMP (2 days) Ages 9-12 Work in clay to develop handbuilding skills, and work in multimedia to create fantastic pots, critters, and other creations! 9am-3:30pm Session I: December 21-22 Session II: December 23-24 Session II: December 28-29 Session III: December 30-31 LAC Members $125 Non-members $130 WHEELTHROWING CAMP (2 days) Ages 9-12 Learn the exciting skill of wheelthrowing! Campers will learn the basics required to throw pottery and express their personal ideas on the wheel. 9am-3:30pm Session I: December 21-22 Session II: December 23-24 Session II: December 28-29 Session III: December 30-31 LAC Members $125 SCHOOL’S OUT CAMPS Columbus Day, October 12 Veterans Day, November 11 CLAY AND MULTIMEDIA (1 day) Ages 5-12 Monday 9am-3:30pm LAC Members $60 Non-members $65 WHEELTHROWING (1 day) Ages 9-12 Monday 9am-3:30pm LAC Members $60 Non-members $65 HOLIDAY CAMPS December 21-December 31

REGISTER TODAY! Sunday, December 6, 2-4pm Roz Adams FAMILY MENORAH One of our most popular family workshops! Learn simple handbuilding techniques to design and create a beautiful and unusual heirloom. Saturday, November 14, 2-4pm Glynnis Lessing CLAY ORNAMENTS Make beautiful ceramic ornaments to decorate your tree or give as special stocking stuffers. graveyard to decorate your table or porch, or a candleholder to really spook up your lair. Sunday, October 4, 2-4pm Roz Adams THANKSGIVING PLATTERS Make a platter or serving bowl to enhance your holiday entertaining. We’ll use stoneware clay for durability and decorate with relief work and colored slips. Sunday, October 25, 2-4pm Glynnis Lessing These workshops are a wonderful opportunity to work together on theme projects, and bring laughter, smiles, and great new crafts into your life! All workshops are 2 hours long and meant for adults and children ages 5+. Adult LAC Members $25 Non-members $30 Kid LAC Members $20 Non-members $25 GHOULISH GRAVEYARDS Set the scene for a spooky Halloween. Make a scary ceramic Family Workshops

Session II: Starts October 24 LAC Members $175/ pair Non-members $180/ pair fun! Sunday 2-4pm Karen Mansfield Session I: Starts September 20 exploring the possibilities of clay. Work together and independently on the pottery wheel to make objects that are useful or just plain FAMILY WHEEL Adults and Children 8+ Share some quality time with that special pre-teen in your life while LAC Members $85 Non-members $90 that is appropriate for all ages. Reservations are encouraged, as there is limited space. Saturday 10:30-11:30am Adults and Children 2+ Drop-in to create with clay as a family! Our teacher will guide you and your family in a clay project SIDE-BY-SIDE FAMILY DROP-IN Non-members $190 Family Classes Ages 5+ Karen Avery Starts September 15 LAC Members $180 Handbuilding projects add variety and expand the creative imagination. Tuesday 4-6pm cylinders, bowls and plates will be covered as well as embellishing these forms with carving handles and surface decoration. This class welcomes beginners as well as those who have had experience with clay. Throwing skills involving basic shapes of HANDBUILDING & WHEELTHROWING FOR AGES 12+ (10 weeks) POLICIES & PROCEDURES

FALL CLASSES BEGIN THE WEEKS OF SEPTEMBER 14 AND OCTOBER 19 AND GETTING TO LILLSTREET RUN 10 WEEKS UNLESS OTHERWISE NOTED. We are located on the northeast corner of Montrose and Ravenswood

TO REGISTER FOR CLASSES PLEASE VISIT WWW.LILLSTREET.COM OR CALL THE Public Transportation: Take the CTA Brown Line to Montrose, or use OFFICE DURING HOURS OF OPERATION: 773.769.4226 Montrose Bus #78. The Metra Union Pacific North line Ravenswood stop is located four blocks north of Lillstreet.

OFFICE & GALLERY HOURS: MONDAY-THURSDAY 10AM-7:30 PM / FRIDAY & SATURDAY 10AM-6PM / SUNDAY 10AM-5PM By Car: We are three blocks west of Ashland and four blocks east of Damen. On-street parking is available. Find directions online at our website www.lillstreet.com REGISTER EARLY! CLASSES FILL QUICKLY. We strongly encourage you to preregister to ensure a space in class. CANCELLATIONS AND REFUNDS Registration is accepted on a first-come, first-served basis with a 50% PLEASE READ CAREFULLY deposit required. Workshops must be paid in full at time of registration. Balance is due on the first day of class. Lillstreet accepts payments by VISA, Master Card, American Express or Discover. Checks should be made Refunds payable to Lillstreet Art Center. Tuition is refundable for all classes and workshops, minus a processing fee for each class dropped, but only if the office staff is notified at least one week prior to the class start date (see chart below). If the office is notified at least one week prior to the scheduled start date, a processing fee of HOLIDAYS $40 is charged for dropping classes. Students are responsible for notifying For classes that fall on holidays, it is up to individual teachers and students the Lillstreet office staff that they wish to drop a class or workshop. Not to decide whether to hold the class or to schedule a make up class later in attending class does not constitute an official withdrawal from courses or the session. cancellation of tuition or fees. If you must drop a class or workshop after the deadline, no refunds will be given, except for documented medical reasons with physicians note. There is a limit of two classes per student per year that can be dropped with a refund or credit for nonmedical reasons. SKILL LEVELS Programs are divided into skill levels: Beginners/ Advanced Beginners: Introduction to basic techniques. Classes Cancellations are designed for the true novice, and returning students in need of a Classes are canceled when enrollment minimums are not reached. refresher or further instruction. Students will be notified if classes are canceled and will be eligible for a full refund or class credit. Tuition credits are good indefinitely toward any classes, workshops or gallery items and are not redeemable for cash Multilevel: Open to both beginners and experienced students. Classes are under any circumstances. designed for students of all skill levels with projects appropriate for each. Refund Policy for Dropped Classes and Workshops

Intermediate/ Advanced: Development of skill and exploration of theme FALL Dropped on or Dropped between Dropped between Dropped after SESSION before 9/8/09 9/9/09 - 9/13/09 9/14/09 - 9/27/09 9/27/09 and content. Classes are designed for students who have completed beginner courses at Lillstreet or have a professional background and are Adult/ Refund minus No refunds/class No refunds/half No refunds/No Child $40 or full class credit only class credit class credit looking for refresher courses, advanced skills and studio time. Students not Classes credit previously enrolled at Lillstreet should seek the approval of the instructor Workshops/ If dropped one full If dropped 2-6 If dropped less than before enrollment. Camps/ week prior to start days before start 2 days before start of 5-week date, refund minus date, no refunds/ workshop, no refund classes in $40 or full class class credit only or class credit October credit TOOLS AND MATERIALS Students may be required to purchase a tool kit from Lillstreet, or other materials in order to complete class work. Unless otherwise specified, materials will be provided for the first class session and students will receive a supply list for purchase.

MISSED CLASSES Missed classes may only be made up within the same class session.

OPEN STUDIO Open studio time is available to all students currently enrolled in classes and usually starts the week after classes begin; please see each department for details.

14 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) GLASS Learn to work glass in a flame to create beautiful beads and small sculptures in our glass classroom. All skill levels will feel comfortable in one of our regular classes or workshops.

GLASS BEAD OPEN STUDIO FIRST-TIME GLASS Intermediate/ Advanced INDEPENDENT STUDY: Open studio allows students to BEADMAKING Glass Bead work on their projects and improve Make beautiful glass beads using This class is recommended to their skills outside of class. We basic techniques for shaping and GLASS BEADMAKING II those students who work well highly recommend students to take decorating with twisties, dots, (5 weeks) independently. Students will have advantage of open studio. There is and stringers. A $30 materials fee Learn to make larger and more 24-hour access to the studio. a $10 fee for each four-hour session includes assorted colors of glass complex beads (hollow and tube Students must provide their own for students who are currently and mandrels. Closed-toe shoes beads) pull complex latticino cane, glass and mandrels (available for enrolled in a glass bead class. The required. Saturday classes are off mandrel sculpture, and work sale during open studio hours); kiln fee helps cover our gas and tool/ open to ages 14 and up. with metals for new colors and access, hand tools are included. kiln costs. Students are required to finishes. We will discuss how to Locker rental available in the Monday 6:30-9:30pm bring their own glass and mandrels best incorporate your beads into bead studio for $10 per session. John Landin but tools will be available for finished jewelry or sculptures. Permission from instructor is Session I: Starts September 14 use. A monitor will be on hand to Students provide their own required. Session II: Starts October 19 answer questions but is not there glass and mandrels (available September 14-November 22 to instruct. Students not currently Thursday 2-5pm for purchase from instructor). enrolled in a glass bead class, who Judy Zeddies Prerequisite: Two sessions of Glass LAC Members $375 have taken at least a 10-week class Session I: Starts September 17 Bead Making I or permission Non-members $385 may attend open studio for a $20 Session II: Starts October 22 from instructor. Closed-toe shoes fee per session. required. Saturday 10am-1pm Workshops September 14-November 22 Jenny Sider Tuesday 2-5pm Session I: Starts September 19 Judy Zeddies Session II: Starts October 24 Session I: Starts September 15 CRITTERS, BUGS AND Beginner/ Advanced Session II: Starts October 20 LAC Members $160 SCULPTURE I (2 days) Beginner Thursday 6:30-9:30pm Non-members $165 Learn to make a variety of sea Leslie Speicher critters, seashells, bugs, birds Session I: Starts September 17 and much more with glass. You FEAR OF COMMITMENT BEGINNING GLASS FUSING Session II: Starts October 22 will learn how to create sculpture GLASS BEADMAKING (1 day) (5 weeks) LAC Members $160 off-mandrel. No glass experience Become familiar with the use of This is a crash course in glass Non-members $165 necessary. There is a $25 material tools, materials and the basic beadmaking! Learn the basic fee. Closed-toe shoes required. techniques and have beads to techniques for fusing glass. Learn take home at the end of the day. proper cutting, layout, design and ADVANCED GLASS FUSING Saturday & Sunday 1-5pm The workshop will cover several firing procedures. Expect to make (5 weeks) John Landin types of surface embellishment cabochons, tiles and even small For students with some previous September 26 & 27 such as dots, stripes and marbling. bowls. Basic kit fee: $30. Additional fusing experience who want LAC Members $95 Closed-toe shoes required. No colors can be ordered the first week to learn more about design, Non-members $100 experience necessary. Fee includes of class. Closed-toe shoes required. advanced cutting and finishing an assortment of colors. Sunday 10am-1pm techniques, kiln firing skills, and small castings. There will be one ADVANCED CRITTERS, BUGS Friday 6:30-9:30pm Barbara Mousigian small casting project. Expect to AND SCULPTURE II (2 days) Jenny Sider/ John Landin Starts September 20 monitor kiln firings during class, For the glass artist who has basic Session I: September 25 LAC Members $160 and learn about ramping and firing beadmaking/ sculpture skills: Session II: October 23 Non-members $165 schedules for tacking, slumping, expand your portfolio to create Session III: November 20 fusing and casting. Material fee: one-of-a-kind sculpture. Students LAC Members $60 Closed-toe shoes $50, which includes glass and must have completed a five- Non-members $65 are required in the casting materials. Prerequisite: week Glass Beadmaking I course Glass Fusing or permission from and bring their own glass and All classes are classroom. instructor. Closed-toe shoes mandrels. Additional glass and 10-weeks unless required. mandrels available for purchase from instructor. Closed-toe shoes Sunday 10am-1pm otherwise noted. required. Barbara Mousigian Starts October 25 Saturday & Sunday 1-5pm LAC Members $160 Leslie Speicher Non-members $165 November 7 & 8 LAC Members $95 Non-members $100

REGISTER TODAY! VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 15 GLASS Non-members $100 Non-members $95 Members LAC 15 & 14 November II: Session 18 & 17 October I: Session Hsieh Kim 1-5pm Sunday & Saturday required. shoes Closed-toe required. experience No glass. of colors assorted includes fee materials $30 A holidays. the for perfect gifts, ornaments/ glass miniature and rings, napkin for beads table, the for sculptures glass holiday small wineglasses, for charms make will We days) (2 HOME THE FOR GLASS HOLIDAY 16 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 16

Starts September 15 September Starts Lucas Tom 6:30-9:30pm Tuesday mess. for Dress day. first the provided be will list materials A paper. own their provide Students provided. materials and equipment tools, Most print! one in together them Combine screenprint. and lithography, relief, intaglio, of techniques basic and history tools, the to introduction marathon a is This TECHNIQUES PRINTMAKING OF SURVEY NEW! $165 Non-members $160 Members LAC 25 October Starts II: Session 20 September Starts I: Session Ginsberg Matt 5-8pm Sunday 24 October Starts II: Session 19 September Starts I: Session Lucas Tom 10am-1pm Saturday mess. for Dress night. first the after paper own their supply Students provided. inks and equipment Most photo-emulsion. and stencils using paper on image an print and screen a Prepare PAPER ON SCREENPRINTING FIRST-TIME Beginner Advanced Beginner/ and othernon-traditionalsurfaces. mixed-media approaches--suchasapplyingprintmakingtechniquestoceramics instructioninexperimentaland in ourPrintmakingDepartment,whichalsooffers Learn traditionaltechniquessuchasmonoprint,screenprinting,andletterpress PRINTMAKING Non-members $290 $290 Non-members $280 Members LAC Read the Printmaking Department Blog! www.hummingbirdpressLAC.blogspot.com Blog! Department Printmaking the Read [email protected] at Lucas Thomas Contact editions, info. only. more Limited for appointment by are by contracts www.hummingbirdpresslac.net. and posters at new Press as well collaborations as Hummingbird Jackson about info Preston more for Marshall, Williams, Look Kerry Tyler, Bernard Al Noland. Ray Canton, include: Shelly Roberts, collaborations Darrell artist Recent having Hopkins, years Michael editions. dozen a artist spans different printer a as twenty unique nearly create experience to Lucas’s published artists paper. on with works collaborate Tomto handprinted works Printer, edition, Press Master and limited Hummingbird Director of Editions, expertise the Artistprint under Formerly Facility Lucas. Printmaking Lillstreet the shares Hummingbird PRESS HUMMINGBIRD

provided for your first edition. first your for provided be will Paper class. this enjoy will students drawing advanced Beginning-through- covered. be also will monoprint and colle Chine layering. and manipulation color through them alter and plates multiple Create means. digital modern as well as explored, be will tusche and crayon as such drawing of aspects Traditional plates. photographic and grained ball- both utilizing cover will course printmaking art fine This LITHOGRAPHY PLATE FOR DRAWING NEW! Non-members $360 Non-members $350 Members LAC 17 September Starts Lucas Tom 6:30-9:30pm Thursday facilities. Departments Printmaking and Ceramic the both to access Includes class. of day first the provided be will list materials A greenware. to techniques those apply to glazes and stains slips, different use and Department Ceramics the to move we’ll Then screenprinting. and lithography relief, as such techniques learn to Department Printmaking the in spent be will class level beginning- this of weeks first The CLAY ON TECHNIQUES PRINTMAKING OF SURVEY $290 Non-members $280 Members LAC 17 September Starts Lucas Tom 2-5pm Thursday

with the press or by hand. Students Students hand. by or press the with printed be can plates monoprint and Blocks covered. be will ideas of translation the and blockprinting, with techniques cutting tools, on instruction Detailed marks. and color of layers incorporate to way a as technique monoprint the of potential the explore also and blockprinting to introduction basic this in linoleum Use AND MONOPRINT RELIEF MIXED-MEDIA Multilevel Non-members $290 Non-members $280 Members LAC 19 September Starts Sheridan April 10am-1pm Saturday book. final collaborative a produce a techniques binding basic Learn design. and typography of understanding an through text and image combine and presses, platen and cylinder on Print broadsides. and books edition limited creating to applies it as method printing relief this of principles the Learn presswork. and typesetting hand to introduction basic a is This TEXT AND IMAGE LETTERPRESS TO INTRODUCTION NEW! $290 Non-members $280 Members LAC 16 September Starts Zeddies Judy 2-5pm Wednesday shop. the from purchase for available or provided be will materials Most paper. provide

PRINTMAKING

All classes are 10-weeks unless otherwise noted. color. Bring photocopies of images no bigger than 8.5”x11”. All other materials included. Sunday, November 8, 10am-2pm Tom Lucas LAC Members $55 Non-members $60 LETTERPRESS HOLIDAY CARDS (1 day) Create a few custom holiday greeting cards. The designs will be kept simple to allow variations with the text color and printing composition. Session I: Sunday, October 4, 10am-2pm Ben Blount Session II: Sunday, November 15, 10am-2pm Ben Blount LAC Members $65 Non-members $70 Workshops SCREENPRINT ON CLAY (1 day) A basic introduction to the screenprinting process on clay. Learn the fundamentals of preparing a screen to print both directly and indirectly on clay. All materials provided. Sunday, October 11, 10am-5pm Tom Lucas LAC Members $80 Non-members $85 PHOTOCOPY TRANSFER (1 day) Explore the potential of lithographic printmaking with an alternative technique that is more user-friendly. Pull impressions from photocopied images ranging from drawings in a sketchbook to photographs. We will work within a complete range of

VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 17 SCREENPRINT ON (1CLAY day) A basic introduction to the screenprinting process on clay. Learn the fundamentals of preparing a screen to print both directly and indirectly on clay. All materials provided. Sunday, October 11, 10am-5pm Tom Lucas LAC Members $80 Non-members $85 by glaze. Tuesday 6:30-9:30pm Tom Lucas Session I: Starts September 15 Session II: Starts October 20 (B) Direct and Indirect Screenprinting on Clay In the direct process, images are printed on flat slabs then clay works can be made afterwards. With the indirect method, we print onto paper first then transfer the images to clay. Both techniques offer an infinite range of image, pattern and color possibilities utilizing slips and glazes on top of the print. We will focus on hand cut stencils and photo-emulsion. The techniques work best on greenware, but there are developing approaches on bisque. Saturday 2-5pm Tom Lucas Session I: Starts September 19 Session II: Starts October 24 LAC Members $350 Non-members $360 Workshops NEW! THE CERAMIC PRINT:Mix and Match Classes For intermediate-to-advanced students who have taken printmaking and/ or ceramics. You choose two five-week class sessions (A and/ or B) in the order of your choice, to customize your experience. Take one of each or two of the same. Classes include access to both the Ceramic and Printmaking Departments facilities. (A) Lithographic Transfer Decal, Relief and Texture on Clay Specifically for the greenware stage, these techniques utilize specially mixed oil-based ceramic ink that allows you to print on flat clay slabs or tiles as well as vessels and sculptural forms. With Relief printing, you will carve into linoleum plate, Styrofoam or PVC in order to print onto clay. Explore a wide range of color using slips combined with printing, followed

REGISTER TODAY!

Non-members $290 Realize personal projects, print editions, portfolio pieces, and print on surfaces other than just paper. Incorporate other art mediums into your work, such as oil, pastel, acrylic and collage. The use of cut stencils, drawn marks, photographic images and text will be introduced. Basic tools and materials are provided. A supply list will be provided. Thursday 6:30-9:30pm Matt Ginsberg Starts September 17 LAC Members $280 nontoxic methods, this printmaking course will introduce the hands-on processes used on metal plates and blocks to create images with line, tone and texture. Students will use traditional and experimental techniques, in b&w and color. Thursday 10am-1pm Julian Cox Starts September 17 LAC Members $280 Non-members $290 EXPERIMENTAL SCREENPRINT Rights Movement. Work with text, color and images. Students will need to provide their own inks and paper. Wednesday 6:30-9:30pm Tom Lucas Starts September 16 LAC Members $280 Non-members $290 INTERMEDIATE-TO- ADVANCED PRINT WORKSHOP Explore etching, dry point, relief and beyond. Using the latest in THE ART OF THE POSTER:Intermediate-to-Advanced Screenprint Create an image that promotes, explains, contradicts, celebrates or confronts, and create an edition to share. We will experiment with printing on colored and textured papers, and applying various layers of ink through more than one screen. We will also examine masters in this field; from the Bauhaus and Polish traditions to the posters created during the Civil Intermediate/Advanced

LAC Members $280 Non-members $290 Tuesday 10am-1pm Tom Lucas Starts September 15 preparing a screen, creating different styles of stencils and photoemulsion. Screenprinting equipment will be provided. Expect a wide range of results utilizing texture, photography, graphics, pattern and color. We will go through the process of screenprinted imagery directly into the painted surface, and working with acrylic printing inks, resists and transfers to alter and organize. BETWEEN PAINT AND PRINT Painters can explore the possibilities of integrating Starts September 14 LAC Members $280 Non-members $290 be provided as well as the basic shop tools. Monday 6:30-9:30pm Tom Lucas vocabulary of techniques. There will be demonstrations in multi-plate printing, roll up viscosity, chine colle and color. The first copper plate will with consistency and controlled variation. We will look at artists such as Rembrandt and Goya for inspiration while mastering a course we will focus on three basic techniques of etching a copper plate: hard ground, soft ground and aquatint as well as how to print NEW! MULTILEVEL ETCHINGAND INTAGLIO In this intermediate-to-advanced TEXTILES Recycle and repurpose materials into beautiful new designs. Screenprint your own t-shirts or add printed embellishments, embroidery, and appliques to household items. Focus on one project for a full session or experiment with a wide variety of techniques in our Saturday Workshop Series.

Printing on Fabric EMBELLISHED FABRIC PRINT II: Printing KATAZOME: Rice Paste SCREENPRINTS (5 weeks) with Thickened Dyes Resist (5 weeks) There are always ways to fix Use Procion dyes on natural Katazome is an traditional FIRST-TIME smudges and imperfections fabrics including silk and cotton. Japanese resist printing technique SCREENPRINTING ON that sometimes happen in Draw complex repeat patterns, used to make beautiful kimono FABRIC screenprinting. Learn new ways monoprint to create unique designs. Katazome applies rice Prepare a screen, shoot, and to make your multiple prints one- disintegrating repeats, and try paste (special bran & sweet rice finally print an image on cloth. of-a-kind. Appliqué, embroidery, loose painterly technique. Many flour) through katagami (cut- Most materials provided, students beadwork, as well as basic sewing different print sources will be out stencil paper) to print on provide their own ink and cloth instruction will be offered. Although used including block printing, fabric. Soybean juice is used for after first night. this class takes place in the “clean” screenprinting, and direct printing. binding with pigments–no fumes Monday 10am-1pm room, former Screenprinting on This class does not utilize photo or chemicals. Study Japanese , Andrea Myers Fabric students will have open silkscreen. Bring your own pair of then develop your own designs, Session I: Starts September 14 studio access to the print studio. rubber dishwashing gloves to the Furoshiki (traditional wrapping first night of class. Session II: Starts October 19 Sunday 10am-1pm cloth) will be given. Thursday 6:30-9:30pm Camille Canales Tuesday 6:30-9:30pm Saturday 10am-1pm Camille Canales Session I: Starts September 20 Rebecca Ringquist Akemi Nakano Cohn Session I: Starts September 17 Session II: Starts October 25 Starts September 15 Starts September 19 Session II: Starts October 22 LAC Members $160 LAC Members $310 LAC Members $160 Non-members $165 Non-members $320 Wednesday 2-5pm Non-members $165 Andrea Myers Session I: Starts September 16 FABRIC PRINT I: Beginning FABRIC PRINT III: Advanced Session II: Starts October 21 Screenprinting on Fabric Screenprinting on Fabric Embroidery, Weaving, Felting, Knitting, and LAC Members $160 Learn the processes of stencil This class is an intensive Crochet Non-members $165 and photo-emulsion prints. Begin introduction to motif generation by printing on loose yardage and repeat construction. Start with and progress to t-shirts and basic paper stencil repeats, and EMBROIDERY I (5 weeks) Print Practice Classes other garments. Class includes move towards combining various Learn traditional embroidery You’ve taken First-Time introductions to two color prints techniques of visual perception to stitches, and translate them Screenprinting but you’re not using free style and hinge clamp create complex patterns. We will into beautiful lines and forms to sure you’re ready for Beginning methods, and alternative mediums address registration, colorways, develop images and patterns. Screenprinting, hone your skills like puff Ink and thickened dye. and various techniques to create Various methods of image transfer before moving on with one of these Dyes and other mediums included. dynamic, visually arresting will be covered. You can expect five-week thematic classes. Students provide their own ink and patterns! to complete one sample. Most fabric after the first night. Monday 6:30-9:30pm materials included. Come to the Wednesday 6:30-9:30pm Rachel Walker first class with a sketchbook and an PRINTING T-SHIRTS Andrea Myers Starts September 14 embroidery hoop. (5 weeks) Starts September 16 LAC Members $310 Wednesday 10am-1pm This fast-paced class gives Sunday 2-5pm Non-members $320 Camille Canales direction for printing on several Allison Rose Starts September 16 types of t-shirts, including kids Starts September 20 Wednesday 6:30-9:30pm sizes. Expect to finish four or five Sunday 6:30-9:30pm Rebecca Ringquist completed t-shirts (even more if you Allison Rose Starts September 16 take advantage of our generous Starts September 20 open studio days). LAC Members $160 LAC Members $310 Non-members $165 Friday 6:30-9:30pm Non-members $320 Camille Canales Session I: Starts September 18 Session II: Starts October 23 All classes are LAC Members $160 10-weeks unless Non-members $165 otherwise noted.

18 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) TEXTILES

provided on the All materials are first night of class. be purchased in the Textiles Department. Additional supplies can pillowcases, curtains, drapes, napkins, and seat cushions. Basic knowledge of the sewing machine and/ or First-Time Sewing is strongly recommended before taking this class. Tuesday 10am-1pm Sayward Schoonmaker Session I: Starts September 15 Session II: Starts October 20 LAC Members $160 Non-members $165 SEW I (BEGINNING SEWING): Garments (5 weeks) Learn how to read and follow a basic pattern, and sew side and shoulder seams, sleeves, and cuffs. You’ll also learn how to mend and alter your existing clothes. Basic knowledge of the sewing machine and/ or First-Time Sewing is strongly recommended before taking this class. Thursday 2-5pm Amy Witte Session I: Starts September 17 Session II: Starts October 22 LAC Members $160 Non-members $165 SEW I (BEGINNING SEWING): Housewares (5 weeks) While learning basic seam construction, we will cover

VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 19 Session II: Starts October 22 LAC Members $160 Non-members $165 teacher is a master knitter who has 22+ years experience knitting and can help you with any project that you want to work on. All skill levels above novice are invited! (Novice? Take First-Time Knitting!) Sunday 6:30-9:30pm Lisa Whiting Starts September 20 LAC Members $280 Non-members $290 Sewing FIRST-TIME SEWING (5 weeks) Learn how to operate and control a sewing machine, and the basics of materials and construction. Work on two projects from start to finish. Machines and materials are provided. Tuesday 2-5pm Amy White Session I: Starts September 15 Session II: Starts October 20 Thursday 6:30-9:30pm Amy White Session I: Starts September 17 KNIT III (ADVANCED KNITTING): Color Changes Learn to make stripes with basic color changing, shapes using intarsia, and patterns with Fair Isle. Work with color composition, knitting technique, design, and other skills that make color working so unique. Class requirements: know how to knit, purl, increase/ decrease, and know how to read a pattern. Materials list will be provided before class starts. Sunday 2-5pm Lisa Whiting Starts September 20 LAC Members $280 Non-members $290 EVERYBODY KNIT: Pick Chooseand This knitting circle style class is perfect for the self-starter. The

REGISTER TODAY!

Dress for Mess LAC Members $280 Non-members $290 KNIT II (INTERMEDIATEKNITTING): Socks Toe up and cuff down on double points or circular needles, we’ll make everything from knee socks to lacey ankle socks and cover a handful of styles in this intermediate-to-advanced class. Please bring your own needles in sizes ranging from 0 to 4 to the first night of class. Monday 2-5pm Lisa Whiting Starts September 14 KNIT I (BEGINNING KNITTING): Blankets (5 weeks) The perfect class for the beginner that knows the basics but wants to do something more than just a scarf. Learn to make a multiple stitched baby blanket. Pattern included. Monday 10am-1pm Lisa Whiting Session I: Starts September 14 Session II: Starts October 19 LAC Members $160 Non-members $165 Learn to knit, purl, work in the round, rib, cast on, bind off, decrease, and fix mistakes while making a scarf and a hat. Saturday 10am-1pm Meryl Kleiman Session I: Starts September 19 Session II: Starts October 24 Sunday 10am-1pm Lisa Whiting Session I: Starts September 20 Session II: Starts October 25 LAC Members $160 Non-members $165 FIRST-TIME KNITTING

LAC Members $160 Non-members $165 home. Saturday 10am-1pm Akemi Nakano Cohn Starts October 24 “lacy” felt designs. Apply the “lacy” felt technique to a scarf or other projects. Bring a large towel and plastic bag to take wet felt pieces art of natural color, wool roving dyeing to create lovely multi-colors by using the dry powder dye technique, then cut them to make (5 weeks) Make delicate “lacy” felt with your own dyed wool roving. Start by making a basic flat felt. Learn the Non-members $320 LACY “NUNO” FELT Tuesday 6:30-9:30pm Pamela Feldman Starts September 15 LAC Members $310 project are provided, however, students are expected to purchase additional materials. Open to all levels. and traditional cultures. Visual presentations, demonstrations, and readings are included. Basic supplies for the beginning Advanced students will work on independent projects. The class will also examine the use of these techniques in both contemporary techniques of tapestry and plain weave, and then explore ways of creating surface, image and text within a woven form. FRAME LOOM WEAVING Experiment with the basic Rebecca Ringquist Starts October 21 LAC Members $160 Non-members $165 Wednesday 10am-1pm Camille Canales Starts October 21 Wednesday 6:30-9:30pm own style. Advanced students can take this class as an independent study. Learn appliqué, reverse appliqué, and more advanced stitches and finishing techniques. Work beyond the sampler to start to develop your EMBROIDERY II Refine your embroidery skills in this continuation of Embroidery I. TEXTILES classes. textile in enrolled students for Free Class. Drop-In Per-Day $25 Non-members $20 Members LAC TBA Hours studio. sewing the to coming before classes sewing our of one take Please machine? sewing the using to New project. specific a on work to basis day day-to- a on pay to choose may others but classes, Department Textile the of any in enrolled students for studio open free a is This fall! this starting basis in drop- a on use to available be will tables cutting and station ironing machines, sewing easy-to-use Our STUDIO SEWING DROP-IN $320 Non-members $310 Members LAC 17 September Starts Witte Amy 10am-1pm Thursday projects. multiple for once than more taken be can class This needs. project individual with help will instructor The projects. individualized in result will skills Pattern-making garment. existing an from pattern a draft to how cover will We SEWING) (ADVANCED III SEW $320 Non-members $310 Members LAC 16 September Starts Witte Amy 10am-1pm Wednesday 14 September Starts Witte Amy 6:30-9:30pm Monday perfect. look clothes your make to techniques shaping and construction discuss and demonstrate will teacher The techniques. hand-sewing and hems, sleeves, interfacings, seams, tailored snaps, holes, button zippers, cuffs, advanced collars, sew to how covers class This SEWING) (INTERMEDIATE II SEW 20 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 20

Read the Textiles Department Blog! Department Textiles the Read www.lillstreettextiles.blogspot.com

rubber bands, then we will dye it in in it dye will we then bands, rubber and chopsticks with it bind and origami like fabric silk fold will We paper. folding means “Origami” SHIBORI ORIGAMI $45 Non-members $40 Members LAC Rose Allison 2-6pm 19, September Saturday, do. will kind Any with. work to like you’d that workshop the to fabric of collection small a bring Please necessary! experience sewing No detail. lovely and reinforcement for place in them hand-stitch or machine then will we appliqué, an with embellished is bag your After bag. your embellish to fabrics printed from appliqués make to ways easy learning workshop this Spend eco-bag. canvas sturdy, one with provided be will student Each WORKSHOP BAG ECO CANVAS EMBELLISHED $45 Non-members $40 Members LAC Ringquist Rebecca 2-6pm 10, October Saturday, Ringquist Rebecca 2-6pm 19, September Saturday, gloves. dishwashing rubber own your bring Please provided. materials All bracelets. and ornaments cool into beads easy-to-form these make to how you show and notions and wool the all provide We’ll WORKSHOP BEADMAKING FELT noted. otherwise unless hours four are workshops All SERIES WORKSHOP SATURDAY Non-members $45 Non-members $40 Members LAC Cohn Nakano Akemi 2-6pm 26, September Saturday, patterns. lovely unexpected, create to pot a

Rana Seigel Rana 2-6pm 3, October Saturday, provided. materials All fabric. embellish or jewelry create can you technique, this With fabric. soluble water- on sewing by embroidery three-dimensional Make EMBROIDERY SCULPTURAL $45 Non-members $40 Members LAC Seigel Rana 2-6pm 26, September Saturday, making. rope of technique basic the learn also will students conjunction, In wool. spinning begin and spindle drop own very their make to how learn will Students rope. make and wool spin to how Learn ROPEMAKING AND SPINDLE DROP Non-members $45 Non-members $40 Members LAC Canales Camille 2-6pm 10, October Saturday, necessary. experience embroidery No hand. by patterns stitch decorative and motifs floral work to floss embroidery and ribbon uses that art old romantic, a is embroidery Silk-ribbon WORKSHOP EMBROIDERY RIBBON SILK $45 Non-members $40 Members LAC Cohn Nakano Akemi 2-6pm 3, October Saturday, home. fabric wet take to bags plastic and gloves, rubber towel, a Bring fabric. silk or scarves own your bring may You class. in purchase to available are hemmed) (natural, scarves chiffon & scarves satin Devore Special twist”. “to means “Nejiri” garment). Japanese (traditional kimono for especially designs beautiful create to used technique dyeing resist Japanese ancient, an is Shibori WORKSHOP SHIBORI NEJIRI $45 Non-members $40 Members LAC

special tricks on how to thread a thread to how on tricks special learn will we Then dishtowels. sack flour to designs embroidery vintage transfer hot-iron will we class, this In designs. transfer embroidery vintage reproduced, from made dishtowels hand-embroidered with style in dishes your Dry WORKSHOP DISHTOWEL EMBROIDERED VINTAGE $45 Non-members $40 Members LAC Canales Camille 2-6pm 17, October Saturday, own. your of fabrics natural 100% pre-washed, bring to free feel Please provided. is muslin Cotton watercolor. printed a resembles technique This them. printing and screens open onto dyes painting be will We WORKSHOP DYE WITH MONOPRINTING Non-members $45 Non-members $40 Members LAC Obermeyer Lindsay 2-6pm 31, October Saturday, provided. materials All necessary. experience No felting. needle sculptural of basics the learning while life to tale fairy favorite your Bring elves! and fairies, Gnomes, ORNAMENTS AND TOYS FELTED $45 Non-members $40 Members LAC Canales Camille 2-6pm 24, October Saturday, like. you if fabric or t-shirt own your bring but provided fabric including provided materials All textile. using fabric on prints multilayered create will you stencils, paper cut intricately using By WORKSHOP SCREENPRINTING STENCIL $45 Non-members $40 Members LAC Rose Allison 2-6pm 17, October Saturday, provided. materials All stitch. chain the and daisy, lazy the knot, French the including stitches embroidery basic learn also will We knot. a tie quickly to how and thread, embroidery separate easily to how needle,

TEXTILES VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 21

REGISTER TODAY!

embroidery as you fashion a stunning pendant. Wear it from a fancy ribbon or string it with other beads. No prior embroidery experience necessary. All materials provided, but feel free to bring your own favorite beads. Saturday, November 21, 2-6pm Lindsay Obermeyer LAC Members $40 Non-members $45 WORKSHOP Choose from several pre-made designs to customize your bag, or design your own paper stencil. One bag included in fee and more are available for purchase on the day of the workshop. Saturday, November 21, 2-6pm Camille Canales LAC Members $40 Non-members $45 BEAD EMBROIDERED PENDANTS Learn the basics of bead Transform bits of fabric into a festive garland for your Christmas tree or mantle. Connect several garlands together for a fabulous table runner. No prior sewing experience necessary. All materials provided, but feel free to bring your own fabrics. Saturday, November 14, 2-6pm Lindsay Obermeyer LAC Members $40 Non-members $45 PRINTED TOTEBAG DISHTOWELS WORKSHOP Customize your own dishtowels with our pre-made screen designs or create a pattern using the stencil printing technique. No printing experience required. Dress for mess. White cotton dishtowels available for purchase on the day of the workshop. Saturday, November 14, 2-6pm Camille Canales LAC Members $40 Non-members $45 YO YO TREE GARLANDS SCREENPRINTED

Lindsay Obermeyer LAC Members $40 Non-members $45 to bring your own favorite cotton fabrics. Saturday, November 7, 2-6pm potholder or make several to quilt into a baby blanket. No prior sewing experience necessary. All materials provided but feel free PATCHWORK POTHOLDERS The basic nine-patch quilt block is colorful, quick, and easy to learn. Use it as the top for a quilted LAC Members $40 Non-members $45 rubber gloves and a plastic grocery bag to take your wet work home in. Saturday, November 7, 2-6pm Rebecca Ringquist like stockings, ornaments, and small bags, and a simple appliqué technique will be demonstrated to get you started. Please bring felt using the wet felting method. You can expect to go home with four or five pieces of flat felt that are perfect for making holiday gifts FLAT FELT WORKSHOP Learn how to make flat sheets of Saturday, October 31, 2-6pm Allison Rose LAC Members $40 Non-members $45 embellishments will be. No sewing experience required. Please BYO fabric. commercially printed) fabric and learn how to turn it into a matched set of stitched napkins. Simple techniques for turning under, handmade bias tape, and easy HANDMADE DINNER NAPKINS WORKSHOP Bring your dyed or printed (or LAC Members $40 Non-members $45 and an old pillow or pillow insert for the case to fit around. Saturday, October 24, 2-6pm Allison Rose no zippers or buttons. No sewing experience required! Students must bring two yards of fabric they would like to make their pillow case from, ENVELOPE PILLOW CASEWORKSHOP Make an envelope pillow case; CATEGORY See page 11 for Kidstreet class information. class Kidstreet for 11 page See register. to 773.769.4226 call or LILLSTREET.COM Visit CLASSES FALL 22 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 22 22 Fall Classes Begin the Weeks of September 14 & October 19 (unless otherwise noted) otherwise (unless 19 October & 14 September of Weeks the Begin Classes Fall 22 Ceramics Jewelry/ Glass Jewelry/ & Metalsmithing Printmaking Textiles Painting & Drawing & Painting

Etching & Intaglio & Etching 6:30-9:30pm Casting & Wax with Working 6:30-9:30pm Beadmaking Glass First-Time 6:30-9:30pm & 11am-2pm Metalsmithing Beginning Soda Beginning Stories and Myths Dreams, Accents Home Glaze Fire Low 6:30-9:30pm Wheelthrowing Beginning Advanced Beginning/ 1:30-4:30pm Pottery Garden and Home AY D N O M 10am-1pm Advanced Screenprinting Advanced Sewing Intermediate Knitting Intermediate Knitting Beginning Fabric on Screenprinting First-Time Figure Painting in Oil in Painting Figure Drawing First-Time Painter First-Time II Painting Oil

10am-1pm

7-10pm 6:30-9:30pm

7-10pm

6:30-9:30pm 6:30-9:30pm

10am-1pm 6:30-9:30pm

6:30-9:30pm 6:30-9:30pm 2-5pm

6:30-9:30pm

7-10pm

Surface Investigations Surface 7-10pm Wheelthrowing Beginning Advanced Beginning/ 6:30-9:30pm Match & Mix Print: Ceramic 6:30-9:30pm & 10am-1pm Wheelthrowing Intermediate 7-10pm & 1:30-4:30pm Handbuilding Intermediate Beginning/ Potter First-Time AY D S E U T Going in Circles in Going 6:30-9:30pm Chainmaking Loop-In-Loop Ancient Metal on Etching Metalsmithing Beginning II Beadmaking Glass Metalsmithing Multilevel 6:30-9:30pm Match & Mix Print: Ceramic 6:30-9:30pm Techniques Printmaking of Survey Print & Paint Between Frame Loom Weaving Loom Frame 6:30-9:30pm Dyes Thickened with Printing First-Time Housewares I: Sew II Painting Acrylic Drawing Beginning Print & Paint Between Painter First-Time

Sewing 2-5pm Sewing

6:30-9:30pm

1:30-4:30pm

6:30-9:30pm 6:30-9:30pm 10am-1pm

10am-1pm 6:30-9:30pm

2-5pm

6:30-9:30pm 10am-1pm 10am-1pm 7-10pm

1-4pm 1-4pm 6:30-9:30pm

Tea and Soda Teaand Sculpture Figure 7-10pm & 10am-1pm Wheelthrowing Beginning Advanced Beginning/ 6:30-9:30pm & 10am-1pm Handbuilding Advanced AY D S E N D E W The Art of the Poster the of Art The 2-5pm Monoprint and Relief Mixed-Media Metalsmithing Intermediate Metal with Weaving Metalsmithing Beginning Metals Tween Casting & Wax with Working Byzantine Variations Byzantine Maille Chain 6:30-9:30pm 2-5pm Embroidery II Embroidery I Embroidery I Print Fabric Fabric on Screenprinting First-Time Sewing Intermediate Painting Encaustic 6:30-9:30pm Drawing & Painting Intuitive Painter First-Time Masters the from Learning Practices Studio 10am-1pm Figure Nude the Painting & Drawing I Painting Acrylic

6:30-9:30pm 10am-1pm & 6:30-9:30pm & 10am-1pm 6:30-9:30pm

10am-1pm & 6:30-9:30pm & 10am-1pm 6:30-9:30pm 4-6pm

10am-1pm 6:30-9:30pm

10am-1pm 6:30-9:30pm

6:30-9:30pm

6:30-9:30pm 6:30-9:30pm 6:30-9:30pm 10am-1pm

6:30-9:30pm

2-5pm

2-5pm

6:30-9:30pm Screenprint Experimental Clay on Techniques Printmaking of Survey Lithography Plate for Drawing Workshop Print Advanced Intermediate/ Forming & Forging Stones & Sticks II Beadmaking Glass Jeweler First-Time Trunk the in Junk Beadmaking Glass First-Time 10am-1pm Metalsmithing Intermediate Wheelthrowing & Handbuilding Fusion: Tiles Ceramic Clay on Techniques Printmaking of Surve Potter First-Time 10am-1pm Techniques Sculpture Figure 10am-1pm Me Super-Size Surface: And Form 10am-1pm Wheelthrowing Beginning Advanced Beginning/ AY D S R U H T 10am-1pm 6:30-9:30pm First-Time Sewing First-Time Fabric on Screenprinting First-Time Garments I: Sew Sewing Advanced I Painting Oil Drawing Figure I Painting Acrylic Mixing Color Painters Oil for Solving Problem Drawing Beginning

6:30-9:30pm

6:30-9:30pm

10am-1pm

10am-1pm 7-10pm 7-10pm

7-10pm 6:30-9:30pm 6:30-9:30pm

6:30-9:30pm 2-5pm

6:30-9:30pm

6-9pm

6:30-9:30pm 10am-1pm

6:30-9:30pm 6:30-9:30pm 10am-1pm

6:30-9:30pm

2-5pm 2-5pm

Beadmaking Glass Commitment of Fear Jeweler First-Time AY D I R F Printing T-Shirts Printing Painting Oil Representational Painting Encaustic Figure Costumed the Drawing & Painting Watercolor Beginning I Painting Acrylic

10am-1pm

2-5pm

6:30-9:30pm

6:30-9:30pm 10am-1pm

10am-1pm 10am-1pm 2-5pm

10am-1pm TURDAY D R U AT S Ceramic Print: Mix & Match & Mix Print: Ceramic 10am-1pm Text and Image Letterpress to Intro 10am-1pm Paper on Screenprinting First-Time 1pm Metalsmithing Intermediate Metalsmithing Beginning 10am-1pm Beadmaking Glass First-Time Match & Mix Print: Ceramic Handbuilding Advanced Topics Advanced 10am-1pm Wheelthrowing Intermediate 10am-1pm Wheelthrowing Beginning Advanced Beginning/ Saturday Workshop Series Workshop Saturday Felt Nuno Lacy Resist Paste Rice Katzome Knitting First-Time Drawing Portrait Advanced Intermediate/ Drawing Portrait Beginning I Painting Oil Figure Advanced Painting Abstract 10am-1pm Drawing Figure to Introduction Drawing First-Time

6-9pm

2-5pm

10am-1pm

10am-1pm 2-5pm

10am-1pm

10am-1pm 10am-1pm

10am-1pm 10am-1pm

10am-1pm 2-6pm

2-5pm 2-5pm 2-5pm 10am-

5-8pm Paper on Screenprinting First-Time 10am-1pm Metalsmithing Beginning 10am-1pm Fusing Glass Beginning 2-5pm Soda Beginning Potter First-Time AY D N U S Fusing Glass Advanced 10am-1pm Wheelthrowing Beginning Advanced Beginning/ Handbuilding Intermediate Beginning/ Watercolor Advanced Intermediate/ Journals Life Journeys/ Life Floorcloths Painted 2-5pm & 10am-1pm Painter First-Time 10am-1pm Teacher for Studio Figure Drawing Beginning Everybody Knit Everybody 6:30-9:30pm & 2-5pm I Print Fabric Knitting Advanced 10am-1pm Screenprints Embellished Knitting First-Time

2-5pm

10am-1pm

6:30-9:30pm

11am-2pm 10am-1pm

10am-1pm 2-5pm 2-5pm 10am-1pm

2-5pm CATEGORY 2-5pm

10am-1pm 2-5pm 2-5pm 10am-1pm

10am-1pm 11am-2pm

6:30-9:30pm

10am-1pm

2-5pm

Embellished Screenprints 10am-1pm Advanced Knitting Fabric Print I 2-5pm & 6:30-9:30pm Everybody Knit Beginning Drawing Figure Studio for Teacher 10am-1pm First-Time Painter 10am-1pm & 2-5pm Painted Floorcloths Life Journeys/ Life Journals Intermediate/ Advanced Watercolor First-Time Knitting Beginning Glass Fusing 10am-1pm Advanced Glass Fusing 10am-1pm Beginning Metalsmithing 10am-1pm First-Time Screenprinting on Paper 5-8pm SUNDAY First-Time Potter Beginning/ Intermediate Handbuilding Beginning Soda Beginning/ Advanced Beginning Wheelthrowing 2-5pm

10am- 2-5pm 2-5pm 2-5pm

2-6pm 10am-1pm

10am-1pm 10am-1pm

10am-1pm 10am-1pm

10am-1pm

2-5pm 10am-1pm

10am-1pm

2-5pm

6-9pm

VISIT WWW.LILLSTREET.COM OR CALL 773.769.4226 23 CALL 773.769.4226 OR VISIT WWW.LILLSTREET.COM 23 Katzome Rice Paste Resist Lacy Nuno Felt Saturday Workshop Series First-Time Drawing Introduction to Figure Drawing 10am-1pm Abstract Painting Advanced Figure Oil Painting I Beginning Portrait Drawing Intermediate/ Advanced Portrait Drawing First-Time Knitting First-Time Glass Beadmaking 10am-1pm Beginning Metalsmithing Intermediate Metalsmithing 1pm First-Time Screenprinting on Paper 10am-1pm Intro to Letterpress Image and Text 10am-1pm Ceramic Print: Mix & Match SATURDAY Beginning/ Advanced Beginning Wheelthrowing 10am-1pm Intermediate Wheelthrowing 10am-1pm Advanced Topics Advanced Handbuilding Ceramic Print: Mix & Match 10am-1pm REGISTER TODAY! REGISTER TODAY!

2-5pm 10am-1pm

10am-1pm 6:30-9:30pm

6:30-9:30pm

2-5pm

10am-1pm

Printing T-Shirts Acrylic Painting I Beginning Watercolor Painting & Drawing the Costumed Figure Encaustic Painting Representational Oil Painting First-Time Jeweler Fear of Commitment Glass Beadmaking FRIDAY

2-5pm 2-5pm

6:30-9:30pm

10am-1pm 6:30-9:30pm 6:30-9:30pm

10am-1pm 6:30-9:30pm

6-9pm

6:30-9:30pm

2-5pm 6:30-9:30pm

6:30-9:30pm 6:30-9:30pm 7-10pm

7-10pm 7-10pm 10am-1pm

10am-1pm

6:30-9:30pm

6:30-9:30pm

6:30-9:30pm First-Time Sewing First-Time Screenprinting on Fabric Advanced Sewing Sew I: Garments Figure Drawing Oil Painting I Acrylic Painting I 10am-1pm Color Mixing Beginning Drawing Problem Solving for Oil Painters 6:30-9:30pm Clay Experimental Screenprint Drawing for Plate Lithography Survey of Printmaking Techniques on Intermediate/ Advanced Print Workshop Sticks & Stones Forging & Forming First-Time Jeweler Glass Beadmaking II Junk in the Trunk 10am-1pm First-Time Glass Beadmaking Intermediate Metalsmithing Fusion: Handbuilding & Wheelthrowing Ceramic Tiles Surve of Printmaking Techniques on Clay 10am-1pm First-Time Potter 10am-1pm Figure Sculpture Techniques 10am-1pm Form And Surface: Super-Size Me Beginning/ Advanced Beginning Wheelthrowing THURSDAY

2-5pm

2-5pm

6:30-9:30pm

10am-1pm 6:30-9:30pm 6:30-9:30pm 6:30-9:30pm

6:30-9:30pm

6:30-9:30pm 10am-1pm

6:30-9:30pm 10am-1pm

4-6pm 6:30-9:30pm 10am-1pm & 6:30-9:30pm

6:30-9:30pm 10am-1pm & 6:30-9:30pm 6:30-9:30pm

Intermediate Sewing First-Time Screenprinting on Fabric 2-5pm Fabric Print I Embroidery I Embroidery II Acrylic Painting I Drawing & Painting the Nude Figure 10am-1pm Studio Practices Learning from the Masters First-Time Painter Intuitive Painting & Drawing 6:30-9:30pm Encaustic Painting The Art of the Poster Byzantine Variations Mixed-Media Relief and Monoprint 2-5pm Working with Wax & Casting Tween Metals Beginning Metalsmithing Weaving with Metal Intermediate Metalsmithing 6:30-9:30pm Chain Maille WEDNESDAY Advanced Handbuilding 10am-1pm & 6:30-9:30pm Beginning/ Advanced Beginning Wheelthrowing 10am-1pm & 7-10pm Figure Sculpture andTea Soda

6:30-9:30pm 1-4pm

7-10pm 10am-1pm 10am-1pm 6:30-9:30pm

2-5pm

6:30-9:30pm 10am-1pm

10am-1pm 6:30-9:30pm 6:30-9:30pm

1:30-4:30pm

6:30-9:30pm

Sewing 2-5pm

First-Time Printing with Thickened Dyes 6:30-9:30pm Frame Loom Weaving First-Time Painter Between Paint & Print Beginning Drawing Acrylic Painting II Sew I: Housewares Multilevel Metalsmithing Glass Beadmaking II Beginning Metalsmithing Etching on Metal Ancient Loop-In-Loop Chainmaking 6:30-9:30pm Going in Circles Between Paint & Print Survey of Printmaking Techniques 6:30-9:30pm Ceramic Print: Mix & Match 6:30-9:30pm TUESDAY First-Time Potter Beginning/ Intermediate Handbuilding 1:30-4:30pm & 7-10pm Intermediate Wheelthrowing 10am-1pm & 6:30-9:30pm Ceramic Print: Mix & Match 6:30-9:30pm Beginning/ Advanced Beginning Wheelthrowing 7-10pm Surface Investigations

7-10pm

6:30-9:30pm

2-5pm 6:30-9:30pm 6:30-9:30pm

6:30-9:30pm 10am-1pm

6:30-9:30pm 6:30-9:30pm

7-10pm

6:30-9:30pm 7-10pm

10am-1pm

10am-1pm Beginning Knitting Intermediate Knitting Intermediate Sewing Advanced Screenprinting Oil Painting II First-Time Painter First-Time Drawing Figure Painting in Oil First-Time Screenprinting on Fabric Beginning Metalsmithing Etching & Intaglio MONDAY Home and Garden Pottery 1:30-4:30pm Beginning/ Advanced Beginning Wheelthrowing 11am-2pm & 6:30-9:30pm First-Time Glass Beadmaking 6:30-9:30pm Working with Wax & Casting 6:30-9:30pm 6:30-9:30pm Low Fire Glaze Home Accents Dreams, Myths and Stories Beginning Soda

Textiles Painting & Drawing Printmaking Ceramics Metalsmithing & Jewelry/ Glass IN THE GALLERY

Drink: Functional Forms for Every Libation 2nd Lillstreet International September 14 - October 11, 2009 Opening Reception: September 19, 3-6pm Join us for an Drinking vessels form a vital component of both the potter’s art and everyday life. In our second Open House with competition, we focus on these functional forms free workshops during whether they be tea bowls, flasks, or mugs. Juried the Ravenswood Art Walk, by Beth Lo, Porfessor of Art, University of Montana. October 3 & 4

180º October 2 - 31 Virtual exhibition available at www.lillstreet.com In conjunction with Chicago Artists’ Month, we offer a selection of work from our faculty and students in an online-only exhibition. We’ve asked instructors from each of our six departments to invite their students to join them in this virtual, multimedia show. Visit www.lillstreet.com/gallery.

Harvest Saturday, October 10 Food and art pair together beautifully. Join us for a celebration of both. Chicago artist Cathi Bouzide brings her culturally and agriculturally influenced art to the gallery and pairs it with harvest themed offering from chef Mary-Ellen Diaz. Dinner, drinks, and a ceramic work to take home are included. Please call for reservations.

Dan Anderson & Robert Archambeau October 10 - November 8 Reception: November 6, 6-10pm Dan Anderson brings his exploration of iconic, Midwestern imagery together with the classic, Japanese-inspired work of Robert Archambeau in this exhibition of exceptional clay artists to coincide with SOFA Chicago.

Driven By Lemons Book Release Saturday, October 3 Lillstreet’s own Josh Cotter, author of the graphic novel Skyscrapers of the Midwest, defaces copies of his new book, Driven by Lemons.

Gift Box: the 34th Holiday Show See November 16 - December 31 inside for Holiday Party: December 4, 6-10pm Boxes play an important role in gift giving, sometimes receiving as much attention as the items complete Fall class listings! they conceal. This year we offer containers in clay, paper, cloth, and, more as both gift and gift box, tied with ribbon, and filled with special treats from First Slice Pie Cafe.Visit our gallery shop for even more unique, artist-made works perfect for whomever is on your list.

LILLSTREET ART CENTER • 4401 N. RAVENSWOOD • 773.769.4226 • WWW.LILLSTREET.COM