TWO-DAY AUCTION
ASIAN ART 27TH & 28TH DISCOVERIES FEBRUARY 2020 Two-Day Auction: Asian Art Discoveries
Thursday, February 27th 2020, at 12:00 pm CET (Japanese & Korean Art) Friday, February 28th 2020, at 10:00 am CET (Chinese & Southeast Asian Art) CATALOG AK0220
VIEWING www.zacke.at IN OUR GALLERY Preview: 10. 2. – 28. 2. 2020 Monday to Friday 10 am - 6 pm 27.2 – 10 am - 12 pm 28.2 – 9 am - 10 am and by appointment
GALERIE ZACKE MARIAHILFERSTRASSE 112 1070 VIENNA AUSTRIA
Tel +43 1 532 04 52 Fax +20 E-mail [email protected] Two-Day Auction: Asian Art Discoveries
Thursday, February 27th 2020, at 12:00 pm CET (Japanese & Korean Art) Friday, February 28th 2020, at 10:00 am CET (Chinese & Southeast Asian Art) CATALOG AK0220
VIEWING www.zacke.at IN OUR GALLERY Preview: 10. 2. – 28. 2. 2020 Monday to Friday 10 am - 6 pm 27.2 – 10 am - 12 pm 28.2 – 9 am - 10 am and by appointment
GALERIE ZACKE MARIAHILFERSTRASSE 112 1070 VIENNA AUSTRIA
Tel +43 1 532 04 52 Fax +20 E-mail [email protected] IMPORTANT INFORMATION ABSENTEE BIDDING FORM FOR THE AUCTION ASIAN ART DISCOVERIES AK0220 ON DATE FEBRUARY 27TH & 28TH, 2020, AT 12PM AND 10AM CET RESPECTIVELY
LOT NR. LOT TITLE %Ζ'Ζ1(852
According to the general terms and conditions of business of Galerie Zacke Vienna, Founded 1968, SZA Versteigerungen & Vertriebs GmbH, 1070 Wien, online at www.zacke.at
ABSENTEE BIDDING COLOR AND CONDITION Absentee bids are carried out under the regulations of the terms Auction lots will be exhibited for viewing prior to the auction, thus of business of Galerie Zacke, SZA Versteigerungen & Vertriebs offering all interested customers the opportunity to examine GmbH, which requires written submission of your purchase limit. the quality and condition of the works exhibited. The catalogue Orders without purchase limits cannot be processed. illustrations are intended to assist customers during such preview. Only the submitted lot number of the auction lot is binding for the In illustrations, printed colors do not correspond exactly to the processing of the absentee bid. The place of jurisdiction is Vienna, originals. The printed catalogue images are not representative Austrian Law and Austrian jurisdiction are exclusively applicable for the condition of the illustrated pieces. Flaws and damages are for all legal questions arising from the business relationship. therefore always indicated in the catalogue. The illustrations in the Absentee bids for this auction will be accepted until the day of online catalogue can be strongly magnified, so that damages and auction by 10:00 a.m. We regret that absentee bids received after restorations are usually well recognizable. the time stated above will not be processed until after the auction. ENDANGERED SPECIES / CITES INFORMATION PLEASE SEND ABSENTEE BIDS FOR THIS AUCTION TO: Some items in this catalogue may consist of material such as 3/($6(5$Ζ6(0<%Ζ'%<21(%Ζ''Ζ1* PLEASE CALL ME WHEN A HIGHER Fax: +43 1 532 04 52 20 or for example ivory, rhinoceros-horn, tortoise shell, coral or any INCREMENT (ca. 10%) IF NECESSARY %Ζ'7+$10Ζ1(+$6%((15(&(Ζ9(' Email: [email protected] or rare types of tropical wood, and are therefore subject to the Mail: Galerie Zacke, Mariahilferstrasse 112, Stiege 1, 2. Stock, Convention on International Trade in Endangered Species of Wild 1070 Wien, Austria, Europe Fauna and Flora [CITES]. Such items may only be exported outside IMPORTANT NOTICE: MY PHONE NUMBER the European Union after an export permit in accordance with %LGVGRQRWLQFOXGHEX\HUvVSUHPLXPDQGRU9$7 WE ACCEPT THE FOLLOWING METHODS OF PAYMENTS: CITES has been granted by the Austrian authorities. ȏ&DVK We would like to inform you that such licenses are typically not TELEPHONE BIDS: ȏ&HUWLILHGRUSHUVRQDOFKHFN granted. For Objects which have a low ivory content or have been ΖI\RXOLNHWRELGE\WHOHSKRQHSOHDVHVWDWHȆ7(/ȇLQWKHȆ%Ζ'Ζ1(852ȇFROXPQLQVWHDGRID(XURDPRXQW*DOHULH=DFNHZLOOFDOO\RXRQWKHGD\ ȏ%DQNWUDQVIHU SOHDVHLQTXLUHWRUHFHLYH proven beyond doubt to be in the EU before 1982 please contact of the auction, on the telephone number provided, 5 lots before the lot you are bidding on and the bidding will commence at the starting our bank account information) our office for more information on how to obtain a CITES license. price, as stated in the catalog. If Galerie Zacke cannot reach you during the auction, Galerie Zacke will bid up to the estimate on your behalf. ȏ&UHGLWFDUG 9LVD0DVWHU&DUG$PH['LQHUV&OXE COMPLAINTS TELEPHONE BIDDING At its auctions, Galerie Zacke sells consigned lots on behalf of TERMS OF PAYMENT, SHIPPING AND COLLECTION: It is generally possible to bid by telephone during the auction. Please third-party consignors. For this reason, any complaints related fill out the absentee bidding form enclosed in this catalogue and to purchased lots must be reported to Galerie Zacke within 6 include your telephone number at which you can be reached during weeks after the receipt of such lot. Our complete general terms NAME EMAIL the auction. In the “bid in euro” column please write “TEL” and then and conditions of business can be found on our website www. send us the completed absentee bidding form. We will contact you zacke.at by telephone during the auction, whereby you will be able to bid ADRESS directly. Please keep in mind that such telephone bids are always THE ART LOSS REGISTER classified as a bid equivalent to the estimate. Should no other person All items starting above 2.000,- EUR have been checked by the Art bid for the specified lot, you will automatically win the bidding and Loss Register. CITY, COUNTRY With the signature on this form, the client instructs the auctioneer to bid on his behalf. The Euro amount up to which the respective lot will be knocked down at the estimate price. the auctioneer shall bid on behalf of the client is either stated in this form or will be communicated to the auctioneer via telephone during the auction. All absentee bidding shall be governed by the terms and conditions [AGB] of Galerie FURTHER IMAGES Zacke. The client agrees with his signature that he has read, understood and fully accepted the AGB of Galerie Zacke. ESTIMATES AND STARTING PRICES More images of all lots can be found at: www.zacke.at POSTCODE Galerie Zacke, founded 1968, is a registered brand of SZA Versteigerungen & Vertriebs GmbH, Vienna, Austria. The auction will begin with the starting price and written bids will be accepted only with a minimum amount equivalent to the starting price. PHONE NUMBER DATE & SIGNATURE
SHIPPING AND TRANSPORT INSURANCE For domestic shipping Galerie Zacke (hereinafter called “the company”) charges in average EUR 15,- to EUR 50,- per item, depending on size and weight. These fees cover the costs of packing CREDIT CARD PAYMENT AMEX DINERS MASTERCARD VISA and shipping. Fees for bulky or fragile items, or international shipping PLEASE CHECK THE DESIRED CARD will be quoted upon request. COLLECTION BY CLIENT The purchased goods are transported at the risk of the WITH PAYMENT ON THE PREMISES NAME customer following handover of the packaged item to the IN CASH, BY CERTIFIED CHEQUE OR CREDIT CARD post office or another carrier which the customer agrees to through his/her submission of the purchase order. According INVOICE PAYMENT ADDRESS to the specific wish of the customer, the auctioned goods may VIA BANK WIRE AFTER RECEIPT OF INVOICE be insured for the value of the purchase price (highest bid SHIPPING AFTER RECEIPT OF PAYMENT and all surcharges). This insurance fee is 3% of the purchase CARD NUMBER price. For any lots with purchase prices exceeding EUR 350,- EXPRESS PARCEL SERVICE the transport insurance will be automatically arranged by the REQUIRED (ACCORDING TO TERMS company if it does not expressively receive the purchaser´s written AND CONDITIONS OF GALERIE ZACKE) EXPIRY DATE SECURITY CODE denial of this service. Payments due to the company under the insurance contract will be charged to the customer. The company SHIPPING INSURANCE is also entitled to assign claims under the insurance contract to REQUIRED (ACCORDING TO TERMS the customer providing the terms of the insurance contract do not AND CONDITIONS OF GALERIE ZACKE) prevent this. In any case, the company is only required to make payment to the customer specifically if payment has effectively been received GALERIE ZACKE from the insurance company. IMPORTANT NOTICE: Mariahilferstrasse 112, 1070 Vienna, At its auctions, Galerie Zacke sells consigned lots on behalf of Austria third-party consignors. For this reason, any complaints related Email: [email protected] to purchased lots must be reported to Galerie Zacke within 6 Tel: +43-1-532 04 52 weeks after the receipt of such lot. Fax: +43-1-532 04 52 20 IMPORTANT INFORMATION ABSENTEE BIDDING FORM FOR THE AUCTION ASIAN ART DISCOVERIES AK0220 ON DATE FEBRUARY 27TH & 28TH, 2020, AT 12PM AND 10AM CET RESPECTIVELY
LOT NR. LOT TITLE %Ζ'Ζ1(852
According to the general terms and conditions of business of Galerie Zacke Vienna, Founded 1968, SZA Versteigerungen & Vertriebs GmbH, 1070 Wien, online at www.zacke.at
ABSENTEE BIDDING COLOR AND CONDITION Absentee bids are carried out under the regulations of the terms Auction lots will be exhibited for viewing prior to the auction, thus of business of Galerie Zacke, SZA Versteigerungen & Vertriebs offering all interested customers the opportunity to examine GmbH, which requires written submission of your purchase limit. the quality and condition of the works exhibited. The catalogue Orders without purchase limits cannot be processed. illustrations are intended to assist customers during such preview. Only the submitted lot number of the auction lot is binding for the In illustrations, printed colors do not correspond exactly to the processing of the absentee bid. The place of jurisdiction is Vienna, originals. The printed catalogue images are not representative Austrian Law and Austrian jurisdiction are exclusively applicable for the condition of the illustrated pieces. Flaws and damages are for all legal questions arising from the business relationship. therefore always indicated in the catalogue. The illustrations in the Absentee bids for this auction will be accepted until the day of online catalogue can be strongly magnified, so that damages and auction by 10:00 a.m. We regret that absentee bids received after restorations are usually well recognizable. the time stated above will not be processed until after the auction. ENDANGERED SPECIES / CITES INFORMATION PLEASE SEND ABSENTEE BIDS FOR THIS AUCTION TO: Some items in this catalogue may consist of material such as 3/($6(5$Ζ6(0<%Ζ'%<21(%Ζ''Ζ1* PLEASE CALL ME WHEN A HIGHER Fax: +43 1 532 04 52 20 or for example ivory, rhinoceros-horn, tortoise shell, coral or any INCREMENT (ca. 10%) IF NECESSARY %Ζ'7+$10Ζ1(+$6%((15(&(Ζ9(' Email: [email protected] or rare types of tropical wood, and are therefore subject to the Mail: Galerie Zacke, Mariahilferstrasse 112, Stiege 1, 2. Stock, Convention on International Trade in Endangered Species of Wild 1070 Wien, Austria, Europe Fauna and Flora [CITES]. Such items may only be exported outside IMPORTANT NOTICE: MY PHONE NUMBER the European Union after an export permit in accordance with %LGVGRQRWLQFOXGHEX\HUvVSUHPLXPDQGRU9$7 WE ACCEPT THE FOLLOWING METHODS OF PAYMENTS: CITES has been granted by the Austrian authorities. ȏ&DVK We would like to inform you that such licenses are typically not TELEPHONE BIDS: ȏ&HUWLILHGRUSHUVRQDOFKHFN granted. For Objects which have a low ivory content or have been ΖI\RXOLNHWRELGE\WHOHSKRQHSOHDVHVWDWHȆ7(/ȇLQWKHȆ%Ζ'Ζ1(852ȇFROXPQLQVWHDGRID(XURDPRXQW*DOHULH=DFNHZLOOFDOO\RXRQWKHGD\ ȏ%DQNWUDQVIHU SOHDVHLQTXLUHWRUHFHLYH proven beyond doubt to be in the EU before 1982 please contact of the auction, on the telephone number provided, 5 lots before the lot you are bidding on and the bidding will commence at the starting our bank account information) our office for more information on how to obtain a CITES license. price, as stated in the catalog. If Galerie Zacke cannot reach you during the auction, Galerie Zacke will bid up to the estimate on your behalf. ȏ&UHGLWFDUG 9LVD0DVWHU&DUG$PH['LQHUV&OXE COMPLAINTS TELEPHONE BIDDING At its auctions, Galerie Zacke sells consigned lots on behalf of TERMS OF PAYMENT, SHIPPING AND COLLECTION: It is generally possible to bid by telephone during the auction. Please third-party consignors. For this reason, any complaints related fill out the absentee bidding form enclosed in this catalogue and to purchased lots must be reported to Galerie Zacke within 6 include your telephone number at which you can be reached during weeks after the receipt of such lot. Our complete general terms NAME EMAIL the auction. In the “bid in euro” column please write “TEL” and then and conditions of business can be found on our website www. send us the completed absentee bidding form. We will contact you zacke.at by telephone during the auction, whereby you will be able to bid ADRESS directly. Please keep in mind that such telephone bids are always THE ART LOSS REGISTER classified as a bid equivalent to the estimate. Should no other person All items starting above 2.000,- EUR have been checked by the Art bid for the specified lot, you will automatically win the bidding and Loss Register. CITY, COUNTRY With the signature on this form, the client instructs the auctioneer to bid on his behalf. The Euro amount up to which the respective lot will be knocked down at the estimate price. the auctioneer shall bid on behalf of the client is either stated in this form or will be communicated to the auctioneer via telephone during the auction. All absentee bidding shall be governed by the terms and conditions [AGB] of Galerie FURTHER IMAGES Zacke. The client agrees with his signature that he has read, understood and fully accepted the AGB of Galerie Zacke. ESTIMATES AND STARTING PRICES More images of all lots can be found at: www.zacke.at POSTCODE Galerie Zacke, founded 1968, is a registered brand of SZA Versteigerungen & Vertriebs GmbH, Vienna, Austria. The auction will begin with the starting price and written bids will be accepted only with a minimum amount equivalent to the starting price. PHONE NUMBER DATE & SIGNATURE
SHIPPING AND TRANSPORT INSURANCE For domestic shipping Galerie Zacke (hereinafter called “the company”) charges in average EUR 15,- to EUR 50,- per item, depending on size and weight. These fees cover the costs of packing CREDIT CARD PAYMENT AMEX DINERS MASTERCARD VISA and shipping. Fees for bulky or fragile items, or international shipping PLEASE CHECK THE DESIRED CARD will be quoted upon request. COLLECTION BY CLIENT The purchased goods are transported at the risk of the WITH PAYMENT ON THE PREMISES NAME customer following handover of the packaged item to the IN CASH, BY CERTIFIED CHEQUE OR CREDIT CARD post office or another carrier which the customer agrees to through his/her submission of the purchase order. According INVOICE PAYMENT ADDRESS to the specific wish of the customer, the auctioned goods may VIA BANK WIRE AFTER RECEIPT OF INVOICE be insured for the value of the purchase price (highest bid SHIPPING AFTER RECEIPT OF PAYMENT and all surcharges). This insurance fee is 3% of the purchase CARD NUMBER price. For any lots with purchase prices exceeding EUR 350,- EXPRESS PARCEL SERVICE the transport insurance will be automatically arranged by the REQUIRED (ACCORDING TO TERMS company if it does not expressively receive the purchaser´s written AND CONDITIONS OF GALERIE ZACKE) EXPIRY DATE SECURITY CODE denial of this service. Payments due to the company under the insurance contract will be charged to the customer. The company SHIPPING INSURANCE is also entitled to assign claims under the insurance contract to REQUIRED (ACCORDING TO TERMS the customer providing the terms of the insurance contract do not AND CONDITIONS OF GALERIE ZACKE) prevent this. In any case, the company is only required to make payment to the customer specifically if payment has effectively been received GALERIE ZACKE from the insurance company. IMPORTANT NOTICE: Mariahilferstrasse 112, 1070 Vienna, At its auctions, Galerie Zacke sells consigned lots on behalf of Austria third-party consignors. For this reason, any complaints related Email: [email protected] to purchased lots must be reported to Galerie Zacke within 6 Tel: +43-1-532 04 52 weeks after the receipt of such lot. Fax: +43-1-532 04 52 20 ABSENTEE BIDDING FORM 50 YEARS GALLERY ZACKE FOR THE AUCTION ASIAN ART DISCOVERIES AK0220 ON DATE FEBRUARY 27TH & 28TH, 2020, AT 12PM AND 10AM CET RESPECTIVELY
LOT NR. LOT TITLE %Ζ'Ζ1(852
HOW TO FIND US ON MARIAHILFERSTRASSE: Apollogasse West- bahnhof
Neubaugürtel BY PUBLIC TRANSPORT: U3 GALERIE U6 Kaiserstraße ZACKE 2-3 minutes from the U3 station ZIEGLERGASSE
112 Zieglergasse
Schottenfeldgasse Mariahilferstraße U3 3-5 minutes from the U3/U6 station WESTBAHNHOF
GÜRTEL
Stumpergasse BY CAR:
Webgasse %HVWURXWHWDNHWKH*¾UWHOWRWKH:HVWEDKQKRIDQG Schmalzhofgasse turn onto Mariahilferstraße; house number 112 is just Mittelgasse after the Kaiserstraße.
Mariahilfergürtel Access is possible by car, with loading and unloading all day as well as short term parking. Multiple garages directly nearby.
ADDRESS: Mariahilferstr. 112 1070 Vienna STAIRCASE 1, 2nd FLOOR (ELEVATOR)
Further images of all lots at: www.zacke.at ABSENTEE BIDDING FORM 50 YEARS GALLERY ZACKE FOR THE AUCTION ASIAN ART DISCOVERIES AK0220 ON DATE FEBRUARY 27TH & 28TH, 2020, AT 12PM AND 10AM CET RESPECTIVELY
LOT NR. LOT TITLE %Ζ'Ζ1(852
HOW TO FIND US ON MARIAHILFERSTRASSE: Apollogasse West- bahnhof
Neubaugürtel BY PUBLIC TRANSPORT: U3 GALERIE U6 Kaiserstraße ZACKE 2-3 minutes from the U3 station ZIEGLERGASSE
112 Zieglergasse
Schottenfeldgasse Mariahilferstraße U3 3-5 minutes from the U3/U6 station WESTBAHNHOF
GÜRTEL
Stumpergasse BY CAR:
Webgasse %HVWURXWHWDNHWKH*¾UWHOWRWKH:HVWEDKQKRIDQG Schmalzhofgasse turn onto Mariahilferstraße; house number 112 is just Mittelgasse after the Kaiserstraße.
Mariahilfergürtel Access is possible by car, with loading and unloading all day as well as short term parking. Multiple garages directly nearby.
ADDRESS: Mariahilferstr. 112 1070 Vienna STAIRCASE 1, 2nd FLOOR (ELEVATOR)
Further images of all lots at: www.zacke.at TERMS OF AUCTION CONTENT
§ 1) The auction shall be carried out in accordance with the provisions of the rules of procedure § 11) If a customer is not able to participate in an auction personally, the company shall ac- of GALERIE ZACKE ©, SZA VERSTEIGERUNGEN UND VERTRIEBS GMBH, MARIAHILFERSTRASSE cept purchase orders. These orders may be placed in writing, via email or fax. In the case of a 112, 1070 WIEN (hereinafter referred to as the company) as well as in accordance with sections purchase order placed by phone or orally, the company shall reserve the right to make the per- 244-246 of the GEWERBEORDNUNG [Industrial Code] of 1994. The auction shall be carried out formance dependent on a confirmation from the principal communicated in writing, via email on commission. The auctioneer shall be entitled to withdraw lots exceptionally, to conduct the or fax. Furthermore, the company shall not be liable for the performance of purchase orders. AUCTION DAY 1 auction deviating from the order of the catalogue numbers and to offer lots jointly. In the event Purchase orders with equal top bid limits will be considered in the order of their receipt. Bids of any dispute concerning a double bid or if the auctioneer has missed a bid, the auctioneer which are only one increment above the starting price shall be exhausted totally. Bids which shall be entitled to revoke acceptance of a bid and to continue auctioning the item. The figures do not correspond to the increments determined by the company (see bidding increment) in Thursday, February 27th at 12:00 PM CET stated in the catalogue shall be the highest bid in Euro (€) expected by the respective expert. As tabular form will be rounded up to the next higher increment. The table of these increments a rule, the bid shall be increased by 10% of the last bid. (See table of the bidding increments). can be sent upon request. In the case of lots auctioned “without any limits”, bids below the JAPANESE & KOREAN ART Lots 1 to 387 ...... Page 10 § 2) estimated price shall be exhausted totally. The written bid (purchase order) must include the The acceptance of a bid shall be granted to the highest bidder unless a hidden reserve has item stating the catalogue number and the offered top bid limit which is quoted as the amount been agreed upon with the consignor of the item in question. Such a hidden reserve (also called of the acceptance of the bid without buyer´s commission and without value added tax. limit or just reserve) shall be the minimum price under which the item will not be sold during the auction. This reserve will be disclosed upon request only and may exceed the estimate. The Ambiguities shall be carried by the bidder. A purchase order which has already been placed auctioneer will in this case bid on behalf of the seller against all other bidders until the reserve may only be cancelled if the written withdrawal is received by the company at least 72 hours has been reached. If a reserve is not reached during the auction, the auctioneer will knock down prior to the beginning of the auction. the item to the highest bidder at the final bid, but the sale will be conditional of the acceptance § 12) of this final bid by the seller. In this case the highest bidder shall be bound to his/her last bid for The company may refuse to process a purchase order without explanation until offer- a term of 8 days starting with the day of the knockdown. If the winning bidder does not receive ing or make this dependent on payment of a deposit. In the event of an unsuccessful order, a written cancellation notice within this term of 8 days, the knockdown becomes unconditional such a deposit will be reimbursed by the company within 5 working days. Processing of and the sale is final. Typically, only a minority of all items in an auction have a hidden reserve. purchase orders is free of charge. § 13) § 3) All items shall be subject to differential taxation. A uniform surcharge of 22% plus the Every contributor shall in principle be entitled to withdraw the items offered for AUCTION DAY 2 value added tax applicable to the surcharge to the amount of 20% shall be added to the auction until the start of the auction. Therefore, it is impossible to assume liability or to give achieved highest bid (final and highest bid). Thus, the surcharge shall be 26.4% of the final warranty for the actual offering. and highest bid in total. § 14) Items paid must be collected within 30 days of payment. Items which have not been Friday, February 28th at 10:00 AM CET § 4) In the event of sales abroad, the value added tax will be repaid if the item is sold to a collected may be delivered without further communication at a starting price from the re- country which is not a member country of the European Union (third country), the legal re- cent auction reduced by 50% after 30 days from the respective auction date. Items which CHINESE & SOUTHEAST ASIAN ART Lots 388 - 857 ...... Page 124 quirements are met, and the proof of exportation is provided. The value added tax shall not be have not been collected within 3 (three) working days after the auction or for which the shown separately on the invoice. company does not receive any proper shipping instructions stating the type of shipping and the address of dispatch (independent of a possibly placed purchase order) within 3 (three) § 5) The auction buyer must pay the purchase price immediately upon acceptance of the bid working days after the auction shall be stored at the owner´s risk. (final and highest bid plus 22% surcharge, plus the value added tax applicable to the surcharge to the amount of 20%). However, the company may grant the auction buyer a respite for the Furthermore, the company shell be entitled to store item which have been purchased at payment of the purchase price in whole or in part in individual cases. If a respite is refused, auction and paid but not collected at the buyer´s risk and expense, including the costs for the acceptance of the bid may be revoked, and the item may be reoffered. In the event of an insurance, with a forwarding agency. It shall be understood that the provision concerning revocation of the acceptance of the bid, the company shall be entitled to accept the last bid the re-auctioning of unpaid and paid but not collected items must also apply to items not from the underbidder. exhibited or stored on the premises of the company. The ownership shall be transferred the buyer at the time of handing over the delivery note. § 6) In the event of respite in whole or in part, the company shall be entitled to charge default § 15) interest (12% p.a.) as well as storage charges (2.4% pf the final and highest bid per month In the case of mixed lots with a starting price of less than EUR 350.00, the company commenced) after 14 days upon acceptance of the bid. The item purchased at auction shall be shall not warrant for the completeness or correctness of the individual items within a mixed handed over exclusively upon full payment of the purchase price including all costs and charges lot. accrued since the acceptance of the bid. § 16) A registration for a bid by telephone for one or several items shall automatically § 7) The buyer can take acquired items in possession, as far as possible, immediately or after represent a bid at the starting prices for these items. If the company cannot reach the bidder the end of the auction. Items which have been fully paid for shall be handed over in our show by telephone, it will bid on behalf of the bidder by phone up to the starting price when the rooms in GALERIE ZACKE, MAIAHILFERSTRASSE 112, 1070 VIENNA. If a deferred purchase price respective auction lot is called. is not paid within the set period, the company shall be entitled to auction the item again in § 17) Payments made to the company by mistake (through the payer´s fault) (e.g. due to order to recoup its claim from the defaulting auction buyer. In this case, the defaulting auction miscalculation of the exchange rate by the payer) or payments made to the company for buyer shall be liable to the company for the total loss of commission incurred by the company the same invoice several times shall be compensated in form of a credit note for goods for due to the re-auctioning as well as for any default interest and storage charges. an indefinite period of time. The repayment of such payments in cash shall be excluded. § 8) The company shall be entitled to a lien on all items of the buyer irrespective of whether § 18) In the case of individual auction lots, it may happen that they are delivered sev- the buyer bought them within the scope of an auction or in free sale or the company secured eral times. In such a case, the auctioneer may accept a second or third etc. bid from the ownership of these items otherwise. This lien shall serve to secure all current and future, quali- underbidder(s) In this case, the text om the catalogue and not the illustration in the cata- fied, limited and unmatured claims to which the company is entitled and which result from all logue shall also be exclusively binding with regard to the warranty (relating to these auction legal transactions concluded with the buyer. lots). § 9) The items received for auction will be exhibited and may be viewed prior to the auction. In § 19) When making a bid, whether personally, in writing or by telephone, the bidder shall doing so, the company shall give everyone the opportunity to check the nature and the condition acknowledge these terms of auction, the AGB (General Terms and Conditions) as well as the of the exhibited items to the extent deemed possible within the scope of the exhibition. Every rules of procedure and the schedule of fees (as amended) of the company. bidder shall be deemed to act on its own behalf uncles it provides a written confirmation saying that it acts as a representative of a well-known principal. The company may refuse bids; this § 20) The place of performance of the contract brought about between the company on the shall particularly apply if a bidder who is unknown to the company or with whom the company one hand and the seller as well as the buyer on the other hand shall be the place of business has no business connections yet does not provide security by the beginning of the auction at the of the company. The legal relationships and contracts existing between the company, the latest. However, in principle there shall be no claim to accept a bid. If a bid has been refused, sellers and the buyers shall be subject to the Austrian substantive law. The company, the the previous bid shall remain effective. sellers and the buyers shall agree to settle all disputes resulting from, concerning and in connection with this contract before the territorially competent court of Vienna. § 10) The company’s experts evaluate and describe the items received for auction and deter- mine the starting prices uncles otherwise stated in the catalogue or expert opinion. The infor- § 21) The export of art objects from Austria, when indicated, shall require a permit from mation concerning production technique or material, state of preservation, origin, design and the Bundesdenkmalamt [Federal Monuments Office]. In any event, the company shall age3 of an item is based on published or otherwise generally accessible (scientific) findings orally provide information about art objects for which an export permit will probably not be concluded by the company’s expert with the necessary care and accuracy. The company shall granted at the beginning of the auction. warrant to the buyer according to §22 of the AGB (General Terms and Conditions) that proper- § 22) ties are correct provided that any possible complaints referring to this are made within four The company reserves the right to assign to the customer all rights and obligations weeks upon their taking into possession. Subsequent complaints shall be excluded in principle. resulting from the contractual relationship between the company and the contributor by a The company shall not be liable for any further information in the catalogue and expert opinion way of a respective declaration, as well to assign to the contributor all rights and obligations as well. This shall also apply to illustrations in the catalogue. The purpose of these illustrations resulting from the contractual relationship between the company and the customer by way is to guide the potential buyer during the preview. They shall not be authoritative for the condi- of a respective declaration, in each case in terms of a complete assignment of contract with tion or the characteristics of the pictured item. The catalogue and the expert opinions shall only the result that the contractual relationship-following the submission of the aforementioned mention defects and damage affecting the artistic or commercial value significantly. Complaints declarations by the company – shall exclusively be between the contributor and the custom- concerning the price shall be excluded upon acceptance of the bid. The company reserves the er, which is in accordance with the basic model of the commission agreement. Customers right to amend catalogue information prior to the auction. These amendments shall be made and contributors shall already now give their explicit consent to this contract assignment. either by a written notice at the place of auction or orally by the auctioneer immediately prior to offering of the respective item. In this case, the company shall be liable for the amendment only. All items offered may be checked prior to the auction. These items are used. Any claims for damages exceeding the liability named above and resulting from other material defects or other defects of the item shall be excluded. When making the bid, the bidder confirms that it has seen the item prior to the auction and has made sure that the item corresponds to the description.
6 7 TERMS OF AUCTION CONTENT
§ 1) The auction shall be carried out in accordance with the provisions of the rules of procedure § 11) If a customer is not able to participate in an auction personally, the company shall ac- of GALERIE ZACKE ©, SZA VERSTEIGERUNGEN UND VERTRIEBS GMBH, MARIAHILFERSTRASSE cept purchase orders. These orders may be placed in writing, via email or fax. In the case of a 112, 1070 WIEN (hereinafter referred to as the company) as well as in accordance with sections purchase order placed by phone or orally, the company shall reserve the right to make the per- 244-246 of the GEWERBEORDNUNG [Industrial Code] of 1994. The auction shall be carried out formance dependent on a confirmation from the principal communicated in writing, via email on commission. The auctioneer shall be entitled to withdraw lots exceptionally, to conduct the or fax. Furthermore, the company shall not be liable for the performance of purchase orders. AUCTION DAY 1 auction deviating from the order of the catalogue numbers and to offer lots jointly. In the event Purchase orders with equal top bid limits will be considered in the order of their receipt. Bids of any dispute concerning a double bid or if the auctioneer has missed a bid, the auctioneer which are only one increment above the starting price shall be exhausted totally. Bids which shall be entitled to revoke acceptance of a bid and to continue auctioning the item. The figures do not correspond to the increments determined by the company (see bidding increment) in Thursday, February 27th at 12:00 PM CET stated in the catalogue shall be the highest bid in Euro (€) expected by the respective expert. As tabular form will be rounded up to the next higher increment. The table of these increments a rule, the bid shall be increased by 10% of the last bid. (See table of the bidding increments). can be sent upon request. In the case of lots auctioned “without any limits”, bids below the JAPANESE & KOREAN ART Lots 1 to 387 ...... Page 10 § 2) estimated price shall be exhausted totally. The written bid (purchase order) must include the The acceptance of a bid shall be granted to the highest bidder unless a hidden reserve has item stating the catalogue number and the offered top bid limit which is quoted as the amount been agreed upon with the consignor of the item in question. Such a hidden reserve (also called of the acceptance of the bid without buyer´s commission and without value added tax. limit or just reserve) shall be the minimum price under which the item will not be sold during the auction. This reserve will be disclosed upon request only and may exceed the estimate. The Ambiguities shall be carried by the bidder. A purchase order which has already been placed auctioneer will in this case bid on behalf of the seller against all other bidders until the reserve may only be cancelled if the written withdrawal is received by the company at least 72 hours has been reached. If a reserve is not reached during the auction, the auctioneer will knock down prior to the beginning of the auction. the item to the highest bidder at the final bid, but the sale will be conditional of the acceptance § 12) of this final bid by the seller. In this case the highest bidder shall be bound to his/her last bid for The company may refuse to process a purchase order without explanation until offer- a term of 8 days starting with the day of the knockdown. If the winning bidder does not receive ing or make this dependent on payment of a deposit. In the event of an unsuccessful order, a written cancellation notice within this term of 8 days, the knockdown becomes unconditional such a deposit will be reimbursed by the company within 5 working days. Processing of and the sale is final. Typically, only a minority of all items in an auction have a hidden reserve. purchase orders is free of charge. § 13) § 3) All items shall be subject to differential taxation. A uniform surcharge of 22% plus the Every contributor shall in principle be entitled to withdraw the items offered for AUCTION DAY 2 value added tax applicable to the surcharge to the amount of 20% shall be added to the auction until the start of the auction. Therefore, it is impossible to assume liability or to give achieved highest bid (final and highest bid). Thus, the surcharge shall be 26.4% of the final warranty for the actual offering. and highest bid in total. § 14) Items paid must be collected within 30 days of payment. Items which have not been Friday, February 28th at 10:00 AM CET § 4) In the event of sales abroad, the value added tax will be repaid if the item is sold to a collected may be delivered without further communication at a starting price from the re- country which is not a member country of the European Union (third country), the legal re- cent auction reduced by 50% after 30 days from the respective auction date. Items which CHINESE & SOUTHEAST ASIAN ART Lots 388 - 857 ...... Page 124 quirements are met, and the proof of exportation is provided. The value added tax shall not be have not been collected within 3 (three) working days after the auction or for which the shown separately on the invoice. company does not receive any proper shipping instructions stating the type of shipping and the address of dispatch (independent of a possibly placed purchase order) within 3 (three) § 5) The auction buyer must pay the purchase price immediately upon acceptance of the bid working days after the auction shall be stored at the owner´s risk. (final and highest bid plus 22% surcharge, plus the value added tax applicable to the surcharge to the amount of 20%). However, the company may grant the auction buyer a respite for the Furthermore, the company shell be entitled to store item which have been purchased at payment of the purchase price in whole or in part in individual cases. If a respite is refused, auction and paid but not collected at the buyer´s risk and expense, including the costs for the acceptance of the bid may be revoked, and the item may be reoffered. In the event of an insurance, with a forwarding agency. It shall be understood that the provision concerning revocation of the acceptance of the bid, the company shall be entitled to accept the last bid the re-auctioning of unpaid and paid but not collected items must also apply to items not from the underbidder. exhibited or stored on the premises of the company. The ownership shall be transferred the buyer at the time of handing over the delivery note. § 6) In the event of respite in whole or in part, the company shall be entitled to charge default § 15) interest (12% p.a.) as well as storage charges (2.4% pf the final and highest bid per month In the case of mixed lots with a starting price of less than EUR 350.00, the company commenced) after 14 days upon acceptance of the bid. The item purchased at auction shall be shall not warrant for the completeness or correctness of the individual items within a mixed handed over exclusively upon full payment of the purchase price including all costs and charges lot. accrued since the acceptance of the bid. § 16) A registration for a bid by telephone for one or several items shall automatically § 7) The buyer can take acquired items in possession, as far as possible, immediately or after represent a bid at the starting prices for these items. If the company cannot reach the bidder the end of the auction. Items which have been fully paid for shall be handed over in our show by telephone, it will bid on behalf of the bidder by phone up to the starting price when the rooms in GALERIE ZACKE, MAIAHILFERSTRASSE 112, 1070 VIENNA. If a deferred purchase price respective auction lot is called. is not paid within the set period, the company shall be entitled to auction the item again in § 17) Payments made to the company by mistake (through the payer´s fault) (e.g. due to order to recoup its claim from the defaulting auction buyer. In this case, the defaulting auction miscalculation of the exchange rate by the payer) or payments made to the company for buyer shall be liable to the company for the total loss of commission incurred by the company the same invoice several times shall be compensated in form of a credit note for goods for due to the re-auctioning as well as for any default interest and storage charges. an indefinite period of time. The repayment of such payments in cash shall be excluded. § 8) The company shall be entitled to a lien on all items of the buyer irrespective of whether § 18) In the case of individual auction lots, it may happen that they are delivered sev- the buyer bought them within the scope of an auction or in free sale or the company secured eral times. In such a case, the auctioneer may accept a second or third etc. bid from the ownership of these items otherwise. This lien shall serve to secure all current and future, quali- underbidder(s) In this case, the text om the catalogue and not the illustration in the cata- fied, limited and unmatured claims to which the company is entitled and which result from all logue shall also be exclusively binding with regard to the warranty (relating to these auction legal transactions concluded with the buyer. lots). § 9) The items received for auction will be exhibited and may be viewed prior to the auction. In § 19) When making a bid, whether personally, in writing or by telephone, the bidder shall doing so, the company shall give everyone the opportunity to check the nature and the condition acknowledge these terms of auction, the AGB (General Terms and Conditions) as well as the of the exhibited items to the extent deemed possible within the scope of the exhibition. Every rules of procedure and the schedule of fees (as amended) of the company. bidder shall be deemed to act on its own behalf uncles it provides a written confirmation saying that it acts as a representative of a well-known principal. The company may refuse bids; this § 20) The place of performance of the contract brought about between the company on the shall particularly apply if a bidder who is unknown to the company or with whom the company one hand and the seller as well as the buyer on the other hand shall be the place of business has no business connections yet does not provide security by the beginning of the auction at the of the company. The legal relationships and contracts existing between the company, the latest. However, in principle there shall be no claim to accept a bid. If a bid has been refused, sellers and the buyers shall be subject to the Austrian substantive law. The company, the the previous bid shall remain effective. sellers and the buyers shall agree to settle all disputes resulting from, concerning and in connection with this contract before the territorially competent court of Vienna. § 10) The company’s experts evaluate and describe the items received for auction and deter- mine the starting prices uncles otherwise stated in the catalogue or expert opinion. The infor- § 21) The export of art objects from Austria, when indicated, shall require a permit from mation concerning production technique or material, state of preservation, origin, design and the Bundesdenkmalamt [Federal Monuments Office]. In any event, the company shall age3 of an item is based on published or otherwise generally accessible (scientific) findings orally provide information about art objects for which an export permit will probably not be concluded by the company’s expert with the necessary care and accuracy. The company shall granted at the beginning of the auction. warrant to the buyer according to §22 of the AGB (General Terms and Conditions) that proper- § 22) ties are correct provided that any possible complaints referring to this are made within four The company reserves the right to assign to the customer all rights and obligations weeks upon their taking into possession. Subsequent complaints shall be excluded in principle. resulting from the contractual relationship between the company and the contributor by a The company shall not be liable for any further information in the catalogue and expert opinion way of a respective declaration, as well to assign to the contributor all rights and obligations as well. This shall also apply to illustrations in the catalogue. The purpose of these illustrations resulting from the contractual relationship between the company and the customer by way is to guide the potential buyer during the preview. They shall not be authoritative for the condi- of a respective declaration, in each case in terms of a complete assignment of contract with tion or the characteristics of the pictured item. The catalogue and the expert opinions shall only the result that the contractual relationship-following the submission of the aforementioned mention defects and damage affecting the artistic or commercial value significantly. Complaints declarations by the company – shall exclusively be between the contributor and the custom- concerning the price shall be excluded upon acceptance of the bid. The company reserves the er, which is in accordance with the basic model of the commission agreement. Customers right to amend catalogue information prior to the auction. These amendments shall be made and contributors shall already now give their explicit consent to this contract assignment. either by a written notice at the place of auction or orally by the auctioneer immediately prior to offering of the respective item. In this case, the company shall be liable for the amendment only. All items offered may be checked prior to the auction. These items are used. Any claims for damages exceeding the liability named above and resulting from other material defects or other defects of the item shall be excluded. When making the bid, the bidder confirms that it has seen the item prior to the auction and has made sure that the item corresponds to the description.
6 7 DAY 1 Japanese & Korean Art Lots 1 to 387
FURTHER IMAGES OF ALL LOTS AT … www.zacke.at
8 9 DAY 1 Japanese & Korean Art Lots 1 to 387
FURTHER IMAGES OF ALL LOTS AT … www.zacke.at
8 9 1 | A LARGE AND SPECTACULAR 3 | A BRONZE FIGURAL GROUP SILVER AND GOLD INLAID KORO (INCENSE Japan, Meiji period (1868-1912) BURNER)
Japan, 18th century, Edo period (1615-1868) Consisting of 4 pieces: The base finely casted with JUDVVHVDQGSODQWVWKHWZR%LMLQVWDQGLQJQH[W to a tree that culminates in a large flower which 7KHHODERUDWHVHFWLRQDOERG\bFRQVLVWLQJRIPDQ\ serves as a container. bronze pieces. The top-section which holds the incense shows a confronting tiger and dragon HEIGHT 36 cm on one side, and two confronting phoenixes on WEIGHT 7.5 kilogram the other. The koro is held by a rock and sits on a four-legged stand with phoenix heads, finally Condition: Worn condition, two hands and one the whole group stands upon an octagonal leaf restored, one foot and one leaf lost. bronze base. The lid of the Koro is surmounted Provenance: Hungarian private collection. by a figure of Kirin. The entire bronze is worked in silver wire and inlays of rich gold and shows Estimate EUR 700,- various fine figures of animals and clams – the Starting price EUR 350,- bronze is also covered with many tiny inlaid barnacles.
HEIGHT c. 53 cm WEIGHT 10.5 kilograms
Condition: Good age-related condition, wear, some elements are loose and the Kirin figure has been reattached. Provenance: Old Austrian private collection.
Estimate EUR 2.000,- Starting price EUR 1.000,-
4 | A BRONZE SCROLL WEIGHT OF KINKO SENNIN
Japan, Meiji period (1868-1912)
Cast to depict Kinko Sennin holding down a seabream.
LENGTH 7 cm WEIGHT 204 grams
Condition: Good condition. 2 | MIYAO EISUKE: A BRONZE Provenance: From an Austrian private collection. Kept in the same ‘SAMURAI’ CANDLESTICK family since the first half of the 20th century and thence by descent.
%\0L\DR(LVXNHRI Signed MIYAO on a gilt rectangular reserve with seal Ei. The heavily cast, gilt and incised bronze figure stands on its en suite lacquered wood stand. The Samurai is dressed in a palatial robe 5 | A CHARMING BRONZE OF HOTEI with various gilt family crests over a large apron with thick tassels at the bottom that looks like Japan, Meiji period (1868-1912) a kesho-mawashi, normally worn only by sumo wrestlers. A tanto is tucked through his sash as he holds the removable blossom-shaped The bronze figure with a subtle maroon patina candleholder. and mounted to an oval plinth with a slightly recessed base. The lucky god is shown in HEIGHT 30.3 cm (including the stand) traditional manner with his outsized bare belly, WEIGHT 1823.7 grams (including the stand) carrying a huge sack on his back. Condition: Superb condition with only minor HEIGHT 19.5 cm wear and traces of use. The stand with some WEIGHT 2926 grams abrasions, minute chipping and age cracks. The warrior may have once held something in his Condition: Excellent condition with only minor proper right hand, which is now missing. wear. Provenance: From an English private collection. Provenance: American private collection. Estimate EUR 1.500,- Estimate EUR 500,- Starting price EUR 750,- Starting price EUR 250,- 10 11 1 | A LARGE AND SPECTACULAR 3 | A BRONZE FIGURAL GROUP SILVER AND GOLD INLAID KORO (INCENSE Japan, Meiji period (1868-1912) BURNER) Japan, 18th century, Edo period (1615-1868) Consisting of 4 pieces: The base finely casted with JUDVVHVDQGSODQWVWKHWZR%LMLQVWDQGLQJQH[W to a tree that culminates in a large flower which 7KHHODERUDWHVHFWLRQDOERG\bFRQVLVWLQJRIPDQ\ serves as a container. bronze pieces. The top-section which holds the incense shows a confronting tiger and dragon HEIGHT 36 cm on one side, and two confronting phoenixes on WEIGHT 7.5 kilogram the other. The koro is held by a rock and sits on a four-legged stand with phoenix heads, finally Condition: Worn condition, two hands and one the whole group stands upon an octagonal leaf restored, one foot and one leaf lost. bronze base. The lid of the Koro is surmounted Provenance: Hungarian private collection. by a figure of Kirin. The entire bronze is worked in silver wire and inlays of rich gold and shows Estimate EUR 700,- various fine figures of animals and clams – the Starting price EUR 350,- bronze is also covered with many tiny inlaid barnacles. HEIGHT c. 53 cm WEIGHT 10.5 kilograms Condition: Good age-related condition, wear, some elements are loose and the Kirin figure has been reattached. Provenance: Old Austrian private collection. Estimate EUR 2.000,- Starting price EUR 1.000,- 4 | A BRONZE SCROLL WEIGHT OF KINKO SENNIN Japan, Meiji period (1868-1912) Cast to depict Kinko Sennin holding down a seabream. LENGTH 7 cm WEIGHT 204 grams Condition: Good condition. 2 | MIYAO EISUKE: A BRONZE Provenance: From an Austrian private collection. Kept in the same ‘SAMURAI’ CANDLESTICK family since the first half of the 20th century and thence by descent. %\0L\DR(LVXNHRI Signed MIYAO on a gilt rectangular reserve with seal Ei. The heavily cast, gilt and incised bronze figure stands on its en suite lacquered wood stand. The Samurai is dressed in a palatial robe 5 | A CHARMING BRONZE OF HOTEI with various gilt family crests over a large apron with thick tassels at the bottom that looks like Japan, Meiji period (1868-1912) a kesho-mawashi, normally worn only by sumo wrestlers. A tanto is tucked through his sash as he holds the removable blossom-shaped The bronze figure with a subtle maroon patina candleholder. and mounted to an oval plinth with a slightly recessed base. The lucky god is shown in HEIGHT 30.3 cm (including the stand) traditional manner with his outsized bare belly, WEIGHT 1823.7 grams (including the stand) carrying a huge sack on his back. Condition: Superb condition with only minor HEIGHT 19.5 cm wear and traces of use. The stand with some WEIGHT 2926 grams abrasions, minute chipping and age cracks. The warrior may have once held something in his Condition: Excellent condition with only minor proper right hand, which is now missing. wear. Provenance: From an English private collection. Provenance: American private collection. Estimate EUR 1.500,- Estimate EUR 500,- Starting price EUR 750,- Starting price EUR 250,- 10 11 6 | GENRYUSAI SEIYA: A MONUMENTAL 9 | A SUPERB IRON AND GOLD DISH ‘PRIDE OF LIONS’ BRONZE VASE WITH DARUMA Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Finely cast with six lions in high relief, neatly applied incision work The iron dish stands on three feet and is decorated in the front with and unctuous patina. The base with an artist’s seal mark reading DQDPXVLQJLPDJHRIWKH=HQSDWULDUFK'DUXPD %RGKLGKDUPD GENRYUSAI SEIYA zo. Despite the pride’s large scale and striking Daruma looks out from a grated window, the bars inlaid in gold appearance as a group, each lion is rendered with scientific and silver, and a wasp descends from a finely inlaid spiderweb and exactitude, remarkably brisk and spirited by its own. The depiction lands on Daruma’s head. He has been woken from his meditation hence attains a degree of naturalism, monumentality, and dignity DQGSXOOVDQDPXVLQJJULPDFH+HLVKROGLQJDKRVVX %XGGKLVW normally found only in the works of the next generation of animal fly whisk) and is contemplating to swat the wasp – this comical VFXOSWRUVQRWDEO\5HPEUDQGW%XJDWWL indecision is masterfully executed in his distorted facial expression. Daruma’s face is inlaid in sentoku and his robe is made from rich HEIGHT 48.5 cm JROG%HORZWKHLPDJHDUHOHDI\YLQHVLQODLGLQVLOYHUJROGDQG WEIGHT 12.1 kilograms copper. The rim is fitted with a silver ring. Condition: Good condition with some stains, dents, old wear and DIAMETER 31 cm traces of use, the original base reinstated. WEIGHT 1546 grams Provenance: From an English private collection. Condition: Excellent condition with associated wear. The iron has Estimate EUR 800,- developed a fine rust patina. Starting price EUR 400,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 3.000,- Starting price EUR 1.500,- 7 | INOUE: A LARGE BRONZE DISH %\ΖQRXHRI.\RWRVLJQHG.\RWRΖQRXHVHLDQGVHDOHG)XVDKLUR 10 | A SMALL SILVER INLAID BRONZE VASE Japan, Meiji period (1868-1912) Japan, 19th century The backside is signed ‘Kyoto Inoue Sei’ and inlaid with the golden artist seal ‘Fusahiro’. Very finely decorated in bronze, silver, copper The baluster-shaped vase with silver inlays depicting plovers and gilt takazogan with a pair of sparrows perched on a bamboo above waves, the plovers inlaid in gold. The base with incised artist pole supporting a snow-covered rice-stook next to which several signature. peonies are growing. Part of the image is executed in Katakiri technique. The scene is enclosed within a circular inlaid band of HEIGHT 11.5 cm leafy bamboo. The lobed rim shows a golden meander inlay. WEIGHT 502 grams DIAMETER 30.5 cm Condition: Worn condition, rusty areas, spots, loss of patina and WEIGHT 1363 grams two small dents to body. Provenance: From the collection of Alexander Popov in Novi Sad, Condition: Superb condition with hardly any wear, some staining to Kingdom of Serbia, acquired between 1900-1920. patina on the backside. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 200,- Starting price EUR 100,- Auction comparison: Compare with a plate by the same maker at Christies, in ‘Edo to Post-War: 500 Years of Japanese Art and Design’ on November 15th, 2017, lot 5. Estimate EUR 1.000,- Starting price EUR 500,- 8 | RINSHOSAI: A PEAR-SHAPED BRONZE VASE 11 | A SUPERB KOMAI IRON DISH %\5LQVKRVDLVLJQHG5LQVKRVDL Japan, Meiji period (1868-1912) %\WKH.RPDL&RPSDQ\RI.\RWR Japan, Meiji period (1868-1912) The vase finely patinated to a deep olive-brown tone and with a sprawling neck and foot. The recessed base with a neatly incised Seal mark inlaid in gold to backside reading ‘Nihonkoku Kyoto no artist signature corresponding to RINSHOSAI and a cursive ju Komai’ beneath a dragonfly. Extremely fine inlay work in gold inscription. The sides cast in high relief with three fish swimming and silver with microscopic incision work depicting Sankin-kotai. amid jakago (breakwater) and tree stumps. A Daimyo in a palanquin is accompanied by an entourage of noblemen, soldiers and servants. HEIGHT 31.8 cm WEIGHT 2933 grams DIAMETER 18.3 cm WEIGHT 248.7 grams Condition: Excellent condition with only minor wear and traces of use. Condition: Perfect with only very minor wear. Provenance: From a private estate in the United Kingdom. Provenance: French private collection. Estimate EUR 600,- Estimate EUR 1.000,- Starting price EUR 300,- Starting price EUR 500,- 12 13 6 | GENRYUSAI SEIYA: A MONUMENTAL 9 | A SUPERB IRON AND GOLD DISH ‘PRIDE OF LIONS’ BRONZE VASE WITH DARUMA Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Finely cast with six lions in high relief, neatly applied incision work The iron dish stands on three feet and is decorated in the front with and unctuous patina. The base with an artist’s seal mark reading DQDPXVLQJLPDJHRIWKH=HQSDWULDUFK'DUXPD %RGKLGKDUPD GENRYUSAI SEIYA zo. Despite the pride’s large scale and striking Daruma looks out from a grated window, the bars inlaid in gold appearance as a group, each lion is rendered with scientific and silver, and a wasp descends from a finely inlaid spiderweb and exactitude, remarkably brisk and spirited by its own. The depiction lands on Daruma’s head. He has been woken from his meditation hence attains a degree of naturalism, monumentality, and dignity DQGSXOOVDQDPXVLQJJULPDFH+HLVKROGLQJDKRVVX %XGGKLVW normally found only in the works of the next generation of animal fly whisk) and is contemplating to swat the wasp – this comical VFXOSWRUVQRWDEO\5HPEUDQGW%XJDWWL indecision is masterfully executed in his distorted facial expression. Daruma’s face is inlaid in sentoku and his robe is made from rich HEIGHT 48.5 cm JROG%HORZWKHLPDJHDUHOHDI\YLQHVLQODLGLQVLOYHUJROGDQG WEIGHT 12.1 kilograms copper. The rim is fitted with a silver ring. Condition: Good condition with some stains, dents, old wear and DIAMETER 31 cm traces of use, the original base reinstated. WEIGHT 1546 grams Provenance: From an English private collection. Condition: Excellent condition with associated wear. The iron has Estimate EUR 800,- developed a fine rust patina. Starting price EUR 400,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 3.000,- Starting price EUR 1.500,- 7 | INOUE: A LARGE BRONZE DISH %\ΖQRXHRI.\RWRVLJQHG.\RWRΖQRXHVHLDQGVHDOHG)XVDKLUR 10 | A SMALL SILVER INLAID BRONZE VASE Japan, Meiji period (1868-1912) Japan, 19th century The backside is signed ‘Kyoto Inoue Sei’ and inlaid with the golden artist seal ‘Fusahiro’. Very finely decorated in bronze, silver, copper The baluster-shaped vase with silver inlays depicting plovers and gilt takazogan with a pair of sparrows perched on a bamboo above waves, the plovers inlaid in gold. The base with incised artist pole supporting a snow-covered rice-stook next to which several signature. peonies are growing. Part of the image is executed in Katakiri technique. The scene is enclosed within a circular inlaid band of HEIGHT 11.5 cm leafy bamboo. The lobed rim shows a golden meander inlay. WEIGHT 502 grams DIAMETER 30.5 cm Condition: Worn condition, rusty areas, spots, loss of patina and WEIGHT 1363 grams two small dents to body. Provenance: From the collection of Alexander Popov in Novi Sad, Condition: Superb condition with hardly any wear, some staining to Kingdom of Serbia, acquired between 1900-1920. patina on the backside. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 200,- Starting price EUR 100,- Auction comparison: Compare with a plate by the same maker at Christies, in ‘Edo to Post-War: 500 Years of Japanese Art and Design’ on November 15th, 2017, lot 5. Estimate EUR 1.000,- Starting price EUR 500,- 8 | RINSHOSAI: A PEAR-SHAPED BRONZE VASE 11 | A SUPERB KOMAI IRON DISH %\5LQVKRVDLVLJQHG5LQVKRVDL Japan, Meiji period (1868-1912) %\WKH.RPDL&RPSDQ\RI.\RWR Japan, Meiji period (1868-1912) The vase finely patinated to a deep olive-brown tone and with a sprawling neck and foot. The recessed base with a neatly incised Seal mark inlaid in gold to backside reading ‘Nihonkoku Kyoto no artist signature corresponding to RINSHOSAI and a cursive ju Komai’ beneath a dragonfly. Extremely fine inlay work in gold inscription. The sides cast in high relief with three fish swimming and silver with microscopic incision work depicting Sankin-kotai. amid jakago (breakwater) and tree stumps. A Daimyo in a palanquin is accompanied by an entourage of noblemen, soldiers and servants. HEIGHT 31.8 cm WEIGHT 2933 grams DIAMETER 18.3 cm WEIGHT 248.7 grams Condition: Excellent condition with only minor wear and traces of use. Condition: Perfect with only very minor wear. Provenance: From a private estate in the United Kingdom. Provenance: French private collection. Estimate EUR 600,- Estimate EUR 1.000,- Starting price EUR 300,- Starting price EUR 500,- 12 13 17 | A SHISHI BRONZE SCROLL WEIGHT Japan, 18th century, Edo period (1615-1868) Cast in openwork and neatly incised miniature bronze sculpture depicting two playful Shishi, mother and cub, with a brocade ball. LENGTH 6 cm WEIGHT 79.5 grams Condition: Excellent condition with fine patina. Remainders of old mounts to bottom. Provenance: Austrian private collection. 13 | A RARE KABUTO PILL BOX Estimate EUR 200,- Starting price EUR 100,- Japan, Meiji period (1868-1912) 12 | SIX SLVER ITEMS, 19TH CENTURY 16 | A RARE INLAID IVORY MOONFLASK China and Japan. Comprising three sake bowls with incised The small box made of silvered bronze in the shape of a Samurai Japan, Meiji period (1868-1912) decorations, one of them showing Mt. Fuji, with hallmarks on helmet with fine décor in high relief as well neatly applied incision the underside, two miniature litters (jiao) with old collector’s work to the sides depicting a Karako playing with a trained mouse labels and hallmarks and a finely incised miniature table with old on a leash. The body of the miniature vase is carved from ivory with pine hallmarks. (6) EUDQFKHVLQKLJKUHOLHI%RWKVLGHVEHDUDFLUFXODU6KDNXGRSODTXH LENGTH 6.5 cm with high relief inlays in gold, silver, Shibuichi and copper. One WEIGHT 104.3 grams side shows the popular theme of tiger and dragon and the other Condition: Good condition with old wear, some slightly bent, the portrays Kinko Sennin riding on his carp. bowls in excellent condition. Condition: Excellent condition with some old wear and some Provenance: From the collection of Alexander Popov in Novi Sad, traces of use. The lid with its original hinge, well moving, and HEIGHT 9 cm Kingdom of Serbia, acquired between 1900-1920. leaving a two-millimeter-gap when closed. WEIGHT 74.5 grams Provenance: Austrian private collection. Weight: 249.1 g in total. Condition: Fine condition with a few small natural age cracks and Dimensions: Diameter 8.2-10.7 cm (the bowls). Length 11.7 cm Estimate EUR 500,- one microscopic associated loss. Good old patina. each (the litters). Height 3.7 cm (the table). Starting price EUR 250,- Provenance: Austrian private collection. Acquired before 1990 in the local auction market. Estimate EUR 600,- Starting price EUR 300,- Estimate EUR 300,- Starting price EUR 150,- 14 | ICHIEI: A SILVER CIGARETTE CASE 19 | A SMALL COMPASS & MINIATURE OKIMONO %\ΖFKLHLVLJQHGΖFKLHLWR Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) The first item in this lot of two is a miniature geta sandal carved The cigarette case is made from 95 % pure silver and is from ivory with a small metal thong and a microscopic fly. The decorated with an idyllic scene of two bijin (beauties) next to a second is a pendant in the shape of a lucky god with a lute, made maple tree and beside a bridge, the sea, rockwork and a pavilion of silver with gilding, with extremely fine incision work. It holds visible in the background. The details are inlaid in copper. The a functioning compass on the backside underneath a crescent inside shows the same scene, though mirrored, and shows some moon. gold details. Signed ICHIEI to (made by) in the reverse. HEIGHT 2 cm (the sandal) and 2.5 cm (the length of the compass) LENGTH 11.2 cm WEIGHT 5 grams in total WEIGHT 115 grams 18 | A GOLD AND SILVER INLAID SENTOKU BOX Condition: Excellent condition with only minor wear. Condition: Minor surface wear and scratches. Generally, in good Provenance: Austrian private collection. condition. Japan, Meiji period (1868-1912) Provenance: Zagreb private collection. Estimate EUR 150,- 15 | A JAPANESE KOMAI STYLE CIGARETTE CASE Starting price EUR 75,- Estimate EUR 400,- Miniature mixed metal pill box with fine inlays in high relief Starting price EUR 200,- Japan, Meiji period (1868-1912) depicting quails, swallows and deer amid millets and peonies. Extremely fine incision work. Rounded corners. The inside with fire-gilding. The convex lid with a minuscule knob. A Japanese Komai cigarette case with gold and silver inlaid decoration depicting a lake scene with mount Fuji in the distance. SIZE 3.7 x 3.1 x 3.1 cm The inside with seal mark ‘DEN’. WEIGHT 47.1 grams SIZE 8.5 x 9 cm Condition: Excellent condition with some old stains to patina and WEIGHT 82 grams wear. Hinge in fine working condition. Provenance: Austrian private collection. Old labels to bottom with Condition: Good condition, minor loss to inlay and rubbing. inventory number and date of acquisition “February 93”, price at Provenance: Austrian private collection. the time – 3.600 Austrian Schillings. Estimate EUR 300,- Estimate EUR 500,- Starting price EUR 150,- Starting price EUR 250,- 14 15 17 | A SHISHI BRONZE SCROLL WEIGHT Japan, 18th century, Edo period (1615-1868) Cast in openwork and neatly incised miniature bronze sculpture depicting two playful Shishi, mother and cub, with a brocade ball. LENGTH 6 cm WEIGHT 79.5 grams Condition: Excellent condition with fine patina. Remainders of old mounts to bottom. Provenance: Austrian private collection. 13 | A RARE KABUTO PILL BOX Estimate EUR 200,- Starting price EUR 100,- Japan, Meiji period (1868-1912) 12 | SIX SLVER ITEMS, 19TH CENTURY 16 | A RARE INLAID IVORY MOONFLASK China and Japan. Comprising three sake bowls with incised The small box made of silvered bronze in the shape of a Samurai Japan, Meiji period (1868-1912) decorations, one of them showing Mt. Fuji, with hallmarks on helmet with fine décor in high relief as well neatly applied incision the underside, two miniature litters (jiao) with old collector’s work to the sides depicting a Karako playing with a trained mouse labels and hallmarks and a finely incised miniature table with old on a leash. The body of the miniature vase is carved from ivory with pine hallmarks. (6) EUDQFKHVLQKLJKUHOLHI%RWKVLGHVEHDUDFLUFXODU6KDNXGRSODTXH LENGTH 6.5 cm with high relief inlays in gold, silver, Shibuichi and copper. One WEIGHT 104.3 grams side shows the popular theme of tiger and dragon and the other Condition: Good condition with old wear, some slightly bent, the portrays Kinko Sennin riding on his carp. bowls in excellent condition. Condition: Excellent condition with some old wear and some Provenance: From the collection of Alexander Popov in Novi Sad, traces of use. The lid with its original hinge, well moving, and HEIGHT 9 cm Kingdom of Serbia, acquired between 1900-1920. leaving a two-millimeter-gap when closed. WEIGHT 74.5 grams Provenance: Austrian private collection. Weight: 249.1 g in total. Condition: Fine condition with a few small natural age cracks and Dimensions: Diameter 8.2-10.7 cm (the bowls). Length 11.7 cm Estimate EUR 500,- one microscopic associated loss. Good old patina. each (the litters). Height 3.7 cm (the table). Starting price EUR 250,- Provenance: Austrian private collection. Acquired before 1990 in the local auction market. Estimate EUR 600,- Starting price EUR 300,- Estimate EUR 300,- Starting price EUR 150,- 14 | ICHIEI: A SILVER CIGARETTE CASE 19 | A SMALL COMPASS & MINIATURE OKIMONO %\ΖFKLHLVLJQHGΖFKLHLWR Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) The first item in this lot of two is a miniature geta sandal carved The cigarette case is made from 95 % pure silver and is from ivory with a small metal thong and a microscopic fly. The decorated with an idyllic scene of two bijin (beauties) next to a second is a pendant in the shape of a lucky god with a lute, made maple tree and beside a bridge, the sea, rockwork and a pavilion of silver with gilding, with extremely fine incision work. It holds visible in the background. The details are inlaid in copper. The a functioning compass on the backside underneath a crescent inside shows the same scene, though mirrored, and shows some moon. gold details. Signed ICHIEI to (made by) in the reverse. HEIGHT 2 cm (the sandal) and 2.5 cm (the length of the compass) LENGTH 11.2 cm WEIGHT 5 grams in total WEIGHT 115 grams 18 | A GOLD AND SILVER INLAID SENTOKU BOX Condition: Excellent condition with only minor wear. Condition: Minor surface wear and scratches. Generally, in good Provenance: Austrian private collection. condition. Japan, Meiji period (1868-1912) Provenance: Zagreb private collection. Estimate EUR 150,- 15 | A JAPANESE KOMAI STYLE CIGARETTE CASE Starting price EUR 75,- Estimate EUR 400,- Miniature mixed metal pill box with fine inlays in high relief Starting price EUR 200,- Japan, Meiji period (1868-1912) depicting quails, swallows and deer amid millets and peonies. Extremely fine incision work. Rounded corners. The inside with fire-gilding. The convex lid with a minuscule knob. A Japanese Komai cigarette case with gold and silver inlaid decoration depicting a lake scene with mount Fuji in the distance. SIZE 3.7 x 3.1 x 3.1 cm The inside with seal mark ‘DEN’. WEIGHT 47.1 grams SIZE 8.5 x 9 cm Condition: Excellent condition with some old stains to patina and WEIGHT 82 grams wear. Hinge in fine working condition. Provenance: Austrian private collection. Old labels to bottom with Condition: Good condition, minor loss to inlay and rubbing. inventory number and date of acquisition “February 93”, price at Provenance: Austrian private collection. the time – 3.600 Austrian Schillings. Estimate EUR 300,- Estimate EUR 500,- Starting price EUR 150,- Starting price EUR 250,- 14 15 20 | TWO PLACEMENT CARD HOLDERS Japan, Meiji period (1868-1912) The card holders of mixed metal inlaid with precious metals and shaped as vases with blooming flowers. SIZE 5 x 6 cm Condition: Good condition. Provenance: From the collection of a Corsican seafarer. 25 | A PAIR OF MENUKI WITH BIRDS Estimate EUR 150,- Starting price EUR 75,- Unsigned Japan, Edo period (1615-1868) %RWKSLHFHVDUHPDGHIURPDFRSSHUDOOR\DQGVKRZVPDOOELUGV 24 | THREE COPPER KOZUKA flying amid clouds. One piece also shows a full moon. Unsigned LENGTH 4.1 cm each 21 | TOZAN: A PLACEMENT Japan, late Edo period (1615-1868) CARD HOLDER OF BENKEI Condition: Good condition. Provenance: From a Hungarian private collection. %\7R]DQVLJQHG7R]DQ The first kozuka depicting a wayfarer with a walking cane in high Japan, Meiji period (1868-1912) relief looking up towards two birds flying in the sky. At the top Estimate EUR 150,- there is bamboo growing. The reverse shows a long inscription in Starting price EUR 75,- b cursive and abbreviated sosho. The second kozuka depicts a man 0DGHIURPVLOYHUHGVHQWRNXDQGGHSLFWLQJ%HQNHLGXULQJ sweeping with a broom in takazogan relief. Above him the silver NDQMLQFKRUHDGLQJIURPD%XGGKLVWVXEVFULSWLRQOLVWVLJQHG crescent moon. The third completely gilt kozuka shows three TOZAN in the back. horses in motion, with different poses. b HEIGHT 9.9 cm LENGTH c. 9.7 cm b Condition: Minor wear to silver. Good condition. Condition: All in good condition. The first with minor areas of Provenance: Old Zagreb private collection. discoloration on the reverse, the second with minor wear and small nicks and the third with signs of wear and some scratches Estimate EUR 200,- on the surface. Starting price EUR 100,- Provenance: German private collection. 22 | TWO PLACEMENT CARD HOLDERS Estimate EUR 300,- AND ONE HAIRPIN Starting price EUR 150,- Japan, Meiji period (1868-1912) 26 | TWO BRONZE MENUKI, EDO PERIOD The two cardholders of mixed metal with inlays of precious metals, one depicting a samurai and another a fan with birds and Unsigned flowers. The hairpin finely inlaid to depict a bird amongst leaves Japan, Edo period (1615-1868) and flowers. SIZE card holders 5 x 6 cm, HEIGHT samurai 4.6 cm, %RWKSLHFHVGHSLFWIHURFLRXVO\URPSLQJ6KLVKL9HU\OLYHO\DQG TOTAL LENGTH hairpin 9 cm densely crafted execution. The bronze is painted black while the eyes of the Shishi are gilt. In wooden box. Condition: Good condition. Provenance: Old Zagreb private collection. LENGTH 3.2 to 3.4 cm Estimate EUR 200,- Condition: Minor associated wear. Very good condition. Starting price EUR 100,- Provenance: From a Hungarian private collection. 27 | TWO FUCHI-KASHIRA 23 | A PAIR OF FAN-SHAPED Estimate EUR 150,- Unsigned PLACEMENT CARD HOLDERS Starting price EUR 75,- Japan, Edo period (1615-1868) Japan, Meiji period (1868-1912) The first very finely worked in shakudo depicting flowers with gold, silver and copper. The second of bronze with a stippled A pair of mixed metal fan-shaped card holders, both inlaid in surface. precious metals to depict birds amongst flowering trees. LENGTH each 4 cm SIZE 8 x 5.5 cm each Condition: Very good with minor wear and oxidation to the Condition: Good condition. bronze fuchi-kashira. Provenance: Old Zagreb private collection. Provenance: Austrian private estate. Estimate EUR 300,- Estimate EUR 400,- Starting price EUR 150,- Starting price EUR 200,- 16 17 20 | TWO PLACEMENT CARD HOLDERS Japan, Meiji period (1868-1912) The card holders of mixed metal inlaid with precious metals and shaped as vases with blooming flowers. SIZE 5 x 6 cm Condition: Good condition. Provenance: From the collection of a Corsican seafarer. 25 | A PAIR OF MENUKI WITH BIRDS Estimate EUR 150,- Starting price EUR 75,- Unsigned Japan, Edo period (1615-1868) %RWKSLHFHVDUHPDGHIURPDFRSSHUDOOR\DQGVKRZVPDOOELUGV 24 | THREE COPPER KOZUKA flying amid clouds. One piece also shows a full moon. Unsigned LENGTH 4.1 cm each 21 | TOZAN: A PLACEMENT Japan, late Edo period (1615-1868) CARD HOLDER OF BENKEI Condition: Good condition. Provenance: From a Hungarian private collection. %\7R]DQVLJQHG7R]DQ The first kozuka depicting a wayfarer with a walking cane in high Japan, Meiji period (1868-1912) relief looking up towards two birds flying in the sky. At the top Estimate EUR 150,- there is bamboo growing. The reverse shows a long inscription in Starting price EUR 75,- b cursive and abbreviated sosho. The second kozuka depicts a man 0DGHIURPVLOYHUHGVHQWRNXDQGGHSLFWLQJ%HQNHLGXULQJ sweeping with a broom in takazogan relief. Above him the silver NDQMLQFKRUHDGLQJIURPD%XGGKLVWVXEVFULSWLRQOLVWVLJQHG crescent moon. The third completely gilt kozuka shows three TOZAN in the back. horses in motion, with different poses. b HEIGHT 9.9 cm LENGTH c. 9.7 cm b Condition: Minor wear to silver. Good condition. Condition: All in good condition. The first with minor areas of Provenance: Old Zagreb private collection. discoloration on the reverse, the second with minor wear and small nicks and the third with signs of wear and some scratches Estimate EUR 200,- on the surface. Starting price EUR 100,- Provenance: German private collection. 22 | TWO PLACEMENT CARD HOLDERS Estimate EUR 300,- AND ONE HAIRPIN Starting price EUR 150,- Japan, Meiji period (1868-1912) 26 | TWO BRONZE MENUKI, EDO PERIOD The two cardholders of mixed metal with inlays of precious metals, one depicting a samurai and another a fan with birds and Unsigned flowers. The hairpin finely inlaid to depict a bird amongst leaves Japan, Edo period (1615-1868) and flowers. SIZE card holders 5 x 6 cm, HEIGHT samurai 4.6 cm, %RWKSLHFHVGHSLFWIHURFLRXVO\URPSLQJ6KLVKL9HU\OLYHO\DQG TOTAL LENGTH hairpin 9 cm densely crafted execution. The bronze is painted black while the eyes of the Shishi are gilt. In wooden box. Condition: Good condition. Provenance: Old Zagreb private collection. LENGTH 3.2 to 3.4 cm Estimate EUR 200,- Condition: Minor associated wear. Very good condition. Starting price EUR 100,- Provenance: From a Hungarian private collection. 27 | TWO FUCHI-KASHIRA 23 | A PAIR OF FAN-SHAPED Estimate EUR 150,- Unsigned PLACEMENT CARD HOLDERS Starting price EUR 75,- Japan, Edo period (1615-1868) Japan, Meiji period (1868-1912) The first very finely worked in shakudo depicting flowers with gold, silver and copper. The second of bronze with a stippled A pair of mixed metal fan-shaped card holders, both inlaid in surface. precious metals to depict birds amongst flowering trees. LENGTH each 4 cm SIZE 8 x 5.5 cm each Condition: Very good with minor wear and oxidation to the Condition: Good condition. bronze fuchi-kashira. Provenance: Old Zagreb private collection. Provenance: Austrian private estate. Estimate EUR 300,- Estimate EUR 400,- Starting price EUR 150,- Starting price EUR 200,- 16 17 30 | A SAMURAI ARMOR WITH KABUTO Japan, Edo period (1615-1868) A samurai armor including the helmet, or kabuto, lacquered in “rusted iron” tone with two-part red lacquered iron plates shikoro and gold lacquered maedate. The facemask with four lame yodare- kake (throat guards) lacquered in gold. The shoulder pads sode are crafted of four strips connected by fabric bands. On the brown lacquered do (breastplate), which can be opened on the side, hangs the five lame kasazuri. The Safeguard hai-date with several arranged rectangular iron plates; the forearm and handguards all similarily arranged in kusari with iron plates, gilt iron bands and gusoki (chain mail). The thigh coverings and shin-guards are missing. With a wood box. HEIGHT c. 125 cm Condition: With signs of aging, tears to fabric, wear, cracks to lacquer, rust and material loss. Provenance: Hungarian private collection. Estimate EUR 4.000,- Starting price EUR 2.000,- 28 | A MINO WAKIZASHI IN KOSHIRAE The mounting: Oval-round tsuba with two hitsu and openwork, motifs showing Japan, c. late 16th to 17th century lotus leaves. The fuchi in silver takazogan with some gilding shows a lively shishi, while the kashira shows a large blossom utilizing the 31 | AN IRON KABUTO (HELMET) VDPHWHFKQLTXH%RWKPHQXNLLQEODFNVKDNXGRZLWKVRPHJROGDOVR The blade: show shishi. The saya with lustrous black lacquer has an ishime Japan, Edo period (1615-1868) Shinogi-zukuri and iori mune, the hamon is a finely pronounced structure. gunome with a partial slight tendency towards sugi. The unsigned tang is ubu with one mekugi-ana, the tip is kurijiri, the yasurime is NAGASA 39.1 cm, total LENGTH 61 cm A black lacquered iron kabuto with three-part shikoro and leather o-sujikai. The Japanese Toen-Sha expertise attributes this blade to a mae-zashi. The Fukigaeshi shows the maru ni katabami crest ‘successor’ of Kanemoto. Condition: The blade in very good condition with minor wear and symbol. imperfections. The saya shows extensive wear. Provenance: From a Hungarian private collection; with certificate HEIGHT c. 20 cm in Japanese from Toen-sha from 1976 issued by the president Murakami Kosuke. Condition: Worn condition, crackling and losses. Generally, very well preserved. Estimate EUR 1.500,- Provenance: Hungarian private collection. Starting price EUR 750,- Estimate EUR 2.000,- Starting price EUR 1.000,- 29 | NORIMITSU: A WAKIZASHI The mounting: WITH HORIMONO IN KOSHIRAE The tsuba with a Chinese sage in high relief admiring the gorgeous flowers on a porch. Partly gilt, the background pattern with %\1RULPLWVXVLJQHG:DVKXMX1RULPLWVXVDNX nanakoji. Fuchi-kashira with finest nanakoji, the floral decorations in Japan, late Edo period (1615-1868) gold zogan. The kozuka handle shows party gilt clams on nanakoji ground. The black-lacquered saya with densely speckled particles of mother-of-pearl. 32 | SAMURAI ARMOR WITH KABUTO The blade: Shinogi-zukuri and iori mune, with decorative horimono on both NAGASA 51.7 cm, total LENGTH 73.7 cm Japan, Edo period (1615-1868) sides. The hamon is wide and mostly suguha with some notare. The horimono show a long-scaled dragon chasing a flaming pearl Condition: The blade is in good condition with minor surface wear as a main motif, the rear side shows dragon claws amid clouds. The and corrosion below the dragon, as visible in the catalog illustration. A rare and impressive complete samurai armor including the tang is ubu with one mekugi-ana. The signature reads Washu ju The saya is in excellent condition with extremely minor wear. helmet, kabuto, with open kiku shaped tehen no kanamono and NORIMITSU saku. Provenance: From a Hungarian private collection. four-part lacquered iron plates shikoro with sugake odoshi. The very impressive maedate front piece in the form of a ferocious Estimate EUR 2.000,- mask with Kuwagata horns. The face-mask hanbo made of iron Starting price EUR 1.000,- with three lame yodare-kake (throat guards). The chest protector is a do-maru, which can be opened on the side. The shoulder pads, sode, are crafted of six lacquer panels with sugake odoshi strings– the top piece is gilded. Mounted to the do are the kusazuri, in six parts, each made of 5 panels hung on long fabric bands. The kote arm and hand guards as well as the haidate thigh guards are made of colorful brocade with protective iron onsets. With an old wood storage box with large mon crests and a modern presentation stand. HEIGHT approx. 155 cm Condition: This set of armor is entirely complete. With signs of wear and use appropriate for its age, especially tears to fabric and cracks as well some material loss to lacquer or metalwork. Provenance: From a Hungarian private collection. Estimate EUR 5.000,- Starting price EUR 2.500,- 18 19 30 | A SAMURAI ARMOR WITH KABUTO Japan, Edo period (1615-1868) A samurai armor including the helmet, or kabuto, lacquered in “rusted iron” tone with two-part red lacquered iron plates shikoro and gold lacquered maedate. The facemask with four lame yodare- kake (throat guards) lacquered in gold. The shoulder pads sode are crafted of four strips connected by fabric bands. On the brown lacquered do (breastplate), which can be opened on the side, hangs the five lame kasazuri. The Safeguard hai-date with several arranged rectangular iron plates; the forearm and handguards all similarily arranged in kusari with iron plates, gilt iron bands and gusoki (chain mail). The thigh coverings and shin-guards are missing. With a wood box. HEIGHT c. 125 cm Condition: With signs of aging, tears to fabric, wear, cracks to lacquer, rust and material loss. Provenance: Hungarian private collection. Estimate EUR 4.000,- Starting price EUR 2.000,- 28 | A MINO WAKIZASHI IN KOSHIRAE The mounting: Oval-round tsuba with two hitsu and openwork, motifs showing Japan, c. late 16th to 17th century lotus leaves. The fuchi in silver takazogan with some gilding shows a lively shishi, while the kashira shows a large blossom utilizing the 31 | AN IRON KABUTO (HELMET) VDPHWHFKQLTXH%RWKPHQXNLLQEODFNVKDNXGRZLWKVRPHJROGDOVR The blade: show shishi. The saya with lustrous black lacquer has an ishime Japan, Edo period (1615-1868) Shinogi-zukuri and iori mune, the hamon is a finely pronounced structure. gunome with a partial slight tendency towards sugi. The unsigned tang is ubu with one mekugi-ana, the tip is kurijiri, the yasurime is NAGASA 39.1 cm, total LENGTH 61 cm A black lacquered iron kabuto with three-part shikoro and leather o-sujikai. The Japanese Toen-Sha expertise attributes this blade to a mae-zashi. The Fukigaeshi shows the maru ni katabami crest ‘successor’ of Kanemoto. Condition: The blade in very good condition with minor wear and symbol. imperfections. The saya shows extensive wear. Provenance: From a Hungarian private collection; with certificate HEIGHT c. 20 cm in Japanese from Toen-sha from 1976 issued by the president Murakami Kosuke. Condition: Worn condition, crackling and losses. Generally, very well preserved. Estimate EUR 1.500,- Provenance: Hungarian private collection. Starting price EUR 750,- Estimate EUR 2.000,- Starting price EUR 1.000,- 29 | NORIMITSU: A WAKIZASHI The mounting: WITH HORIMONO IN KOSHIRAE The tsuba with a Chinese sage in high relief admiring the gorgeous flowers on a porch. Partly gilt, the background pattern with %\1RULPLWVXVLJQHG:DVKXMX1RULPLWVXVDNX nanakoji. Fuchi-kashira with finest nanakoji, the floral decorations in Japan, late Edo period (1615-1868) gold zogan. The kozuka handle shows party gilt clams on nanakoji ground. The black-lacquered saya with densely speckled particles of mother-of-pearl. 32 | SAMURAI ARMOR WITH KABUTO The blade: Shinogi-zukuri and iori mune, with decorative horimono on both NAGASA 51.7 cm, total LENGTH 73.7 cm Japan, Edo period (1615-1868) sides. The hamon is wide and mostly suguha with some notare. The horimono show a long-scaled dragon chasing a flaming pearl Condition: The blade is in good condition with minor surface wear as a main motif, the rear side shows dragon claws amid clouds. The and corrosion below the dragon, as visible in the catalog illustration. A rare and impressive complete samurai armor including the tang is ubu with one mekugi-ana. The signature reads Washu ju The saya is in excellent condition with extremely minor wear. helmet, kabuto, with open kiku shaped tehen no kanamono and NORIMITSU saku. Provenance: From a Hungarian private collection. four-part lacquered iron plates shikoro with sugake odoshi. The very impressive maedate front piece in the form of a ferocious Estimate EUR 2.000,- mask with Kuwagata horns. The face-mask hanbo made of iron Starting price EUR 1.000,- with three lame yodare-kake (throat guards). The chest protector is a do-maru, which can be opened on the side. The shoulder pads, sode, are crafted of six lacquer panels with sugake odoshi strings– the top piece is gilded. Mounted to the do are the kusazuri, in six parts, each made of 5 panels hung on long fabric bands. The kote arm and hand guards as well as the haidate thigh guards are made of colorful brocade with protective iron onsets. With an old wood storage box with large mon crests and a modern presentation stand. HEIGHT approx. 155 cm Condition: This set of armor is entirely complete. With signs of wear and use appropriate for its age, especially tears to fabric and cracks as well some material loss to lacquer or metalwork. Provenance: From a Hungarian private collection. Estimate EUR 5.000,- Starting price EUR 2.500,- 18 19 34 | A JINGASA WITH A GENTIAN EMBLEM 38 | A JINGASA WITH A MON Unsigned Unsigned Japan, late Edo period (1615-1868) Japan, late Edo period (1615-1868) Of conical form. The interior is smooth with red lacquer, the Of lightly conical form, black lacquer painted with gold and wickerwork covered with black lacquer shows three decorative silver, showing three vines, each with a bird, as well as a lustrous elements painted with gold lacquer on the exterior, with gentian heraldic mon on the front side showing three stylized geese blossoms and leaves. The gentian or rindo is an old aristocratic within a wide circle. Several tsurugi blades at the point as a emblem, used among others by branches of the important symbol of war but executed in the style of the Chinese ken. There Minamoto. is no padding on the red-lacquered interior and the bands are new. DIAMETER 41.8 cm DIAMETER 40.5 cm Condition: Chips and other damage, padding and bands in good condition. Condition: Chips and other damage. Provenance: From a Hungarian private collection. Provenance: From a Hungarian private collection. Estimate EUR 300,- Estimate EUR 300,- Starting price EUR 150,- Starting price EUR 150,- 37 | A JINGASA WITH A MON 33 | A KUSARI KATABIRA (CHAIN-MAIL JACKET) Unsigned Japan, Edo period (1615-1868) Japan, late Edo period (1615-1868) 2IVKRUWVOHHYHVDQGYHU\KHDY\bPDGHRIEOXHIDEULFZLWKVHZQ Of relatively small size, black on the exterior and with red lacquer linked iron rings. on the interior, and rather flat shape. The gilt symbol on the exterior meaning igeta (puteal). Lacing on the interior. SIZE c. 75 x 105 cm DIAMETER 34.7 cm Condition: With signs of aging, tears to fabric, wear, rust and material loss. Condition: Chips and other damage. Provenance: Hungarian private collection. Provenance: From a Hungarian private collection. Estimate EUR 700,- Estimate EUR 300,- Starting price EUR 350,- Starting price EUR 150,- 36 | A JINGASA WITH TWO MON 40 | A JINGASA WITH PHOENIXES Japan, late Edo (1615-1868) to Meiji period (1868-1912) Unsigned Japan, Meiji period (1868-1912) Lustrous roironuri on the exterior and red lacquer on the interior. Two mon are painted with gold lacquer on the exterior, An interesting piece with a slightly more curved rim, but the hexagonal one shows a crane, a symbol of long life and a especially with its depiction of two ho-o (phoenixes), one male popular emblem among the warrior class while the round one and the other female. There is no difference between them shows a stylized character Hayashi for “forest”. on the surface, both flying with beautiful tail feathers and symbolizing imperial power. These ho-o are not painted on the DIAMETER 42 cm hat but executed in a lightly raised relief with lacquer and gilt. A silver mounting in the form of a chrysanthemum at the point of Condition: Age-related damages, including old padding. the hat, with an opening to insert possibly a bush or flowers. Red Provenance: From a Hungarian private collection. lacquer on the interior. Estimate EUR 300,- DIAMETER 39.3 cm Starting price EUR 150,- 39 | A JINGASA WITH A MON 35 | A JINGASA WITH A RARE MON Condition: The padding and bands are missing. The gilt is worn. Unsigned Provenance: From a Hungarian private collection. Unsigned Japan, late Edo period (1615-1868) Japan, late Edo (1615-1868) to Meiji period (1868-1912) Estimate EUR 300,- Starting price EUR 150,- Coated with black lacquer on the interior and exterior. The Lustrous roironuri on the exterior and interior, the shape of the lightly gilt emblem interestingly shows a bolt of lightning, taken hat like the slight slope of a small hill. The mon painted in gold from ancient China, of martial significance and used by several lacquer on the exterior shows three square frames or kaku – rare aristocratic families as a mon during the Edo period. The padding for a mon but has long been in use. and padded bands are one piece. DIAMETER 42 cm DIAMETER 38 cm Condition: Age-related damages, especially chips on the rim. Condition: Age-related damage. Provenance: From a Hungarian private collection. Provenance: From a Hungarian private collection. Estimate EUR 300,- Estimate EUR 300,- Starting price EUR 150,- Starting price EUR 150,- 20 21 34 | A JINGASA WITH A GENTIAN EMBLEM 38 | A JINGASA WITH A MON Unsigned Unsigned Japan, late Edo period (1615-1868) Japan, late Edo period (1615-1868) Of conical form. The interior is smooth with red lacquer, the Of lightly conical form, black lacquer painted with gold and wickerwork covered with black lacquer shows three decorative silver, showing three vines, each with a bird, as well as a lustrous elements painted with gold lacquer on the exterior, with gentian heraldic mon on the front side showing three stylized geese blossoms and leaves. The gentian or rindo is an old aristocratic within a wide circle. Several tsurugi blades at the point as a emblem, used among others by branches of the important symbol of war but executed in the style of the Chinese ken. There Minamoto. is no padding on the red-lacquered interior and the bands are new. DIAMETER 41.8 cm DIAMETER 40.5 cm Condition: Chips and other damage, padding and bands in good condition. Condition: Chips and other damage. Provenance: From a Hungarian private collection. Provenance: From a Hungarian private collection. Estimate EUR 300,- Estimate EUR 300,- Starting price EUR 150,- Starting price EUR 150,- 37 | A JINGASA WITH A MON 33 | A KUSARI KATABIRA (CHAIN-MAIL JACKET) Unsigned Japan, Edo period (1615-1868) Japan, late Edo period (1615-1868) 2IVKRUWVOHHYHVDQGYHU\KHDY\bPDGHRIEOXHIDEULFZLWKVHZQ Of relatively small size, black on the exterior and with red lacquer linked iron rings. on the interior, and rather flat shape. The gilt symbol on the exterior meaning igeta (puteal). Lacing on the interior. SIZE c. 75 x 105 cm DIAMETER 34.7 cm Condition: With signs of aging, tears to fabric, wear, rust and material loss. Condition: Chips and other damage. Provenance: Hungarian private collection. Provenance: From a Hungarian private collection. Estimate EUR 700,- Estimate EUR 300,- Starting price EUR 350,- Starting price EUR 150,- 36 | A JINGASA WITH TWO MON 40 | A JINGASA WITH PHOENIXES Japan, late Edo (1615-1868) to Meiji period (1868-1912) Unsigned Japan, Meiji period (1868-1912) Lustrous roironuri on the exterior and red lacquer on the interior. Two mon are painted with gold lacquer on the exterior, An interesting piece with a slightly more curved rim, but the hexagonal one shows a crane, a symbol of long life and a especially with its depiction of two ho-o (phoenixes), one male popular emblem among the warrior class while the round one and the other female. There is no difference between them shows a stylized character Hayashi for “forest”. on the surface, both flying with beautiful tail feathers and symbolizing imperial power. These ho-o are not painted on the DIAMETER 42 cm hat but executed in a lightly raised relief with lacquer and gilt. A silver mounting in the form of a chrysanthemum at the point of Condition: Age-related damages, including old padding. the hat, with an opening to insert possibly a bush or flowers. Red Provenance: From a Hungarian private collection. lacquer on the interior. Estimate EUR 300,- DIAMETER 39.3 cm Starting price EUR 150,- 39 | A JINGASA WITH A MON 35 | A JINGASA WITH A RARE MON Condition: The padding and bands are missing. The gilt is worn. Unsigned Provenance: From a Hungarian private collection. Unsigned Japan, late Edo period (1615-1868) Japan, late Edo (1615-1868) to Meiji period (1868-1912) Estimate EUR 300,- Starting price EUR 150,- Coated with black lacquer on the interior and exterior. The Lustrous roironuri on the exterior and interior, the shape of the lightly gilt emblem interestingly shows a bolt of lightning, taken hat like the slight slope of a small hill. The mon painted in gold from ancient China, of martial significance and used by several lacquer on the exterior shows three square frames or kaku – rare aristocratic families as a mon during the Edo period. The padding for a mon but has long been in use. and padded bands are one piece. DIAMETER 42 cm DIAMETER 38 cm Condition: Age-related damages, especially chips on the rim. Condition: Age-related damage. Provenance: From a Hungarian private collection. Provenance: From a Hungarian private collection. Estimate EUR 300,- Estimate EUR 300,- Starting price EUR 150,- Starting price EUR 150,- 20 21 41 | A YASUYUKI STYLE CLOISONNÉ VASE 44 | A PAIR OF SMALL CLOISONNÉ VASES Japan, early Meiji period (1868-1912) Japan, Meiji period (1868-1912) The vase with an appealing amphora shape and original bronze Each vase baluster-shaped and decorated with silver wire and mountings. The central part is finely enameled with swallows and colored enamels on a midnight blue ground and depicting a wisteria above a bright blue ground. The midnight blue, almost sparrow in flight amongst wisteria and iris blossoms. black neck with its various butterflies is highly reminiscent of some early works by the famous Namikawa Yasuyuki. The base shows HEIGHT each 12 cm spuming waves and water birds. Condition: Miniscule surface wear. Very good condition. HEIGHT 25 cm Provenance: Austrian private collection acquired at the local WEIGHT 575.9 grams Viennese art market. Condition: The lip slightly warped and with very small, associated Estimate EUR 400,- losses. Very few small, hardly visible hairlines here and there. Starting price EUR 200,- 45 | A PAIR OF CLOISONNE ENAMEL VASES Overall good, well-presentable, condition. WITH BUTTERFLIES Provenance: Austrian private collection. Japan, Meiji period (1868-1912) Estimate EUR 500,- Starting price EUR 250,- A pair of bulbous vases with a fine dark green ground and decorated in colored enamels with many butterflies. The underside shows gilding to the copper and the rim of the mouth is raised, thick and circular. 42 | A LIDDED CLOISONNÉ VASE HEIGHT each 16 cm Condition: Minor expected surface scratches. One of the vases Japan, Meiji period (1868-1912) with a damaged area near the neck next to several scratches. Otherwise good condition. Provenance: From the collection of Alexander Popov in Novi Sad, %DOXVWHUVKDSHGYDVHZLWKDVOLPERG\FLUFXODUEDVHDQGOLG7KH Kingdom of Serbia, acquired between 1900-1920. top section is decorated with scrolling vines and floral motifs in FLUFXODUUHVHUYHV%HORZDUHVKLHOGVKDSHGUHVHUYHVZLWKDOWHUQDWLQJ Estimate EUR 400,- designs of stylized phoenixes and dragons. The rims with a brocade Starting price EUR 200,- pattern, all against a beige-grey ground. The lid with the same scrolling vine décor and a pink knob. HEIGHT 14 cm 46 | TWO CLOSONNÉ VASES 47 | A PAIR OF SMALL CLOISONNÉ VASES Condition: Good condition with two small hairlines around the Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) mouth. Provenance: Austrian private collection. One cloisonné vase depicting a lady holding a flower in her hand, %RWKYDVHVKDYHRYRLGVKDSHVDQGHYHUWHGOLSV7KHIORUDO Estimate EUR 400,- the other a crane. composition on a deep black-blue background is rather free and Starting price EUR 200,- very lively in a decorative way, showing tangled branches of the HEIGHT 12 cm each plum tree (ume) but also other blossoms and leaves, including lotus. Condition: Overall in good condition, the vase with the lady with chipping and a few cracks. HEIGHT 14.7 cm Provenance: From the collection of Alexander Popov in Novi Sad, 43 | A FINE CLOISONNÉ ENAMEL VASE IN Kingdom of Serbia, acquired between 1900-1920. Condition: Good condition, the first with two tiny nicks, the THE MANNER OF HAYASHI KODENJI second with a crack. Estimate EUR 300,- Provenance: From an Austrian private collection, formerly Japan, Meiji period (1868-1912) Starting price EUR 150,- collection Doblhoff. Estimate EUR 1.000,- The faceted vase shows a midnight blue ground and is decorated Starting price EUR 500,- with silver wire and colored enamels to depict a tranquil scene of two sparrows perched on a branch beneath hanging wisteria and above a dense composition of flowers including morning glory, peonies and iris blossoms. Another sparrow is depicted in flight next to the wisteria. The mouth and base with a silver-applied rim. HEIGHT 25 cm Condition: Small imperfections and faults, minor fritting, minor surface scratches and minor surface wear. One larger area where the enamel has been damaged and sealed above the third sparrow in flight. Generally, in good condition. Provenance: Austrian private collection acquired at the local Viennese art market. Estimate EUR 500,- Starting price EUR 250,- 22 23 41 | A YASUYUKI STYLE CLOISONNÉ VASE 44 | A PAIR OF SMALL CLOISONNÉ VASES Japan, early Meiji period (1868-1912) Japan, Meiji period (1868-1912) The vase with an appealing amphora shape and original bronze Each vase baluster-shaped and decorated with silver wire and mountings. The central part is finely enameled with swallows and colored enamels on a midnight blue ground and depicting a wisteria above a bright blue ground. The midnight blue, almost sparrow in flight amongst wisteria and iris blossoms. black neck with its various butterflies is highly reminiscent of some early works by the famous Namikawa Yasuyuki. The base shows HEIGHT each 12 cm spuming waves and water birds. Condition: Miniscule surface wear. Very good condition. HEIGHT 25 cm Provenance: Austrian private collection acquired at the local WEIGHT 575.9 grams Viennese art market. Condition: The lip slightly warped and with very small, associated Estimate EUR 400,- losses. Very few small, hardly visible hairlines here and there. Starting price EUR 200,- 45 | A PAIR OF CLOISONNE ENAMEL VASES Overall good, well-presentable, condition. WITH BUTTERFLIES Provenance: Austrian private collection. Japan, Meiji period (1868-1912) Estimate EUR 500,- Starting price EUR 250,- A pair of bulbous vases with a fine dark green ground and decorated in colored enamels with many butterflies. The underside shows gilding to the copper and the rim of the mouth is raised, thick and circular. 42 | A LIDDED CLOISONNÉ VASE HEIGHT each 16 cm Condition: Minor expected surface scratches. One of the vases Japan, Meiji period (1868-1912) with a damaged area near the neck next to several scratches. Otherwise good condition. Provenance: From the collection of Alexander Popov in Novi Sad, %DOXVWHUVKDSHGYDVHZLWKDVOLPERG\FLUFXODUEDVHDQGOLG7KH Kingdom of Serbia, acquired between 1900-1920. top section is decorated with scrolling vines and floral motifs in FLUFXODUUHVHUYHV%HORZDUHVKLHOGVKDSHGUHVHUYHVZLWKDOWHUQDWLQJ Estimate EUR 400,- designs of stylized phoenixes and dragons. The rims with a brocade Starting price EUR 200,- pattern, all against a beige-grey ground. The lid with the same scrolling vine décor and a pink knob. HEIGHT 14 cm 46 | TWO CLOSONNÉ VASES 47 | A PAIR OF SMALL CLOISONNÉ VASES Condition: Good condition with two small hairlines around the Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) mouth. Provenance: Austrian private collection. One cloisonné vase depicting a lady holding a flower in her hand, %RWKYDVHVKDYHRYRLGVKDSHVDQGHYHUWHGOLSV7KHIORUDO Estimate EUR 400,- the other a crane. composition on a deep black-blue background is rather free and Starting price EUR 200,- very lively in a decorative way, showing tangled branches of the HEIGHT 12 cm each plum tree (ume) but also other blossoms and leaves, including lotus. Condition: Overall in good condition, the vase with the lady with chipping and a few cracks. HEIGHT 14.7 cm Provenance: From the collection of Alexander Popov in Novi Sad, 43 | A FINE CLOISONNÉ ENAMEL VASE IN Kingdom of Serbia, acquired between 1900-1920. Condition: Good condition, the first with two tiny nicks, the THE MANNER OF HAYASHI KODENJI second with a crack. Estimate EUR 300,- Provenance: From an Austrian private collection, formerly Japan, Meiji period (1868-1912) Starting price EUR 150,- collection Doblhoff. Estimate EUR 1.000,- The faceted vase shows a midnight blue ground and is decorated Starting price EUR 500,- with silver wire and colored enamels to depict a tranquil scene of two sparrows perched on a branch beneath hanging wisteria and above a dense composition of flowers including morning glory, peonies and iris blossoms. Another sparrow is depicted in flight next to the wisteria. The mouth and base with a silver-applied rim. HEIGHT 25 cm Condition: Small imperfections and faults, minor fritting, minor surface scratches and minor surface wear. One larger area where the enamel has been damaged and sealed above the third sparrow in flight. Generally, in good condition. Provenance: Austrian private collection acquired at the local Viennese art market. Estimate EUR 500,- Starting price EUR 250,- 22 23 48 | 11-PART SIGNED SATSUMA TEA SET Japan, Meiji period (1868-1912) Signed Nikko and with the Shimazu crest on the underside. Masterful hand painting with polychrome enamels and gold. Depicted are blooming flower meadows and butterflies. The set consist of 4 cups and saucers, a lidded milk jug, a sugar box and a tea pot both also with their original lid. HEIGHT of the teapot 17 cm, DIAMETER of one saucer 12 cm and HEIGHT of one tea cup 4.5 cm Condition: Perfect condition with only minimal traces of age. Provenance: From an Austrian private collection. Estimate EUR 600,- 52 | A SATSUMA CERAMIC VASE Starting price EUR 300,- Japan, Meiji period (1868-1912) 49 | A LIDDED SATSUMA BOWL 51 | A SAKE STORAGE BOTTLE IN THE STYLE OF $EDOXVWHUVKDSHGYDVHGHFRUDWHGZLWKDQLPDJHRI%LMLQDQG AOKI MOKUBEI, MEIJI OR LATER boys arranged in a reserve. The base with artist signature. Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) or later HEIGHT 22.5 cm A three-legged lidded satsuma ceramic bowl elaborately painted Condition: Good condition. with diverse flowers and birds. On the bottom the signature within The globular bottle vase with a cylindrical neck and lipped rim, Provenance Swiss private collection. a black square. enameled and gilt with a group of Chinese immortal sages and karakos, including Taoist Immortal Kinko riding a giant carp, amid Estimate EUR 400,- DIAMETER 8 cm, HEIGHT 4.3 cm SLQHWUHHVΖQVFULEHG.87$1Ζ02.8%(ΖWRWKHEDVH Starting price EUR 200,- Condition: Some rubbing to the enamel, the lid with three chips. HEIGHT 27.3 cm Provenance: Austrian private collection. Condition: Excellent condition with minor wear, intentional 54 | A JAPANESE NORITAKE PORCELAIN VASE Estimate EUR 200,- crackling. Starting price EUR 100,- Provenance: From the collection of Georg Weifert (1850-1937). Japan, 20th century Thence by descent in the same family. Weifert was a Serbo- $XVWULDQLQGXVWULDOLVWDQGWKHILUVWJRYHUQRURIWKH)HGHUDO%DQNRI the Kingdom of Serbia, Croatia and Slovenia. The baluster-shaped vase with a hand painted landscape of trees and mountains, executed in various shades of greens, yellows Estimate EUR 1.000,- DQGUHGV7KHXQGHUVLGHPDUNHG125Ζ7$.(%21(&+Ζ1$ Starting price EUR 500,- NIPPON TOKI KAISHA. HEIGHT 29 cm 53 | A JAPANESE PAINTED CERAMIC KUTANI VASE Condition: Good condition. Provence: Swiss private collection. Japan, Meiji period (1868-1912) to Taisho period (1912-1926) Estimate EUR 800,- Starting price EUR 400,- Of ovoid shape and slightly everted lip, hand-painted to depict a scene of court nobles and calligraphy within reserves. The base 50 | VERY LARGE SATSUMA CHIKUSAI VASE with a Kutani mark. Japan, Meiji period (1868-1912) HEIGHT 17.5 cm Condition: Good condition. Signed Satsuma Chikusai and with the Shimazu mon crest on Provenance: Swiss private collection. the underside. Masterful hand painting in high relief polychrome enamels and gold. Depicted are various flowers such as peonies, Estimate EUR 500,- chrysanthemum or mallows as well as misty golden clouds. Starting price EUR 250,- HEIGHT approx. 46.5 cm WEIGHT 8.9 kilograms Condition: Perfect condition with only minimal traces of age. Provenance: From a German private collection, by repute in the same family since the early 1900s. Compare with a related vase of the same workshop and dating to the same period sold at Christie’s, Japanese Art and Design, London, South Kensington, 10 November 2010, lot 271. Estimate EUR 800,- Starting price EUR 400,- 24 25 48 | 11-PART SIGNED SATSUMA TEA SET Japan, Meiji period (1868-1912) Signed Nikko and with the Shimazu crest on the underside. Masterful hand painting with polychrome enamels and gold. Depicted are blooming flower meadows and butterflies. The set consist of 4 cups and saucers, a lidded milk jug, a sugar box and a tea pot both also with their original lid. HEIGHT of the teapot 17 cm, DIAMETER of one saucer 12 cm and HEIGHT of one tea cup 4.5 cm Condition: Perfect condition with only minimal traces of age. Provenance: From an Austrian private collection. Estimate EUR 600,- 52 | A SATSUMA CERAMIC VASE Starting price EUR 300,- Japan, Meiji period (1868-1912) 49 | A LIDDED SATSUMA BOWL 51 | A SAKE STORAGE BOTTLE IN THE STYLE OF $EDOXVWHUVKDSHGYDVHGHFRUDWHGZLWKDQLPDJHRI%LMLQDQG AOKI MOKUBEI, MEIJI OR LATER boys arranged in a reserve. The base with artist signature. Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) or later HEIGHT 22.5 cm A three-legged lidded satsuma ceramic bowl elaborately painted Condition: Good condition. with diverse flowers and birds. On the bottom the signature within The globular bottle vase with a cylindrical neck and lipped rim, Provenance Swiss private collection. a black square. enameled and gilt with a group of Chinese immortal sages and karakos, including Taoist Immortal Kinko riding a giant carp, amid Estimate EUR 400,- DIAMETER 8 cm, HEIGHT 4.3 cm SLQHWUHHVΖQVFULEHG.87$1Ζ02.8%(ΖWRWKHEDVH Starting price EUR 200,- Condition: Some rubbing to the enamel, the lid with three chips. HEIGHT 27.3 cm Provenance: Austrian private collection. Condition: Excellent condition with minor wear, intentional 54 | A JAPANESE NORITAKE PORCELAIN VASE Estimate EUR 200,- crackling. Starting price EUR 100,- Provenance: From the collection of Georg Weifert (1850-1937). Japan, 20th century Thence by descent in the same family. Weifert was a Serbo- $XVWULDQLQGXVWULDOLVWDQGWKHILUVWJRYHUQRURIWKH)HGHUDO%DQNRI the Kingdom of Serbia, Croatia and Slovenia. The baluster-shaped vase with a hand painted landscape of trees and mountains, executed in various shades of greens, yellows Estimate EUR 1.000,- DQGUHGV7KHXQGHUVLGHPDUNHG125Ζ7$.(%21(&+Ζ1$ Starting price EUR 500,- NIPPON TOKI KAISHA. HEIGHT 29 cm 53 | A JAPANESE PAINTED CERAMIC KUTANI VASE Condition: Good condition. Provence: Swiss private collection. Japan, Meiji period (1868-1912) to Taisho period (1912-1926) Estimate EUR 800,- Starting price EUR 400,- Of ovoid shape and slightly everted lip, hand-painted to depict a scene of court nobles and calligraphy within reserves. The base 50 | VERY LARGE SATSUMA CHIKUSAI VASE with a Kutani mark. Japan, Meiji period (1868-1912) HEIGHT 17.5 cm Condition: Good condition. Signed Satsuma Chikusai and with the Shimazu mon crest on Provenance: Swiss private collection. the underside. Masterful hand painting in high relief polychrome enamels and gold. Depicted are various flowers such as peonies, Estimate EUR 500,- chrysanthemum or mallows as well as misty golden clouds. Starting price EUR 250,- HEIGHT approx. 46.5 cm WEIGHT 8.9 kilograms Condition: Perfect condition with only minimal traces of age. Provenance: From a German private collection, by repute in the same family since the early 1900s. Compare with a related vase of the same workshop and dating to the same period sold at Christie’s, Japanese Art and Design, London, South Kensington, 10 November 2010, lot 271. Estimate EUR 800,- Starting price EUR 400,- 24 25 56 | A CERAMIC OKIMONO OF FUGEN BOSATSU 59 | A PORCELAIN KUTANI DOUBLE GOURD 60 | A FABRIC DOLL OF A GEISHA Japan, Meiji period (1868-1912) TOKKURI WITH POLYCHROME PAINTING Japan, Taisho period (1912-1926) to Showa era (1926-1989) Japan, 19th century, Edo period (1615-1868) The deity depicted on top of an elephant, wearing flowing robes leaving the chest bare, jewels and holding a nyoi-scepter. 55 | FOUR JAPANESE PORCELAIN PLATES AND The Geisha wearing a brocade silk kimono, the hands and face BOWLS Waisted middle section and narrow, cylindrical neck. The wall SDLQWHGLQILQHODFTXHUΖQDPRGHUQVKRZFDVHb HEIGHT 19 cm decorated with geometrical ornaments, landscapes, as well as Japan, 19th/20th century flower and tendril décor. The middle section contrasted with a HEIGHT 27 cm Condition: Multiple restorations, the fingers of one hand, a part of meander border. Fuku mark. the hairband and the tips of both elephant horns missing. Condition: Good condition with minor wear, the two thumbs Provenance: From an Austrian private collection. Kept in the Smallest DIAMETER 19 cm, largest DIAMETER 27 cm HEIGTH 16.5 cm missing, and a finger restored. same family since the first half of the 20th century and thence by Provenance: Austrian private collection. descent. Condition: All in good condition. Condition: Very good condition; the painting is minimal rubbed Provenance: Old Austrian private collection acquired before in places. Estimate EUR 200,- Estimate EUR 300,- 1930. Provenance: Old European collection. Starting price EUR 100,- Starting price EUR 150,- Estimate EUR 150,- Estimate EUR 150,- Starting price EUR 75,- Starting price EUR 75,- 62 | A HAGOITA PADDLE Japan, c. 1900, Meiji period (1868-1912) 61 | A CERAMIC VASE WITH PLAYING BOYS AND BATS $SDLQWHGZRRGbKDJRLWDbSDGGOHZLWKDWKUHHGLPHQVLRQDOFROODJHG Japan, 19th century woman in embroidered silk. Stamp and sticker on the backside. HEIGHT 47 cm Well-formed vase with attractive smudged green glaze depicting two playing boys amongst bats. Condition: Good age-related condition, a chip to the wood and minimal damage to the silk. HEIGHT 21 cm Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by Condition: Metal rim chipped, otherwise good condition. descent. Provenance: Old Austrian private collection acquired before 1930. Estimate EUR 300,- Starting price EUR 150,- Estimate EUR 150,- Starting price EUR 75,- 57 | A GROUP OF SIX JAPANESE OBJECTS Japan, Meiji period (1868-1912) 58 | A GLAZED CERAMIC FIGURE OF DARUMA Japan, Taisho period (1912-1926) to Showa era (1926-1989) Consisting of one small vase, one lacquered comb and tray, a set of two lacquer containers of decreasing size placed inside of each other and a cloisonné teapot. Depicted is Daruma standing in a long robe and holding a basket RISHDFKHV%HDXWLIXOFRORUVRIWKHJOD]H HEIGHT 9 – 14.5 cm HEIGHT 21 cm Condition: Overall good condition, the teapot and two containers with few chips and cracks; one container restored. Condition: Wear and firing imperfections, both hands with a Provenance: From the collection of Alexander Popov in Novi Sad, restoration. Kingdom of Serbia, acquired between 1900-1920. Provenance: Croatian private collection. Estimate EUR 200,- Estimate EUR 200,- Starting price EUR 100,- Starting price EUR 100,- 26 27 56 | A CERAMIC OKIMONO OF FUGEN BOSATSU 59 | A PORCELAIN KUTANI DOUBLE GOURD 60 | A FABRIC DOLL OF A GEISHA Japan, Meiji period (1868-1912) TOKKURI WITH POLYCHROME PAINTING Japan, Taisho period (1912-1926) to Showa era (1926-1989) Japan, 19th century, Edo period (1615-1868) The deity depicted on top of an elephant, wearing flowing robes leaving the chest bare, jewels and holding a nyoi-scepter. 55 | FOUR JAPANESE PORCELAIN PLATES AND The Geisha wearing a brocade silk kimono, the hands and face BOWLS Waisted middle section and narrow, cylindrical neck. The wall SDLQWHGLQILQHODFTXHUΖQDPRGHUQVKRZFDVHb HEIGHT 19 cm decorated with geometrical ornaments, landscapes, as well as Japan, 19th/20th century flower and tendril décor. The middle section contrasted with a HEIGHT 27 cm Condition: Multiple restorations, the fingers of one hand, a part of meander border. Fuku mark. the hairband and the tips of both elephant horns missing. Condition: Good condition with minor wear, the two thumbs Provenance: From an Austrian private collection. Kept in the Smallest DIAMETER 19 cm, largest DIAMETER 27 cm HEIGTH 16.5 cm missing, and a finger restored. same family since the first half of the 20th century and thence by Provenance: Austrian private collection. descent. Condition: All in good condition. Condition: Very good condition; the painting is minimal rubbed Provenance: Old Austrian private collection acquired before in places. Estimate EUR 200,- Estimate EUR 300,- 1930. Provenance: Old European collection. Starting price EUR 100,- Starting price EUR 150,- Estimate EUR 150,- Estimate EUR 150,- Starting price EUR 75,- Starting price EUR 75,- 62 | A HAGOITA PADDLE Japan, c. 1900, Meiji period (1868-1912) 61 | A CERAMIC VASE WITH PLAYING BOYS AND BATS $SDLQWHGZRRGbKDJRLWDbSDGGOHZLWKDWKUHHGLPHQVLRQDOFROODJHG Japan, 19th century woman in embroidered silk. Stamp and sticker on the backside. HEIGHT 47 cm Well-formed vase with attractive smudged green glaze depicting two playing boys amongst bats. Condition: Good age-related condition, a chip to the wood and minimal damage to the silk. HEIGHT 21 cm Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by Condition: Metal rim chipped, otherwise good condition. descent. Provenance: Old Austrian private collection acquired before 1930. Estimate EUR 300,- Starting price EUR 150,- Estimate EUR 150,- Starting price EUR 75,- 57 | A GROUP OF SIX JAPANESE OBJECTS Japan, Meiji period (1868-1912) 58 | A GLAZED CERAMIC FIGURE OF DARUMA Japan, Taisho period (1912-1926) to Showa era (1926-1989) Consisting of one small vase, one lacquered comb and tray, a set of two lacquer containers of decreasing size placed inside of each other and a cloisonné teapot. Depicted is Daruma standing in a long robe and holding a basket RISHDFKHV%HDXWLIXOFRORUVRIWKHJOD]H HEIGHT 9 – 14.5 cm HEIGHT 21 cm Condition: Overall good condition, the teapot and two containers with few chips and cracks; one container restored. Condition: Wear and firing imperfections, both hands with a Provenance: From the collection of Alexander Popov in Novi Sad, restoration. Kingdom of Serbia, acquired between 1900-1920. Provenance: Croatian private collection. Estimate EUR 200,- Estimate EUR 200,- Starting price EUR 100,- Starting price EUR 100,- 26 27 63 | FUJITA: A CHERRYWOOD AND IVORY PANEL OF KIKUJIDO Signed Fujita Japan, Meiji period (1868-1912) Finely inlaid with carved and incised ivory, root wood and mother- RISHDUOWKLVSDQHOGHSLFWVWKH&KU\VDQWKHPXP%R\UHDGLQJDERRN while seated on the trunk of a gnarly plum tree, with a pair of flying suzume above and chrysanthemum flowers (kiku) at his feet. Artist signature FUJITA within an inlaid square seal. Note the fine patina and unctuous surface of the cherry (sakura) wood. SIZE 77 x 47 cm Condition: Excellent condition with some old wear, minor natural warping to some inlays and few traces of use. No losses to inlays! 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.200,- Starting price EUR 600,- 64 | A FINE WOVEN BAMBOO HYOTAN HANAKAGO Japan, 20th century, Meiji period (1868-1912) or Showa era (1912-1926) 66 | MASAMITSU: A FINE SILVER FILIGREE AND SHIBAYAMA DISH The reverse shows four silver filigree feet and a central panel with dense nashiji and signature MASAMITSU – a known Meiji artist who The hanakago (flower basket) made from woven bamboo in the %\0DVDPLWVXVLJQHG0DVDPLWVX worked in Shibayama, lacquer and silver. form of a double-gourd (hyotan) and with an opening for the formal Japan, Meiji period (1868-1912) presentation of flowers (ikebana). The hanakago is mounted onto DIAMETER 28.1 cm a burlwood stand giving it a unique appeal - the natural burlwood twisting and turning around the bamboo hyotan. Of foliate form and finely worked in openwork with silver filigree Condition: Excellent condition. Miniscule wear to lacquer. and inset with eight ivory petal-shaped panels decorated in gold 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 38 cm takamaki-e and hiramaki-e with images of flowers and plants. The octagonal center with a gold lacquered kinji ground with Shibayama Estimate EUR 3.000,- Condition: Very good condition. Miniscule losses and expected inlays showing a flower arrangement set on a red-lacquered table. Starting price EUR 1.500,- surface wear. Provenance: French private collection. Estimate EUR 600,- Starting price EUR 300,- 67 | A FINE MINIATURE IVORY AND SHIBAYAMA DISPLAY CABINET Japan, Meiji period (1868-1912) 65 | FINE IVORY AND SHIBAYAMA GAME COUNTER Japan, Meiji period (1868-1912) Finely worked as a miniature display cabinet (shodana) ideal for the display of miniature objects such as netsuke. The cabinet stands on four flared feet and has two storage drawers carved with celestial 7KHORYHO\ZRRGHQJDPHFRXQWHUILQHO\FRDWHGZLWKUďLURQXUL dragons in high relief grasping a tama (which forms the knob), their Precisely painted depictions of flowers and leaves in hiramaki-e eyes inlaid in mother of pearl. The mid-section allows for display gold lacquer against a black background in the center. Ivory space and one side is finely inlaid in Shibayama style with flowers counters are decorated with mother of pearl and other natural and butterflies. The top section consists of two sliding doors and stones inlays in charming forms of birds and insects. Pair of golden another door with a knob. The sides and top as well are decorated hiramaki-e flowers on the sides. in Shibayama style with flowers, birds and butterflies. The inlays are horn and mother of pearl amongst fine incision work. HEIGHT 6 cm, LENGTH 9.5 cm SIZE 15.4 x 14.2 cm Condition: Very good condition with some minor wear to the lacquer surface and some minor losses. Condition: Excellent condition. Provenance: English private collection. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 150,- Estimate EUR 1.500,- Starting price EUR 75,- Starting price EUR 750,- 28 29 63 | FUJITA: A CHERRYWOOD AND IVORY PANEL OF KIKUJIDO Signed Fujita Japan, Meiji period (1868-1912) Finely inlaid with carved and incised ivory, root wood and mother- RISHDUOWKLVSDQHOGHSLFWVWKH&KU\VDQWKHPXP%R\UHDGLQJDERRN while seated on the trunk of a gnarly plum tree, with a pair of flying suzume above and chrysanthemum flowers (kiku) at his feet. Artist signature FUJITA within an inlaid square seal. Note the fine patina and unctuous surface of the cherry (sakura) wood. SIZE 77 x 47 cm Condition: Excellent condition with some old wear, minor natural warping to some inlays and few traces of use. No losses to inlays! 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.200,- Starting price EUR 600,- 64 | A FINE WOVEN BAMBOO HYOTAN HANAKAGO Japan, 20th century, Meiji period (1868-1912) or Showa era (1912-1926) 66 | MASAMITSU: A FINE SILVER FILIGREE AND SHIBAYAMA DISH The reverse shows four silver filigree feet and a central panel with dense nashiji and signature MASAMITSU – a known Meiji artist who The hanakago (flower basket) made from woven bamboo in the %\0DVDPLWVXVLJQHG0DVDPLWVX worked in Shibayama, lacquer and silver. form of a double-gourd (hyotan) and with an opening for the formal Japan, Meiji period (1868-1912) presentation of flowers (ikebana). The hanakago is mounted onto DIAMETER 28.1 cm a burlwood stand giving it a unique appeal - the natural burlwood twisting and turning around the bamboo hyotan. Of foliate form and finely worked in openwork with silver filigree Condition: Excellent condition. Miniscule wear to lacquer. and inset with eight ivory petal-shaped panels decorated in gold 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 38 cm takamaki-e and hiramaki-e with images of flowers and plants. The octagonal center with a gold lacquered kinji ground with Shibayama Estimate EUR 3.000,- Condition: Very good condition. Miniscule losses and expected inlays showing a flower arrangement set on a red-lacquered table. Starting price EUR 1.500,- surface wear. Provenance: French private collection. Estimate EUR 600,- Starting price EUR 300,- 67 | A FINE MINIATURE IVORY AND SHIBAYAMA DISPLAY CABINET Japan, Meiji period (1868-1912) 65 | FINE IVORY AND SHIBAYAMA GAME COUNTER Japan, Meiji period (1868-1912) Finely worked as a miniature display cabinet (shodana) ideal for the display of miniature objects such as netsuke. The cabinet stands on four flared feet and has two storage drawers carved with celestial 7KHORYHO\ZRRGHQJDPHFRXQWHUILQHO\FRDWHGZLWKUďLURQXUL dragons in high relief grasping a tama (which forms the knob), their Precisely painted depictions of flowers and leaves in hiramaki-e eyes inlaid in mother of pearl. The mid-section allows for display gold lacquer against a black background in the center. Ivory space and one side is finely inlaid in Shibayama style with flowers counters are decorated with mother of pearl and other natural and butterflies. The top section consists of two sliding doors and stones inlays in charming forms of birds and insects. Pair of golden another door with a knob. The sides and top as well are decorated hiramaki-e flowers on the sides. in Shibayama style with flowers, birds and butterflies. The inlays are horn and mother of pearl amongst fine incision work. HEIGHT 6 cm, LENGTH 9.5 cm SIZE 15.4 x 14.2 cm Condition: Very good condition with some minor wear to the lacquer surface and some minor losses. Condition: Excellent condition. Provenance: English private collection. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 150,- Estimate EUR 1.500,- Starting price EUR 75,- Starting price EUR 750,- 28 29 68 | MASAYUKI: A RARE IVORY LENGTH of handle 25 cm, overall LENGTH 96 cm 71 | AN IVORY BIWA LUTE BOX AND SHIBAYAMA PARASOL Condition: The handle in fine condition with only few tiny age cracks Japan, Meiji period (1868-1912) %\0DVD\XNLVLJQHG0DVD\XNL to ivory and a nice naturally grown patina. The pink silk parasol with Japan, Meiji period (1868-1912) traces of use an several large tears, hence in unusable condition (silk needs to be repaired or replaced). The expansion mechanism The instrument is finely carved of two pieces forming the base and of the parasol is in fine working condition. The wrapper is original to the lid. The strings and some elements of décor are inlaid in silver The ivory handle finely inlaid in mother-of-pearl and tortoiseshell the parasol and also comes in fine condition. and neatly incised with swastika and other emblems. The ivory has to depict wisteria amid other flowers, vines and leaves. The artist 3URYHQDQFH%ULWLVKFROOHFWLRQ patinated nicely to a golden-yellow tone. signature incised into a mother-of-pearl cartouche. Estimate EUR 300,- LENGTH 13.5 cm Starting price EUR 150,- Condition: Superb condition with minor wear and one silver string slightly loose. Provenance: From an English private estate. Estimate EUR 600,- Starting price EUR 300,- 72 | A CARVED IVORY SEVEN MICE BOWL Japan, 19th century The sides of this lovely miniature bowl are neatly carved in high relief and with fine incision work to depict a group of seven mice dancing around a Daikoku hammer. Their eyes are finely inlaid in black horn LENGTH 4.5 cm Condition: Good condition. Some natural age cracks. Two of the inlaid eyes have been replaced with black staining. Provenance: Austrian private collection. Estimate EUR 600,- Starting price EUR 300,- 73 | AN IVORY WALKING CANE HANDLE Japan, Meiji period (1868-1912) 70 | A RARE JAPANESE STAG ANTLER ‘DRAGON AND An ivory walking cane handle carved depicting a group of rats, all TIGER’ SCROLL CASE FOR A eyes inlaid. BUDDHIST SUTRA WIDTH of handle c. 13 cm Japan, late 19th century, Meiji period (1868-1912) Condition: Overall good condition. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920. Finely carved stag antler in high relief with roller ends made of dark horn. The case is Estimate EUR 200,- made in the form of a scroll, openable in Starting price EUR 100,- the middle. Depicted is a celestial dragon, 69 | AN IVORY finely carved amidst clouds, the scales and CIGAR HOLDER ILHUFHH[SUHVVLRQSDUWLFXODUO\GHWDLOHG%HORZ 74 | FINE IVORY CIGARETTE CASE the dragon is a tiger snarling at the dragon, WITH DRAGON Japan, Meiji period naturalistically carved with sprays of waves (1868-1912) around him. The antler has been carved with Japan, Meiji period (1868-1912) great skill, somewhat simulating ivory. Fine incision work depicting LENGTH 16 cm A rectangular cigarette case with rounded edges, hinged lid and a peacock standing amid two metal mountings to the sides. Fine carving depicting ferocious bamboo on a craggy rock. Condition: Very good condition, one tiny age coiled dragons amongst swirling clouds. Superb natural patina! crack, a minor imperfection around the edge of the opening and a tiny chip on the edge. HEIGHT 7 cm, LENGTH 10 cm LENGTH 11 cm Provenance: Old Austrian private collection. Condition: Good condition with some wear and traces of use like Condition: Perfect. Tiger and dragon represent the earth and staining and natural age cracks to the sides and back. Nice, old Provenance: Austrian private VN\DQGSURWHFWWKH%XGGKLVWWHDFKLQJVWKDW patina. Small traces of an old restoration. collection. would be stored inside this scroll. Provenance: Old Zagreb private collection. Estimate EUR 200,- Estimate EUR 600,- Estimate EUR 300,- Starting price EUR 100,- Starting price EUR 300,- Starting price EUR 150,- 30 31 68 | MASAYUKI: A RARE IVORY LENGTH of handle 25 cm, overall LENGTH 96 cm 71 | AN IVORY BIWA LUTE BOX AND SHIBAYAMA PARASOL Condition: The handle in fine condition with only few tiny age cracks Japan, Meiji period (1868-1912) %\0DVD\XNLVLJQHG0DVD\XNL to ivory and a nice naturally grown patina. The pink silk parasol with Japan, Meiji period (1868-1912) traces of use an several large tears, hence in unusable condition (silk needs to be repaired or replaced). The expansion mechanism The instrument is finely carved of two pieces forming the base and of the parasol is in fine working condition. The wrapper is original to the lid. The strings and some elements of décor are inlaid in silver The ivory handle finely inlaid in mother-of-pearl and tortoiseshell the parasol and also comes in fine condition. and neatly incised with swastika and other emblems. The ivory has to depict wisteria amid other flowers, vines and leaves. The artist 3URYHQDQFH%ULWLVKFROOHFWLRQ patinated nicely to a golden-yellow tone. signature incised into a mother-of-pearl cartouche. Estimate EUR 300,- LENGTH 13.5 cm Starting price EUR 150,- Condition: Superb condition with minor wear and one silver string slightly loose. Provenance: From an English private estate. Estimate EUR 600,- Starting price EUR 300,- 72 | A CARVED IVORY SEVEN MICE BOWL Japan, 19th century The sides of this lovely miniature bowl are neatly carved in high relief and with fine incision work to depict a group of seven mice dancing around a Daikoku hammer. Their eyes are finely inlaid in black horn LENGTH 4.5 cm Condition: Good condition. Some natural age cracks. Two of the inlaid eyes have been replaced with black staining. Provenance: Austrian private collection. Estimate EUR 600,- Starting price EUR 300,- 73 | AN IVORY WALKING CANE HANDLE Japan, Meiji period (1868-1912) 70 | A RARE JAPANESE STAG ANTLER ‘DRAGON AND An ivory walking cane handle carved depicting a group of rats, all TIGER’ SCROLL CASE FOR A eyes inlaid. BUDDHIST SUTRA WIDTH of handle c. 13 cm Japan, late 19th century, Meiji period (1868-1912) Condition: Overall good condition. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920. Finely carved stag antler in high relief with roller ends made of dark horn. The case is Estimate EUR 200,- made in the form of a scroll, openable in Starting price EUR 100,- the middle. Depicted is a celestial dragon, 69 | AN IVORY finely carved amidst clouds, the scales and CIGAR HOLDER ILHUFHH[SUHVVLRQSDUWLFXODUO\GHWDLOHG%HORZ 74 | FINE IVORY CIGARETTE CASE the dragon is a tiger snarling at the dragon, WITH DRAGON Japan, Meiji period naturalistically carved with sprays of waves (1868-1912) around him. The antler has been carved with Japan, Meiji period (1868-1912) great skill, somewhat simulating ivory. Fine incision work depicting LENGTH 16 cm A rectangular cigarette case with rounded edges, hinged lid and a peacock standing amid two metal mountings to the sides. Fine carving depicting ferocious bamboo on a craggy rock. Condition: Very good condition, one tiny age coiled dragons amongst swirling clouds. Superb natural patina! crack, a minor imperfection around the edge of the opening and a tiny chip on the edge. HEIGHT 7 cm, LENGTH 10 cm LENGTH 11 cm Provenance: Old Austrian private collection. Condition: Good condition with some wear and traces of use like Condition: Perfect. Tiger and dragon represent the earth and staining and natural age cracks to the sides and back. Nice, old Provenance: Austrian private VN\DQGSURWHFWWKH%XGGKLVWWHDFKLQJVWKDW patina. Small traces of an old restoration. collection. would be stored inside this scroll. Provenance: Old Zagreb private collection. Estimate EUR 200,- Estimate EUR 600,- Estimate EUR 300,- Starting price EUR 100,- Starting price EUR 300,- Starting price EUR 150,- 30 31 75 | AN IVORY AND SHIBAYAMA 76 | A RARE IVORY AND SHIBAYAMA 79 | A FINE IVORY AND SHIBAYAMA 80 | AN UNUSUAL IVORY AND SHIBAYAMA OKIMONO OF A THICK GOURD EROTIC OKIMONO OKIMONO OF A PEAR EROTIC OKIMONO OF A POD Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) An ivory okimono in the shape of a thick gourd with a short An ivory okimono in the shape of a gourd with a long stem, The carving in the shape of a pear with a long, naturalistically An ivory okimono in the shape of a pod opening in the front to naturalistically textured stem, while the ivory is smooth and however resembling a female body with supple breasts and textured stem, while the ivory is smooth and polished to a high reveal the seeds, subtly resembling female genitalia. The surface polished to a high luster. Most finely and precisely inlaid in buttocks and revealed female genitalia. The body is adorned with luster. Most finely and precisely inlaid in shibayama with nine of the finely polished ivory is adorned with insects inlaid in Shibayama with nine different insects, executed in mother-of- insects inlaid in Shibayama style with inlays of mother-of-pearl, different insects, executed in mother-of-pearl, horn, lacquer and Shibayama style with inlays of mother-of-pearl, horn, lacquer and pearl, horn, lacquer and coral. Artist signature in red color. horn, lacquer and coral. Artist signature in red color. coral. Artist signature in red color. coral. Artist signature in red color. HEIGHT 10.1 cm HEIGHT 10.1 cm HEIGHT 8.6 cm HEIGHT 10.1 cm Condition: Very good condition with age cracks. Condition: Very good condition with age cracks. Condition: Very good condition with age cracks. Condition: Very good condition with age cracks. Provenance: German private collection. Provenance: German private collection. Provenance: German private collection. Provenance: German private collection. Estimate EUR 1.500,- Estimate EUR 1.800,- Estimate EUR 1.500,- Estimate EUR 1.500,- Starting price EUR 750,- Starting price EUR 900,- Starting price EUR 750,- Starting price EUR 750,- 77 | A SHIBAYAMA INLAID IVORY 78 | A SHIBAYAMA INLAID IVORY 81 | AN IVORY CARVING WITH 82 | A SHIBAYAMA INLAID IVORY OKIMONO OF A GOURD OKIMONO OF A PEAR SHIBAYAMA INLAID INSECTS OKIMONO OF A FRUIT Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) A naturalistically carved gourd inlaid in shibayama style with A naturalistically carved pear (nashiji) inlaid in shibayama style The pear-form carving with a long, naturalistically textured A naturalistically carved fruit partially peeled to reveal its pods, eleven various insects and signed. with eight various insects and signed. stem, while the ivory is smooth and polished to a high luster. inlaid in shibayama style with thirteen various insects and signed. Most finely and precisely inlaid in Shibayama with nine different HEIGHT 6 cm HEIGHT 8 cm insects, executed in mother-of-pearl, horn, lacquer and coral. LENGTH 10.5 cm Artist signature in red color. Condition: Very good condition with few expected age cracks. Condition: Very good condition. Condition: Very good condition with few expected age cracks. Provenance: German private collection. Provenance: German private collection. HEIGHT 8.6 cm Provenance: German private collection. Estimate EUR 1.500,- Estimate EUR 1.500,- Condition: Very good condition. Estimate EUR 1.500,- Starting price EUR 750,- Starting price EUR 750,- Provenance: German private collection. Starting price EUR 750,- Estimate EUR 1.500,- Starting price EUR 750,- 32 33 75 | AN IVORY AND SHIBAYAMA 76 | A RARE IVORY AND SHIBAYAMA 79 | A FINE IVORY AND SHIBAYAMA 80 | AN UNUSUAL IVORY AND SHIBAYAMA OKIMONO OF A THICK GOURD EROTIC OKIMONO OKIMONO OF A PEAR EROTIC OKIMONO OF A POD Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) An ivory okimono in the shape of a thick gourd with a short An ivory okimono in the shape of a gourd with a long stem, The carving in the shape of a pear with a long, naturalistically An ivory okimono in the shape of a pod opening in the front to naturalistically textured stem, while the ivory is smooth and however resembling a female body with supple breasts and textured stem, while the ivory is smooth and polished to a high reveal the seeds, subtly resembling female genitalia. The surface polished to a high luster. Most finely and precisely inlaid in buttocks and revealed female genitalia. The body is adorned with luster. Most finely and precisely inlaid in shibayama with nine of the finely polished ivory is adorned with insects inlaid in Shibayama with nine different insects, executed in mother-of- insects inlaid in Shibayama style with inlays of mother-of-pearl, different insects, executed in mother-of-pearl, horn, lacquer and Shibayama style with inlays of mother-of-pearl, horn, lacquer and pearl, horn, lacquer and coral. Artist signature in red color. horn, lacquer and coral. Artist signature in red color. coral. Artist signature in red color. coral. Artist signature in red color. HEIGHT 10.1 cm HEIGHT 10.1 cm HEIGHT 8.6 cm HEIGHT 10.1 cm Condition: Very good condition with age cracks. Condition: Very good condition with age cracks. Condition: Very good condition with age cracks. Condition: Very good condition with age cracks. Provenance: German private collection. Provenance: German private collection. Provenance: German private collection. Provenance: German private collection. Estimate EUR 1.500,- Estimate EUR 1.800,- Estimate EUR 1.500,- Estimate EUR 1.500,- Starting price EUR 750,- Starting price EUR 900,- Starting price EUR 750,- Starting price EUR 750,- 77 | A SHIBAYAMA INLAID IVORY 78 | A SHIBAYAMA INLAID IVORY 81 | AN IVORY CARVING WITH 82 | A SHIBAYAMA INLAID IVORY OKIMONO OF A GOURD OKIMONO OF A PEAR SHIBAYAMA INLAID INSECTS OKIMONO OF A FRUIT Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) A naturalistically carved gourd inlaid in shibayama style with A naturalistically carved pear (nashiji) inlaid in shibayama style The pear-form carving with a long, naturalistically textured A naturalistically carved fruit partially peeled to reveal its pods, eleven various insects and signed. with eight various insects and signed. stem, while the ivory is smooth and polished to a high luster. inlaid in shibayama style with thirteen various insects and signed. Most finely and precisely inlaid in Shibayama with nine different HEIGHT 6 cm HEIGHT 8 cm insects, executed in mother-of-pearl, horn, lacquer and coral. LENGTH 10.5 cm Artist signature in red color. Condition: Very good condition with few expected age cracks. Condition: Very good condition. Condition: Very good condition with few expected age cracks. Provenance: German private collection. Provenance: German private collection. HEIGHT 8.6 cm Provenance: German private collection. Estimate EUR 1.500,- Estimate EUR 1.500,- Condition: Very good condition. Estimate EUR 1.500,- Starting price EUR 750,- Starting price EUR 750,- Provenance: German private collection. Starting price EUR 750,- Estimate EUR 1.500,- Starting price EUR 750,- 32 33 87 | AN AMUSING AND EXCELLENT IVORY OKIMONO OF A KAPPA WITH CUCUMBER BY MUNEHARU %\0XQHKDUXVLJQHG0XQHKDUX Japan, late 19th century, Meiji period (1868-1912) A very well detailed and amusing okimono depicting a kappa pulling a huge cucumber, the favourite food of the kappa, 88 | AN IVORY OKIMONO OF A CORNCOB 83 | A SHIBAYAMA STYLE INLAID 84 | A SHIBAYAMA STYLE INLAID with a rope. The aquatic creature has its head tilted to the left IVORY GLOVE STRETCHER IVORY TOOTHPICK CASE with squinting eyes, inlaid in dark horn, and is exclaiming as the large cucumber is probably very heavy. The rope is carved Unsigned very precisely and ties around the cucumber several times. Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) The cucumber is also carved realistically with the spiny surface stippled and the characteristic ‘dots’ inlaid in horn. The signature MUNEHARU is found in a rounded reserve under the cucumber. Finely and naturalistically carved as a corncob, its skin partially The glove stretchers inlaid in shibayama style with horn, precious The toothpick case inlaid in shibayama style with horn and peeled revealing the individual kernels. The leaves in the back stones and mother of pearl depicting beetles. With inscribed precious stones, depicting beetles on the lid. HEIGHT 5 cm, LENGTH 9.5 cm finely incised and flowing towards the frontside. initials ‘SH’. LENGTH 9 cm Condition: Very good condition with no restorations, only the tip LENGTH 14 cm LENGTH 21.5 cm of the cucumber branch has a small chip. Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Expected age cracks, imperfections, minor wear. Very Condition: Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 800,- Provenance: French private collection. Estimate EUR 300,- Starting price EUR 400,- Estimate EUR 300,- Starting price EUR 150,- Estimate EUR 300,- Starting price EUR 150,- Starting price EUR 150,- 86 | AN IVORY OKIMONO OF A CAT AND RAT 90 | AN IVORY OKIMONO OF A RECUMBENT OX BY GOYOSAI Unsigned Japan, late 19th century, Meiji period (1868-1912) %\*R\RVDLVLJQHG*R\RVDL Japan, late 19th to early 20th century, Meiji period (1868-1912) An ivory okimono of a housecat, wearing a bell-collar, holding down a rat and preparing to strike it. The rat is struggling and An unusual ivory okimono depicting a jolly ox, the eyes double screeching with opened mouth and visible teeth. Its tail curls up inlaid in reddish and dark horn. The ox has its head slightly lifted around to the cat’s side and it is pulling on its fur. The cat has a and tilted to the left with a very curious expression and a wide playful and confident expression and its body is slightly contorted smile showing both rows of his teeth and the tongue. The details as it lifts one paw up high, ready to attack. The paws are carved are well-carved – such as the rope halter through the nose, especially well and naturalistic. The eyes of the cat and rat are the bulky horns and the saddle cloth which shows an incised inlaid with reddish and black horn, respectively. zig-zag pattern. The underside is equally accomplished with the expressive skin-fold of the neck and tucked-in legs, as well as the HEIGHT 5.5 cm, LENGTH 9.5 cm unusually large, smooth and round genitals. The signature is in a wavy reserve reads GOYOSAI. Condition: Very good condition, minor discoloration in some areas of the ivory. LENGTH 11.2 cm 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Several age cracks and the stained ivory is worn in Estimate EUR 400,- some areas – generally in good and complete condition. Starting price EUR 200,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Starting price EUR 300,- 85 | A SMALL IVORY OKIMONO 89 | AN IVORY OKIMONO OF A PEELING OF AN OLD TREE TRUNK BANANA WITH SILVER MOUNT Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) HEIGHT 8 cm The banana peeling from two separate sections to reveal the fruit. Silver mount at the end for suspension. Condition: Expected age cracks, the top plate restored and with missing parts. LENGTH 10.5 cm Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by Condition: Good condition; age cracks. descent. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 200,- Estimate EUR 300,- Starting price EUR 100,- Starting price EUR 150,- 34 35 87 | AN AMUSING AND EXCELLENT IVORY OKIMONO OF A KAPPA WITH CUCUMBER BY MUNEHARU %\0XQHKDUXVLJQHG0XQHKDUX Japan, late 19th century, Meiji period (1868-1912) A very well detailed and amusing okimono depicting a kappa pulling a huge cucumber, the favourite food of the kappa, 88 | AN IVORY OKIMONO OF A CORNCOB 83 | A SHIBAYAMA STYLE INLAID 84 | A SHIBAYAMA STYLE INLAID with a rope. The aquatic creature has its head tilted to the left IVORY GLOVE STRETCHER IVORY TOOTHPICK CASE with squinting eyes, inlaid in dark horn, and is exclaiming as the large cucumber is probably very heavy. The rope is carved Unsigned very precisely and ties around the cucumber several times. Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) The cucumber is also carved realistically with the spiny surface stippled and the characteristic ‘dots’ inlaid in horn. The signature MUNEHARU is found in a rounded reserve under the cucumber. Finely and naturalistically carved as a corncob, its skin partially The glove stretchers inlaid in shibayama style with horn, precious The toothpick case inlaid in shibayama style with horn and peeled revealing the individual kernels. The leaves in the back stones and mother of pearl depicting beetles. With inscribed precious stones, depicting beetles on the lid. HEIGHT 5 cm, LENGTH 9.5 cm finely incised and flowing towards the frontside. initials ‘SH’. LENGTH 9 cm Condition: Very good condition with no restorations, only the tip LENGTH 14 cm LENGTH 21.5 cm of the cucumber branch has a small chip. Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Expected age cracks, imperfections, minor wear. Very Condition: Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 800,- Provenance: French private collection. Estimate EUR 300,- Starting price EUR 400,- Estimate EUR 300,- Starting price EUR 150,- Estimate EUR 300,- Starting price EUR 150,- Starting price EUR 150,- 86 | AN IVORY OKIMONO OF A CAT AND RAT 90 | AN IVORY OKIMONO OF A RECUMBENT OX BY GOYOSAI Unsigned Japan, late 19th century, Meiji period (1868-1912) %\*R\RVDLVLJQHG*R\RVDL Japan, late 19th to early 20th century, Meiji period (1868-1912) An ivory okimono of a housecat, wearing a bell-collar, holding down a rat and preparing to strike it. The rat is struggling and An unusual ivory okimono depicting a jolly ox, the eyes double screeching with opened mouth and visible teeth. Its tail curls up inlaid in reddish and dark horn. The ox has its head slightly lifted around to the cat’s side and it is pulling on its fur. The cat has a and tilted to the left with a very curious expression and a wide playful and confident expression and its body is slightly contorted smile showing both rows of his teeth and the tongue. The details as it lifts one paw up high, ready to attack. The paws are carved are well-carved – such as the rope halter through the nose, especially well and naturalistic. The eyes of the cat and rat are the bulky horns and the saddle cloth which shows an incised inlaid with reddish and black horn, respectively. zig-zag pattern. The underside is equally accomplished with the expressive skin-fold of the neck and tucked-in legs, as well as the HEIGHT 5.5 cm, LENGTH 9.5 cm unusually large, smooth and round genitals. The signature is in a wavy reserve reads GOYOSAI. Condition: Very good condition, minor discoloration in some areas of the ivory. LENGTH 11.2 cm 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Several age cracks and the stained ivory is worn in Estimate EUR 400,- some areas – generally in good and complete condition. Starting price EUR 200,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Starting price EUR 300,- 85 | A SMALL IVORY OKIMONO 89 | AN IVORY OKIMONO OF A PEELING OF AN OLD TREE TRUNK BANANA WITH SILVER MOUNT Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) HEIGHT 8 cm The banana peeling from two separate sections to reveal the fruit. Silver mount at the end for suspension. Condition: Expected age cracks, the top plate restored and with missing parts. LENGTH 10.5 cm Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by Condition: Good condition; age cracks. descent. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 200,- Estimate EUR 300,- Starting price EUR 100,- Starting price EUR 150,- 34 35 91 | RYUKO: A LARGE AND SPECTACULAR beauty, and one wonders what she might be dreaming. The garment 93 | A MASTERFUL AND MONUMENTAL TOKYO SCHOOL IVORY OKIMONO folds are carved incredibly well, almost coming to life. Her hair is SECTIONAL IVORY OKIMONO OF A OF A SLEEPING BIJIN incised precisely and tied up at the back. One striking detail is the COCKATOO sandals she is wearing, one of them gently coming off her extended %\5\XNRVLJQHG5\XNR foot. The shape of the okimono is elegant, further underlining her Japan, Meiji period (1868-1912) Japan, Tokyo, Meiji period (1868-1912) beauty. An exceptional masterpiece from the Tokyo school. The base with two floral mon and the signature in sosho RYUKO. The feathery bird is perched on a black burlwood stand, its A large and impressive okimono depicting a serenely sleeping LENGTH 18.6 cm talons tightly gripping a branch. The bird is crafted with superior bijin (beauty), her head rested on a basket. The girl has fallen naturalism, the plumage is masterfully carved and three- asleep after a harvest and she is in a deep slumber. The artist has Condition: Excellent condition, expected minor age cracks. dimensional with neatly incised lines. The cockatoo has its head mastered both her exhaustion and beauty impeccably – a delicate 3URYHQDQFH%ULWLVKFROOHFWLRQ slightly lowered and the large eyes are lacquered in black with balance of subtle nuances. Her wrist bends over the edge of the inlaid silver rings for the pupils. The defining attributes of this basket, her mouth is slightly opened, and her expression is sunken. Estimate EUR 3.500,- exotic bird are the long tail feathers and the crest on the back of Her facial features are crafted sensitively, showing her sublime Starting price EUR 1.750,- its head. HEIGHT 62 cm with stand, 29 cm without stand Condition: Very good complete and original condition. Minor wear and natural age cracks and very minor losses and chipping to the edge of some feathers. 3URYHQDQFH%ULWLVKFROOHFWLRQ The cockatoo is not native to Japan and was probably introduced by the Dutch. It became a popular theme in Japanese art, perhaps most famously treated by the woodblock print artist Ohara Shoson (1877-1945). This monumental sculpture was probably intended for a Japanese World Fair during the Meiji period. Auction comparison: Compare to a near identical example sold at %RQKDPV$VLDQ$UW-XO\(GLQEXUJKORW Estimate EUR 18.000,- Starting price EUR 9.000,- 94 | A MONUMENTAL AND RARE STATUE OF A WHITE GYRFALCON Japan, Meiji period (1868-1912) 92 | TOMOKAZU: A LARGE MUSEUM QUALITY IVORY OKIMONO OF AN EAGLE WITH The majestic Falco Rusticolus is departing from a T-shaped TWO FOXES landing pole, which itself rests on a mahogany stand with four HEIGHT 11 cm, LENGTH c. 17 cm feet. The bird of prey is carved from wood and embellished %\2NDGD7VXQHNLFKL 7RPRND]X VLJQHG7RPRND]X overall with neatly incised ivory feathers. The eyes are inlaid Japan, Tokyo, Meiji period (1868-1912) Condition: Two paws of the smaller fox are reattached. Otherwise in dark horn and mother-of-pearl. The landing pole is entirely excellent condition. covered with ivory segments, all carved to imitate the natural 3URYHQDQFH%ULWLVKFROOHFWLRQ wood grain. A dynamic and powerful scene of a large eagle grappling a fox between its talons, the wild beast letting out an agonizing scream, Okada Tsunekichi, who used the art name Tomokazu, was a gifted HEIGHT 77 cm as the eagle looks determined to one side, with large inlaid eyes carver of okimono who participated in and received several prizes of mother of pearl. Another smaller fox is escaping, its body shape at the carving competitions organised by the Tokyo Chokokai (The Condition: Excellent and fully original condition with some old dynamically captured, as it scurries away, turning around to bite Tokyo Carver’s Association). wear, minor natural warping to some inlays and few traces of use. the eagle in its tail. The carving is incredibly detailed all around with Very minor losses to inlays and some age cracks. Small repair masterfully carved plumage and fur. The talons and beak of the Auction comparison: For a similar okimono attributed to Okada where the pole connects to the stand. eagle are quite terrifying and carved with fabulous realism. The eyes 7RPRND]XDQGRIVPDOOHUVL]HVHH%RQKDPV)LQH-DSDQHVH$UW 3URYHQDQFH%ULWLVKFROOHFWLRQ of both foxes are inlaid in shimmering mother of pearl. The surface November 2017, London, lot 167. of the ivory has developed an appealing yellowish patina over time. The gyrfalcon is a bird of prey and the largest of the falcon Signed in typical style of the artist in high relief TOMOKAZU with Estimate EUR 4.000,- species. It breeds in Japan and is a resident there also, but some seal. Starting price EUR 2.000,- gyrfalcons disperse more widely after the breeding season, or in winter. Individual vagrancy can take birds for very long distances. Its plumage varies with location, with birds being colored from all-white, like the present one, to dark brown. These color variations are called morphs. Like other falcons, it shows sexual dimorphism, with the female much larger than the male. For centuries, the gyrfalcon has been valued as a hunting bird in Japan. Typical prey includes the ptarmigan and waterfowl, which it may take in flight. It also takes fish and mammals. Estimate EUR 15.000,- Starting price EUR 7.500,- 36 37 91 | RYUKO: A LARGE AND SPECTACULAR beauty, and one wonders what she might be dreaming. The garment 93 | A MASTERFUL AND MONUMENTAL TOKYO SCHOOL IVORY OKIMONO folds are carved incredibly well, almost coming to life. Her hair is SECTIONAL IVORY OKIMONO OF A OF A SLEEPING BIJIN incised precisely and tied up at the back. One striking detail is the COCKATOO sandals she is wearing, one of them gently coming off her extended %\5\XNRVLJQHG5\XNR foot. The shape of the okimono is elegant, further underlining her Japan, Meiji period (1868-1912) Japan, Tokyo, Meiji period (1868-1912) beauty. An exceptional masterpiece from the Tokyo school. The base with two floral mon and the signature in sosho RYUKO. The feathery bird is perched on a black burlwood stand, its A large and impressive okimono depicting a serenely sleeping LENGTH 18.6 cm talons tightly gripping a branch. The bird is crafted with superior bijin (beauty), her head rested on a basket. The girl has fallen naturalism, the plumage is masterfully carved and three- asleep after a harvest and she is in a deep slumber. The artist has Condition: Excellent condition, expected minor age cracks. dimensional with neatly incised lines. The cockatoo has its head mastered both her exhaustion and beauty impeccably – a delicate 3URYHQDQFH%ULWLVKFROOHFWLRQ slightly lowered and the large eyes are lacquered in black with balance of subtle nuances. Her wrist bends over the edge of the inlaid silver rings for the pupils. The defining attributes of this basket, her mouth is slightly opened, and her expression is sunken. Estimate EUR 3.500,- exotic bird are the long tail feathers and the crest on the back of Her facial features are crafted sensitively, showing her sublime Starting price EUR 1.750,- its head. HEIGHT 62 cm with stand, 29 cm without stand Condition: Very good complete and original condition. Minor wear and natural age cracks and very minor losses and chipping to the edge of some feathers. 3URYHQDQFH%ULWLVKFROOHFWLRQ The cockatoo is not native to Japan and was probably introduced by the Dutch. It became a popular theme in Japanese art, perhaps most famously treated by the woodblock print artist Ohara Shoson (1877-1945). This monumental sculpture was probably intended for a Japanese World Fair during the Meiji period. Auction comparison: Compare to a near identical example sold at %RQKDPV$VLDQ$UW-XO\(GLQEXUJKORW Estimate EUR 18.000,- Starting price EUR 9.000,- 94 | A MONUMENTAL AND RARE STATUE OF A WHITE GYRFALCON Japan, Meiji period (1868-1912) 92 | TOMOKAZU: A LARGE MUSEUM QUALITY IVORY OKIMONO OF AN EAGLE WITH The majestic Falco Rusticolus is departing from a T-shaped TWO FOXES landing pole, which itself rests on a mahogany stand with four HEIGHT 11 cm, LENGTH c. 17 cm feet. The bird of prey is carved from wood and embellished %\2NDGD7VXQHNLFKL 7RPRND]X VLJQHG7RPRND]X overall with neatly incised ivory feathers. The eyes are inlaid Japan, Tokyo, Meiji period (1868-1912) Condition: Two paws of the smaller fox are reattached. Otherwise in dark horn and mother-of-pearl. The landing pole is entirely excellent condition. covered with ivory segments, all carved to imitate the natural 3URYHQDQFH%ULWLVKFROOHFWLRQ wood grain. A dynamic and powerful scene of a large eagle grappling a fox between its talons, the wild beast letting out an agonizing scream, Okada Tsunekichi, who used the art name Tomokazu, was a gifted HEIGHT 77 cm as the eagle looks determined to one side, with large inlaid eyes carver of okimono who participated in and received several prizes of mother of pearl. Another smaller fox is escaping, its body shape at the carving competitions organised by the Tokyo Chokokai (The Condition: Excellent and fully original condition with some old dynamically captured, as it scurries away, turning around to bite Tokyo Carver’s Association). wear, minor natural warping to some inlays and few traces of use. the eagle in its tail. The carving is incredibly detailed all around with Very minor losses to inlays and some age cracks. Small repair masterfully carved plumage and fur. The talons and beak of the Auction comparison: For a similar okimono attributed to Okada where the pole connects to the stand. eagle are quite terrifying and carved with fabulous realism. The eyes 7RPRND]XDQGRIVPDOOHUVL]HVHH%RQKDPV)LQH-DSDQHVH$UW 3URYHQDQFH%ULWLVKFROOHFWLRQ of both foxes are inlaid in shimmering mother of pearl. The surface November 2017, London, lot 167. of the ivory has developed an appealing yellowish patina over time. The gyrfalcon is a bird of prey and the largest of the falcon Signed in typical style of the artist in high relief TOMOKAZU with Estimate EUR 4.000,- species. It breeds in Japan and is a resident there also, but some seal. Starting price EUR 2.000,- gyrfalcons disperse more widely after the breeding season, or in winter. Individual vagrancy can take birds for very long distances. Its plumage varies with location, with birds being colored from all-white, like the present one, to dark brown. These color variations are called morphs. Like other falcons, it shows sexual dimorphism, with the female much larger than the male. For centuries, the gyrfalcon has been valued as a hunting bird in Japan. Typical prey includes the ptarmigan and waterfowl, which it may take in flight. It also takes fish and mammals. Estimate EUR 15.000,- Starting price EUR 7.500,- 36 37 96 | TOSHIMUNE: A FINE IVORY OKIMONO 99 | SEIDO: IVORY OKIMONO OF OF A RESTING MAN A RAT CATCHER WITH BIJIN %\7RVKLPXQHVLJQHG7RVKLPXQHDQGNDNLKDQ %\6HLGRVLJQHG6HLGR Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) The okimono consisting of three parts and depicting a resting Highly detailed carving enhanced by fine incision work. Depiction man holding a parasol and lying on a bed. His robe is finely of a rat catcher holding a cage while the rat, subject of the hunt, 95 | KOZAN: AN IVORY OKIMONO decorated, and his expression is very well crafted. In front of is escaping across his shoulder. A noble lady, probably the client, him is a smoking and tea set. Signed in a mother of pearl plaque is watching in despair. Artist signature SEIDO to base. %\.R]DQVLJQHG.R]DQ TOSHIMUNE with kakihan on the underside of the man. Japan, Meiji period (1868-1912) HEIGHT 7.5 cm Entire composition HEIGHT 9.5 cm, LENGTH 10.3 cm Condition: Good condition with only minor wear and one small Finely carved depiction of father and son standing behind two Condition: The handle of the parasol has been reattached. loss. Fine natural patina. buckets with fish. Good natural patina. Two-character artist Otherwise excellent original condition. Provenance: From an English private estate. signature KOZAN engraved to base. 3URYHQDQFH%ULWLVKFROOHFWLRQ7RVKLPXQHZDVDILQHRNLPRQR maker. His name is recorded in the Tokyo Sculptors’ Society from Estimate EUR 800,- HEIGHT 10.5 cm 1904 to 1910. Starting price EUR 400,- Condition: Fine condition with small loss to brush in father’s hand Auction comparison: Compare to another okimono by the artist and some tiny age cracks. LQVLPLODUVW\OHVROGE\%RQKDPV$VLDQ:RUNVRI$UW$XJXVW Provenance: From an English private estate. 2011, San Francisco, lot 6465. 100 | GYOKUDO: AN IVORY OKIMONO OF A FAMER WITH BOY Estimate EUR 300,- Estimate EUR 800,- Starting price EUR 150,- Starting price EUR 400,- %\*\RNXGRVLJQHG*\RNXGR Japan, late 19th century, Meiji period (1868-1912) 97 | A MONKEY AND CRAB 98 | SADAMASA: AN IVORY OKIMONO An ivory okimono of a farmer holding a bundle of flowers over IVORY OKIMONO OF AN ARCHER his shoulder and standing next to a boy who is holding another bundle and has his hand stretched out to receive a flower from Japan, Meiji period (1868-1912) %\6DGDPDVDVLJQHG6DGDPDVD his father. The two figures are separately carved and inset into Japan, late 19th century, Meiji period (1868-1912) the base. The signature GYOKUDO is found on the underside. Humorous and detailed carving of a monkey crying out in pain HEIGHT 14.5 cm as he is unexpectedly tweaked by two crabs, while trying to grab A small and expressive carving with fine incision work. Depiction a large lotus plant. The okimono references the legendary battle of an archer preparing a set of arrows. His work is almost Condition: Excellent condition with minor natural imperfections. between the monkey and crab. Note the finely inlaid eyes of the completed as he is sharpening the last arrow from a group of 36. Provenance: Austrian private collection. 101 | MASAKAZU: A LARGE IVORY OKIMONO monkey. Note the focused expression on his face. Signature SADAMASA OF KANNON AND DRAGON to the base. Auction comparison: Compare to another okimono by the LENGTH 6 cm DUWLVWVROGDW%RQKDPV$VLDQ$UWLQFOXGLQJSRUFHODLQIURP7KH %\0DVDND]XVLJQHG0DVDND]X HEIGHT 5 cm Fiorentini Collection, 2 July 2014, Edinburgh, lot 19. Japan, second half of the 19th century, Meiji period (1868-1912) Condition: Superb condition with only minor wear and minimal age cracks. Good natural patina. Condition: Perfect condition. The ivory with a good natural patina. Estimate EUR 700,- Provenance: From an English private estate. Provenance: From an English private estate. Starting price EUR 350,- Finely carved of several pieces of ivory, the goddess stands on a lotus base, holds a lotus flower and wears long flowing robes Estimate EUR 400,- Estimate EUR 400,- surrounded by heavenly bands. Her face bears a benevolent Starting price EUR 200,- Starting price EUR 200,- expression with downcast eyes. Note the elaborately carved jewelry on her breast, skirt and ears, the inlays to the jewelry and eyes of the dragon and the small Arhat figure on top of her head. The artist signature MASAKAZU is found on a tsuishu lacquer cartouche neatly inlaid to the base. Matching wood base. HEIGHT 35 cm (excluding base) and 39.5 cm (the ensemble) Condition: Excellent condition with some wear and minor age cracks. Provenance: English private collection. Estimate EUR 1.000,- Starting price EUR 500,- 38 39 96 | TOSHIMUNE: A FINE IVORY OKIMONO 99 | SEIDO: IVORY OKIMONO OF OF A RESTING MAN A RAT CATCHER WITH BIJIN %\7RVKLPXQHVLJQHG7RVKLPXQHDQGNDNLKDQ %\6HLGRVLJQHG6HLGR Japan, Meiji period (1868-1912) Japan, Meiji period (1868-1912) The okimono consisting of three parts and depicting a resting Highly detailed carving enhanced by fine incision work. Depiction man holding a parasol and lying on a bed. His robe is finely of a rat catcher holding a cage while the rat, subject of the hunt, 95 | KOZAN: AN IVORY OKIMONO decorated, and his expression is very well crafted. In front of is escaping across his shoulder. A noble lady, probably the client, him is a smoking and tea set. Signed in a mother of pearl plaque is watching in despair. Artist signature SEIDO to base. %\.R]DQVLJQHG.R]DQ TOSHIMUNE with kakihan on the underside of the man. Japan, Meiji period (1868-1912) HEIGHT 7.5 cm Entire composition HEIGHT 9.5 cm, LENGTH 10.3 cm Condition: Good condition with only minor wear and one small Finely carved depiction of father and son standing behind two Condition: The handle of the parasol has been reattached. loss. Fine natural patina. buckets with fish. Good natural patina. Two-character artist Otherwise excellent original condition. Provenance: From an English private estate. signature KOZAN engraved to base. 3URYHQDQFH%ULWLVKFROOHFWLRQ7RVKLPXQHZDVDILQHRNLPRQR maker. His name is recorded in the Tokyo Sculptors’ Society from Estimate EUR 800,- HEIGHT 10.5 cm 1904 to 1910. Starting price EUR 400,- Condition: Fine condition with small loss to brush in father’s hand Auction comparison: Compare to another okimono by the artist and some tiny age cracks. LQVLPLODUVW\OHVROGE\%RQKDPV$VLDQ:RUNVRI$UW$XJXVW Provenance: From an English private estate. 2011, San Francisco, lot 6465. 100 | GYOKUDO: AN IVORY OKIMONO OF A FAMER WITH BOY Estimate EUR 300,- Estimate EUR 800,- Starting price EUR 150,- Starting price EUR 400,- %\*\RNXGRVLJQHG*\RNXGR Japan, late 19th century, Meiji period (1868-1912) 97 | A MONKEY AND CRAB 98 | SADAMASA: AN IVORY OKIMONO An ivory okimono of a farmer holding a bundle of flowers over IVORY OKIMONO OF AN ARCHER his shoulder and standing next to a boy who is holding another bundle and has his hand stretched out to receive a flower from Japan, Meiji period (1868-1912) %\6DGDPDVDVLJQHG6DGDPDVD his father. The two figures are separately carved and inset into Japan, late 19th century, Meiji period (1868-1912) the base. The signature GYOKUDO is found on the underside. Humorous and detailed carving of a monkey crying out in pain HEIGHT 14.5 cm as he is unexpectedly tweaked by two crabs, while trying to grab A small and expressive carving with fine incision work. Depiction a large lotus plant. The okimono references the legendary battle of an archer preparing a set of arrows. His work is almost Condition: Excellent condition with minor natural imperfections. between the monkey and crab. Note the finely inlaid eyes of the completed as he is sharpening the last arrow from a group of 36. Provenance: Austrian private collection. 101 | MASAKAZU: A LARGE IVORY OKIMONO monkey. Note the focused expression on his face. Signature SADAMASA OF KANNON AND DRAGON to the base. Auction comparison: Compare to another okimono by the LENGTH 6 cm DUWLVWVROGDW%RQKDPV$VLDQ$UWLQFOXGLQJSRUFHODLQIURP7KH %\0DVDND]XVLJQHG0DVDND]X HEIGHT 5 cm Fiorentini Collection, 2 July 2014, Edinburgh, lot 19. Japan, second half of the 19th century, Meiji period (1868-1912) Condition: Superb condition with only minor wear and minimal age cracks. Good natural patina. Condition: Perfect condition. The ivory with a good natural patina. Estimate EUR 700,- Provenance: From an English private estate. Provenance: From an English private estate. Starting price EUR 350,- Finely carved of several pieces of ivory, the goddess stands on a lotus base, holds a lotus flower and wears long flowing robes Estimate EUR 400,- Estimate EUR 400,- surrounded by heavenly bands. Her face bears a benevolent Starting price EUR 200,- Starting price EUR 200,- expression with downcast eyes. Note the elaborately carved jewelry on her breast, skirt and ears, the inlays to the jewelry and eyes of the dragon and the small Arhat figure on top of her head. The artist signature MASAKAZU is found on a tsuishu lacquer cartouche neatly inlaid to the base. Matching wood base. HEIGHT 35 cm (excluding base) and 39.5 cm (the ensemble) Condition: Excellent condition with some wear and minor age cracks. Provenance: English private collection. Estimate EUR 1.000,- Starting price EUR 500,- 38 39 102 | AN IVORY NETSUKE OF A RAT 105 | TWO IVORY NETSUKE ON A LARGE CHESTNUT OF TWO PIEBALD RATS AND TWO PUPPIES Unsigned Japan, probably Kyoto, early 19th century, Edo period (1615-1868) Unsigned Japan, late 18th and 19th century, Edo period (1615-1868) An ideally shaped ivory netsuke of a rat lying on top of an over- exaggeratedly large chestnut. The ribbed texture of the chestnut is well pronounced, as is the top section with its stippled surface. The The rats very much in the style of Ikko. rat’s eyes are inlaid in black horn, himotoshi in the reverse and the ivory with a very good honey patina. HEIGHT 2.3 and 3 cm HEIGHT 2.5 cm, LENGTH 4.6 cm Condition: The puppies in good condition with expected age cracks. The rats with missing end Condition: Very good condition, with expected age cracks. of the tails and a small chip to one ear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 600,- Starting price EUR 300,- Starting price EUR 300,- 106 | TWO WOOD NETSUKE OF A RAT AND A DOG Unsigned Japan, 19th century LENGTH 3.5 - 4 cm 103 | TWO WOOD NETSUKE OF A CAT AND A RAT Condition: Few surface scratches, the rat with a tiny chip to the eye and the dog with a larger chip. The second signed 3URYHQDQFH%ULWLVKFROOHFWLRQ Japan, 19th century Estimate EUR 300,- Starting price EUR 150,- The first depicting a resting cat with a collar and the second a rat on a beanpod, signed. 107 | AN IVORY NETSUKE LENGTH 4 cm OF A RECUMBENT OX SIGNED TOMOTADA Condition: The second with chipped ears, otherwise good worn condition. Signed Tomotada 3URYHQDQFH%ULWLVKFROOHFWLRQ Japan, Kyoto, late 18th to early 19th century, Edo period (1615-1868) Estimate EUR 800,- Starting price EUR 400,- HEIGHT 2 cm Condition: With surface scratches, otherwise good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- 104 | A WOOD NETSUKE OF A RAT Starting price EUR 500,- WITH CHESTNUT Unsigned 108 | TWO IVORY NETSUKE Japan, 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) A charming study of a rat (nezumi) holding a large chestnut. The rat has full chubby cheeks, large eyes inlaid in horn and the ears are in an alert position. The fur is neatly incised and the thick, finely The first of an immortal with a large gourd next carved tail curls around over the rodent’s back. The underside with to a horse on a base, the second of a boy with ox himotoshi through the chestnut. on a base. HEIGHT 3.2 cm, LENGTH 4 cm HEIGHT 3.3 and 2.8 cm Condition: One plus-shaped crack to the side of the rat. Otherwise Condition: The second with a section of the rope very good condition. attached to the ox lost. Otherwise good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 200,- 40 41 102 | AN IVORY NETSUKE OF A RAT 105 | TWO IVORY NETSUKE ON A LARGE CHESTNUT OF TWO PIEBALD RATS AND TWO PUPPIES Unsigned Japan, probably Kyoto, early 19th century, Edo period (1615-1868) Unsigned Japan, late 18th and 19th century, Edo period (1615-1868) An ideally shaped ivory netsuke of a rat lying on top of an over- exaggeratedly large chestnut. The ribbed texture of the chestnut is well pronounced, as is the top section with its stippled surface. The The rats very much in the style of Ikko. rat’s eyes are inlaid in black horn, himotoshi in the reverse and the ivory with a very good honey patina. HEIGHT 2.3 and 3 cm HEIGHT 2.5 cm, LENGTH 4.6 cm Condition: The puppies in good condition with expected age cracks. The rats with missing end Condition: Very good condition, with expected age cracks. of the tails and a small chip to one ear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 600,- Starting price EUR 300,- Starting price EUR 300,- 106 | TWO WOOD NETSUKE OF A RAT AND A DOG Unsigned Japan, 19th century LENGTH 3.5 - 4 cm 103 | TWO WOOD NETSUKE OF A CAT AND A RAT Condition: Few surface scratches, the rat with a tiny chip to the eye and the dog with a larger chip. The second signed 3URYHQDQFH%ULWLVKFROOHFWLRQ Japan, 19th century Estimate EUR 300,- Starting price EUR 150,- The first depicting a resting cat with a collar and the second a rat on a beanpod, signed. 107 | AN IVORY NETSUKE LENGTH 4 cm OF A RECUMBENT OX SIGNED TOMOTADA Condition: The second with chipped ears, otherwise good worn condition. Signed Tomotada 3URYHQDQFH%ULWLVKFROOHFWLRQ Japan, Kyoto, late 18th to early 19th century, Edo period (1615-1868) Estimate EUR 800,- Starting price EUR 400,- HEIGHT 2 cm Condition: With surface scratches, otherwise good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- 104 | A WOOD NETSUKE OF A RAT Starting price EUR 500,- WITH CHESTNUT Unsigned 108 | TWO IVORY NETSUKE Japan, 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) A charming study of a rat (nezumi) holding a large chestnut. The rat has full chubby cheeks, large eyes inlaid in horn and the ears are in an alert position. The fur is neatly incised and the thick, finely The first of an immortal with a large gourd next carved tail curls around over the rodent’s back. The underside with to a horse on a base, the second of a boy with ox himotoshi through the chestnut. on a base. HEIGHT 3.2 cm, LENGTH 4 cm HEIGHT 3.3 and 2.8 cm Condition: One plus-shaped crack to the side of the rat. Otherwise Condition: The second with a section of the rope very good condition. attached to the ox lost. Otherwise good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 200,- 40 41 109 | TOMOTADA: AN IVORY NETSUKE OF A 112 | AN EARLY IVORY NETSUKE OF AN OX HERDER RECUMBENT COW AND CALF Unsigned Signed Tomotada Japan, mid-18th century, Edo period (1615-1868) Japan, Kyoto, late 18th to early 19th century, Edo period (1615-1868) An ivory netsuke of an ox herder seated on a recumbent ox, one hand placed on his lap and the other placed on his head pensively. An ivory netsuke of a recumbent cow with her head tilted to the The sickle is visible on the back and is attached to the herder’s obi right and her sensitively carved young nestling up to her. The rope (belt). The ivory shows considerable wear and a beautiful warm halter which attaches to the nose ring passes over the back. Her patina and is set on a base, as is usual for this type of early netsuke, pupils are inlaid, and the muscular body is expressed very well. with very large and well-hollowed out himotoshi. Finely carved hooves and large himotoshi through the underside above the signature TOMOTADA in a rectangular reserve. HEIGHT 4.2 cm LENGTH 5.7 cm Condition: Good condition – expected age cracks and wear. Provenance: The 40-Year Collection of a London Gentleman. 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: The ivory slightly worn with a good patina on the Estimate EUR 400,- underside. Good condition. Starting price EUR 200,- Estimate EUR 1.000,- Starting price EUR 500,- 113 | TWO IVORY NETSUKE 110 | AN IVORY NETSUKE OF AN OX WITH BOKUDO Unsigned Unsigned Japan, 18th- early 19th century, Japan, early 19th century, Edo period (1615-1868) Edo period (1615-1868) A finely carved ivory netsuke set on an irregular base with a singular This lot consists of two himotoshi. The bokudo (ox herder), with inlaid tufts of hair, is unsigned ivory netsuke. One gleefully playing on his flute while the ox (ushi) is turning around GHSLFWLQJ%RNXGRZLWKDQR[ towards him and listening to the tune. The thin legs of the ox are and the other Karako leaning carved extraordinarily well. Finely carved fur, worn in some areas, RQ+RWHLȇVEDJ%RWKVKRZD with spots of fine honey patina shining through. fine patina. HEIGHT 3 cm HEIGHT 3.2 – 3.4 cm Condition: A section of the rope halter and the inlaid eye on Condition: The karako in worn the less visible side of the face of the ox is lost. Otherwise good condition with a deep patina. condition with excellent patina. Some remnants of red paint on the Chipping to one horn and one underside. ear of the ox. Deep and worn 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ patina on the back of the ox. Signs of age with a few age Estimate EUR 400,- cracks and surface scratches. Starting price EUR 200,- Provenance: Old Zagreb private collection. Estimate EUR 1.000,- Starting price EUR 500,- 111 | KOJIMA TOSHINAGA (JUEI): AN EXQUISITE 114 | MASASHIGE: A WOOD NETSUKE OF AN OX IVORY NETSUKE OF BOKUDO WITH OX AND HERDER WOMAN %\0DVDKLJHVLJQHG0DVDKLJH %\.RMLPD7RVKLQDJD -XHL VLJQHG.RMLPD7RVKLQDJD Japan, Ise-Yamada, 19th century, Edo period (1615-1868) Japan, early 19th century, Edo period (1615-1868) The ushidoji (ox-boy) playing his flute is seated next to an ox. The The group set on a base with singular himotoshi, the bokudo content facial features are very finely carved, while the ox’ fur is gleefully playing on his flute while riding an ox, beside them pattern is very precise. The ox also has a nose ring with a rope a woman holds the reigns. The elaborate details are carved attached to it. Himotoshi on the underside between the delicately extraordinarily well with spots of fine honey patina shining through. executed ox legs and signed MASASHIGE on one of the hind legs. HEIGHT 4 cm WIDTH 4.1 cm Condition: Very good condition. Condition: Good, complete condition; one tiny dent to the side of 3URYHQDQFH3ULYDWH-DSDQHVHFROOHFWLRQRI0UV%DFTXLUHGDW$GHU the face of the boy. Picard Tajan auction of March 1973 lot 277. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 700,- Estimate EUR 800,- Starting price EUR 350,- Starting price EUR 400,- 42 43 109 | TOMOTADA: AN IVORY NETSUKE OF A 112 | AN EARLY IVORY NETSUKE OF AN OX HERDER RECUMBENT COW AND CALF Unsigned Signed Tomotada Japan, mid-18th century, Edo period (1615-1868) Japan, Kyoto, late 18th to early 19th century, Edo period (1615-1868) An ivory netsuke of an ox herder seated on a recumbent ox, one hand placed on his lap and the other placed on his head pensively. An ivory netsuke of a recumbent cow with her head tilted to the The sickle is visible on the back and is attached to the herder’s obi right and her sensitively carved young nestling up to her. The rope (belt). The ivory shows considerable wear and a beautiful warm halter which attaches to the nose ring passes over the back. Her patina and is set on a base, as is usual for this type of early netsuke, pupils are inlaid, and the muscular body is expressed very well. with very large and well-hollowed out himotoshi. Finely carved hooves and large himotoshi through the underside above the signature TOMOTADA in a rectangular reserve. HEIGHT 4.2 cm LENGTH 5.7 cm Condition: Good condition – expected age cracks and wear. Provenance: The 40-Year Collection of a London Gentleman. 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: The ivory slightly worn with a good patina on the Estimate EUR 400,- underside. Good condition. Starting price EUR 200,- Estimate EUR 1.000,- Starting price EUR 500,- 113 | TWO IVORY NETSUKE 110 | AN IVORY NETSUKE OF AN OX WITH BOKUDO Unsigned Unsigned Japan, 18th- early 19th century, Japan, early 19th century, Edo period (1615-1868) Edo period (1615-1868) A finely carved ivory netsuke set on an irregular base with a singular This lot consists of two himotoshi. The bokudo (ox herder), with inlaid tufts of hair, is unsigned ivory netsuke. One gleefully playing on his flute while the ox (ushi) is turning around GHSLFWLQJ%RNXGRZLWKDQR[ towards him and listening to the tune. The thin legs of the ox are and the other Karako leaning carved extraordinarily well. Finely carved fur, worn in some areas, RQ+RWHLȇVEDJ%RWKVKRZD with spots of fine honey patina shining through. fine patina. HEIGHT 3 cm HEIGHT 3.2 – 3.4 cm Condition: A section of the rope halter and the inlaid eye on Condition: The karako in worn the less visible side of the face of the ox is lost. Otherwise good condition with a deep patina. condition with excellent patina. Some remnants of red paint on the Chipping to one horn and one underside. ear of the ox. Deep and worn 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ patina on the back of the ox. Signs of age with a few age Estimate EUR 400,- cracks and surface scratches. Starting price EUR 200,- Provenance: Old Zagreb private collection. Estimate EUR 1.000,- Starting price EUR 500,- 111 | KOJIMA TOSHINAGA (JUEI): AN EXQUISITE 114 | MASASHIGE: A WOOD NETSUKE OF AN OX IVORY NETSUKE OF BOKUDO WITH OX AND HERDER WOMAN %\0DVDKLJHVLJQHG0DVDKLJH %\.RMLPD7RVKLQDJD -XHL VLJQHG.RMLPD7RVKLQDJD Japan, Ise-Yamada, 19th century, Edo period (1615-1868) Japan, early 19th century, Edo period (1615-1868) The ushidoji (ox-boy) playing his flute is seated next to an ox. The The group set on a base with singular himotoshi, the bokudo content facial features are very finely carved, while the ox’ fur is gleefully playing on his flute while riding an ox, beside them pattern is very precise. The ox also has a nose ring with a rope a woman holds the reigns. The elaborate details are carved attached to it. Himotoshi on the underside between the delicately extraordinarily well with spots of fine honey patina shining through. executed ox legs and signed MASASHIGE on one of the hind legs. HEIGHT 4 cm WIDTH 4.1 cm Condition: Very good condition. Condition: Good, complete condition; one tiny dent to the side of 3URYHQDQFH3ULYDWH-DSDQHVHFROOHFWLRQRI0UV%DFTXLUHGDW$GHU the face of the boy. Picard Tajan auction of March 1973 lot 277. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 700,- Estimate EUR 800,- Starting price EUR 350,- Starting price EUR 400,- 42 43 115 | A WOOD NETSUKE OF A TIGER 119 | TWO WOOD NETSUKE OF A Unsigned HORSE AND A Japan, early 19th century, Edo period (1615-1868) DOG WITH BALL The first signed Though a quite simple netsuke, the tiger comes across incredibly Japan, 19th century powerful. The eyes are enigmatically inlaid in pale translucent horn and the tiger opens its mouth, baring its teeth, as if it was about to let out a menacing growl. The hairwork is sparsely incised and HEIGHT 3.4 - 4 cm the tail is curling up the side of the tiger. The wood has a very good color and a fine patina, showing wear in all the right places. Natural Condition: Good condition with himotoshi between the legs. fine patina, the dog with few surface scratches to the base. HEIGHT 3.8 cm 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: Fine and very good condition, excellent patina. Estimate EUR 500,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Starting price EUR 250,- Estimate EUR 600,- Starting price EUR 300,- 120 | MUNEMITSU: AN IVORY NETSUKE OF A 116 | AN IVORY NETSUKE OF A RABBIT HORSE ON A HORSESHOE Unsigned Signed Munemitsu Japan, 20th century, Meiji period (1868-1912) Japan, 20th century, Meiji period (1868-1912) An almost white ivory seated rabbit with its head looking down and The ivory is smooth and shows a good patina, the horse is with long ears attached to its body. One of the paws is raised to the lying on a horseshoe base and the hair and bushy tail are mouth as it cleans itself and both eyes are inlaid in black. finely carved. The underside with himotoshi and signature MUNEMITSU. HEIGHT 3.9 cm LENGTH 4.5 cm Condition: Good worn condition with expected age cracks. Provenance: European private collection. Condition: Good worn condition. Provenance: European private collection. Estimate EUR 400,- Starting price EUR 200,- Estimate EUR 400,- Starting price EUR 200,- 117 | A RARE WOOD NETSUKE OF CHINNAN SENNIN 121 | NOBUKAZU: AN IVORY NETSUKE OF 122 | AN IVORY NETSUKE OF A RABBIT Unsigned A SNAKE WITH FROG, SANSUKUMI & MONKEY WRESTLING Japan, 19th century, Edo period (1615-1868) %\1REXND]XVLJQHG1REXND]X Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 20th century, Meiji period (1868-1912) Chinnan Sennin is depicted seated holding his vessel, which he used to conjure the dragon lying next to him, up high. He has a grim facial expression while the dragon has a somewhat Amusingly carved as a coiled snake with a comical expression. Humorous carving of the two companions of the golden boy mischievous one. The dragon was up to no good and Chinnan is fed A little frog is seated in an opening of the winding body of the Kintaro, the rabbit and monkey shown engaged in a wrestling up and calling him back into his vessel. Dark patina of the wood and snake, which is about to close and crush the poor amphibian. match. The rabbit’s eyes inlaid in red and the monkey’s painted in small himotoshi on the underside. Natural himotoshi which allow the netsuke to perfectly hang on black. Note the neatly incised detail of the monkey’s fur. the obi, so that both the frog and the looming snake are visible. HEIGHT 2.9 cm, LENGTH 4.2 cm 6LJQHG12%8.$=8LQDVOLJKWO\IDGHGUHVHUYH HEIGHT 4.3 cm Condition: Very good condition. HEIGHT 4.1 cm Condition: Good condition with few expected age cracks. Provenance: The 40-Year Collection of a London Gentleman. Provenance: European private collection. Condition: The ivory slightly worn. Good condition. Estimate EUR 400,- Provenance: Hungarian collection. Estimate EUR 900,- Starting price EUR 200,- Starting price EUR 450,- 118 | A FINE IVORY HANDLE FINIAL OF A TIGER Estimate EUR 1.000,- Starting price EUR 500,- Unsigned Japan, 19th century %HDXWLIXOO\DQGFRPSDFWO\FDUYHGWRGHSLFWDWLJHULWVKHDGWLOWHG backwards, and the eyes inlaid in lustrous black horn. The tiger is seated on a rock with finely carved bamboo leaves draping over his back. This filial was likely the end of a parasol handle or cane. HEIGHT 4.8 cm Condition: Age cracks, otherwise in good condition. Provenance: French private collection. Estimate EUR 600,- Starting price EUR 300,- 44 45 115 | A WOOD NETSUKE OF A TIGER 119 | TWO WOOD NETSUKE OF A Unsigned HORSE AND A Japan, early 19th century, Edo period (1615-1868) DOG WITH BALL The first signed Though a quite simple netsuke, the tiger comes across incredibly Japan, 19th century powerful. The eyes are enigmatically inlaid in pale translucent horn and the tiger opens its mouth, baring its teeth, as if it was about to let out a menacing growl. The hairwork is sparsely incised and HEIGHT 3.4 - 4 cm the tail is curling up the side of the tiger. The wood has a very good color and a fine patina, showing wear in all the right places. Natural Condition: Good condition with himotoshi between the legs. fine patina, the dog with few surface scratches to the base. HEIGHT 3.8 cm 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: Fine and very good condition, excellent patina. Estimate EUR 500,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Starting price EUR 250,- Estimate EUR 600,- Starting price EUR 300,- 120 | MUNEMITSU: AN IVORY NETSUKE OF A 116 | AN IVORY NETSUKE OF A RABBIT HORSE ON A HORSESHOE Unsigned Signed Munemitsu Japan, 20th century, Meiji period (1868-1912) Japan, 20th century, Meiji period (1868-1912) An almost white ivory seated rabbit with its head looking down and The ivory is smooth and shows a good patina, the horse is with long ears attached to its body. One of the paws is raised to the lying on a horseshoe base and the hair and bushy tail are mouth as it cleans itself and both eyes are inlaid in black. finely carved. The underside with himotoshi and signature MUNEMITSU. HEIGHT 3.9 cm LENGTH 4.5 cm Condition: Good worn condition with expected age cracks. Provenance: European private collection. Condition: Good worn condition. Provenance: European private collection. Estimate EUR 400,- Starting price EUR 200,- Estimate EUR 400,- Starting price EUR 200,- 117 | A RARE WOOD NETSUKE OF CHINNAN SENNIN 121 | NOBUKAZU: AN IVORY NETSUKE OF 122 | AN IVORY NETSUKE OF A RABBIT Unsigned A SNAKE WITH FROG, SANSUKUMI & MONKEY WRESTLING Japan, 19th century, Edo period (1615-1868) %\1REXND]XVLJQHG1REXND]X Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 20th century, Meiji period (1868-1912) Chinnan Sennin is depicted seated holding his vessel, which he used to conjure the dragon lying next to him, up high. He has a grim facial expression while the dragon has a somewhat Amusingly carved as a coiled snake with a comical expression. Humorous carving of the two companions of the golden boy mischievous one. The dragon was up to no good and Chinnan is fed A little frog is seated in an opening of the winding body of the Kintaro, the rabbit and monkey shown engaged in a wrestling up and calling him back into his vessel. Dark patina of the wood and snake, which is about to close and crush the poor amphibian. match. The rabbit’s eyes inlaid in red and the monkey’s painted in small himotoshi on the underside. Natural himotoshi which allow the netsuke to perfectly hang on black. Note the neatly incised detail of the monkey’s fur. the obi, so that both the frog and the looming snake are visible. HEIGHT 2.9 cm, LENGTH 4.2 cm 6LJQHG12%8.$=8LQDVOLJKWO\IDGHGUHVHUYH HEIGHT 4.3 cm Condition: Very good condition. HEIGHT 4.1 cm Condition: Good condition with few expected age cracks. Provenance: The 40-Year Collection of a London Gentleman. Provenance: European private collection. Condition: The ivory slightly worn. Good condition. Estimate EUR 400,- Provenance: Hungarian collection. Estimate EUR 900,- Starting price EUR 200,- Starting price EUR 450,- 118 | A FINE IVORY HANDLE FINIAL OF A TIGER Estimate EUR 1.000,- Starting price EUR 500,- Unsigned Japan, 19th century %HDXWLIXOO\DQGFRPSDFWO\FDUYHGWRGHSLFWDWLJHULWVKHDGWLOWHG backwards, and the eyes inlaid in lustrous black horn. The tiger is seated on a rock with finely carved bamboo leaves draping over his back. This filial was likely the end of a parasol handle or cane. HEIGHT 4.8 cm Condition: Age cracks, otherwise in good condition. Provenance: French private collection. Estimate EUR 600,- Starting price EUR 300,- 44 45 123 | A FINE IVORY NETSUKE OF A RECUMBENT 124 | A FINE WOOD NETSUKE OF A MONKEY GOAT IN THE MANNER OF YOSHINAGA EMERGING FROM A CHESTNUT Unsigned Unsigned Japan, Kyoto, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Expressively carved as a recumbent goat with large horns and Finely carved, the wood attractively stained, and depicting a shaggy fur, parted in the middle and draping down the sides, monkey emerging from a chestnut. The monkey’s pupils inlaid all finely carved. The goat has a charming expression with inlaid in bone. Good asymmetrical himotoshi through the under- and 127 | AN ASAKUSA STYLE INLAID WALRUS IVORY 128 | A GROUP OF THREE WOOD NETSUKE pupils and a flowing trifurcated beard which touches the front backside. RYUSA MANJU NETSUKE WITH MONKEY OF MONKEYS legs. Large asymmetrical himotoshi through the underside. The carving is very much in the manner of Yoshinaga of Kyoto (see HEIGHT 3.6 cm Unsigned Unsigned auction comparison). Japan, Asakusa, mid to late 19th century Japan, 19th century Condition: Good, worn condition. The monkey’s arm with some HEIGHT 3 cm, LENGTH 5.5 cm surface wear and minor chipping. 3URYHQDQFH%ULWLVKFROOHFWLRQ A well-carved walrus ivory ryusa-manju depicting many pine trees Comprising a seated monkey eating a flea; a monkey on a large Condition: Good, worn condition with some discoloration to the and grasses with an inlaid silver-gilt long-armed monkey in the mushroom and a monkey looking for fleas, inlaid eyes. fur. One inlaid pupil is replaced. Expected, minor age cracks. Auction comparison: An almost identical netsuke sold at center. The reverse with rocks, a waterfall and further pines, and Provenance: European collection. Lempertz, Asiatische Kunst, 7 December 2018, Cologne, lot 342. FHQWUDOULPPHGKLPRWRVKL%HDXWLIXOFRORURIWKHPDWHULDODQG HEIGHT 4 – 4.5 cm natural structure of the walrus tooth. Auction comparison: Compare to a similarly executed goat by Estimate EUR 600,- Condition: Age-related condition, few chips and age cracks, the Yoshinaga sold by Zacke, Exhibition 1987, Vienna, no. 97. Starting price EUR 300,- DIAMETER 4.2 cm, WIDTH 2.5 cm third with a restored leg. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 2.000,- Condition: A small section of a branch on the side has been Starting price EUR 1.000,- restored and the metal inlay is not original. Estimate EUR 800,- 126 | AN AMUSING STAG ANTLER NETSUKE Provenance: The 40-Year Collection of a London Gentleman. Starting price EUR 400,- OF A SMALL MONKEY CARRYING A LARGE MUSHROOM Estimate EUR 400,- 125 | SHUGYOKU: IVORY NETSUKE OF Starting price EUR 200,- A MONKEY WITH SAKE BOWL AND CUP Unsigned 130 | KOGYOKU: AN IVORY NETSUKE OF A Japan, 19th century, Edo period (1615-1868) MONKEY WITH A GIGANT PERSIMMON %\6KXJ\RNXVLJQHG6KXJ\RNX Japan, 19th century 129 | A WOODEN NETSUKE OF A MONKEY Signed Kogyoku A humorous depiction of a smiling monkey bending under the STUCK IN A MIKAN Japan, Meiji period (1868-1912) weight of a huge mushroom associated with two chestnuts. Depicting a monkey seated gripping a double gourd between Signed …yuki its legs and balancing a full cup of sake on its head. Signature HEIGHT 7.6 cm Japan, 19th century, Edo period (1615-1868) A finely carved netsuke of a monkey hugging a gigantic SHUGYOKU in an oval reserve on the bottom. Natural himotoshi. persimmon (kaki). The monkey has a relaxed expression and Condition: Good worn condition. the eyes and other details are accentuated with black ink. The HEIGHT c. 5.3 cm Provenance: French private collection. The fruit is neatly carved, on top a small spider and a branch with persimmon branch makes the base of the netsuke. Natural long leaves. In the inside a monkey tears the skin of the fruit, himotoshi through the stem and signature KOGYOKU. Condition: Minor wear, very good condition. Estimate EUR 600,- trying to get out. The underside with fine, large himotoshi and 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Starting price EUR 300,- signed …YUKI within a reserve. LENGHT 4.2 cm Estimate EUR 600,- LENGHT 4 cm Condition: Very good condition. Starting price EUR 300,- Provenance: European private collection. Condition: Very good condition. Provenance: European private collection. Estimate EUR 700,- Starting price EUR 350,- Estimate EUR 800,- Starting price EUR 400,- 46 47 123 | A FINE IVORY NETSUKE OF A RECUMBENT 124 | A FINE WOOD NETSUKE OF A MONKEY GOAT IN THE MANNER OF YOSHINAGA EMERGING FROM A CHESTNUT Unsigned Unsigned Japan, Kyoto, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Expressively carved as a recumbent goat with large horns and Finely carved, the wood attractively stained, and depicting a shaggy fur, parted in the middle and draping down the sides, monkey emerging from a chestnut. The monkey’s pupils inlaid all finely carved. The goat has a charming expression with inlaid in bone. Good asymmetrical himotoshi through the under- and 127 | AN ASAKUSA STYLE INLAID WALRUS IVORY 128 | A GROUP OF THREE WOOD NETSUKE pupils and a flowing trifurcated beard which touches the front backside. RYUSA MANJU NETSUKE WITH MONKEY OF MONKEYS legs. Large asymmetrical himotoshi through the underside. The carving is very much in the manner of Yoshinaga of Kyoto (see HEIGHT 3.6 cm Unsigned Unsigned auction comparison). Japan, Asakusa, mid to late 19th century Japan, 19th century Condition: Good, worn condition. The monkey’s arm with some HEIGHT 3 cm, LENGTH 5.5 cm surface wear and minor chipping. 3URYHQDQFH%ULWLVKFROOHFWLRQ A well-carved walrus ivory ryusa-manju depicting many pine trees Comprising a seated monkey eating a flea; a monkey on a large Condition: Good, worn condition with some discoloration to the and grasses with an inlaid silver-gilt long-armed monkey in the mushroom and a monkey looking for fleas, inlaid eyes. fur. One inlaid pupil is replaced. Expected, minor age cracks. Auction comparison: An almost identical netsuke sold at center. The reverse with rocks, a waterfall and further pines, and Provenance: European collection. Lempertz, Asiatische Kunst, 7 December 2018, Cologne, lot 342. FHQWUDOULPPHGKLPRWRVKL%HDXWLIXOFRORURIWKHPDWHULDODQG HEIGHT 4 – 4.5 cm natural structure of the walrus tooth. Auction comparison: Compare to a similarly executed goat by Estimate EUR 600,- Condition: Age-related condition, few chips and age cracks, the Yoshinaga sold by Zacke, Exhibition 1987, Vienna, no. 97. Starting price EUR 300,- DIAMETER 4.2 cm, WIDTH 2.5 cm third with a restored leg. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 2.000,- Condition: A small section of a branch on the side has been Starting price EUR 1.000,- restored and the metal inlay is not original. Estimate EUR 800,- 126 | AN AMUSING STAG ANTLER NETSUKE Provenance: The 40-Year Collection of a London Gentleman. Starting price EUR 400,- OF A SMALL MONKEY CARRYING A LARGE MUSHROOM Estimate EUR 400,- 125 | SHUGYOKU: IVORY NETSUKE OF Starting price EUR 200,- A MONKEY WITH SAKE BOWL AND CUP Unsigned 130 | KOGYOKU: AN IVORY NETSUKE OF A Japan, 19th century, Edo period (1615-1868) MONKEY WITH A GIGANT PERSIMMON %\6KXJ\RNXVLJQHG6KXJ\RNX Japan, 19th century 129 | A WOODEN NETSUKE OF A MONKEY Signed Kogyoku A humorous depiction of a smiling monkey bending under the STUCK IN A MIKAN Japan, Meiji period (1868-1912) weight of a huge mushroom associated with two chestnuts. Depicting a monkey seated gripping a double gourd between Signed …yuki its legs and balancing a full cup of sake on its head. Signature HEIGHT 7.6 cm Japan, 19th century, Edo period (1615-1868) A finely carved netsuke of a monkey hugging a gigantic SHUGYOKU in an oval reserve on the bottom. Natural himotoshi. persimmon (kaki). The monkey has a relaxed expression and Condition: Good worn condition. the eyes and other details are accentuated with black ink. The HEIGHT c. 5.3 cm Provenance: French private collection. The fruit is neatly carved, on top a small spider and a branch with persimmon branch makes the base of the netsuke. Natural long leaves. In the inside a monkey tears the skin of the fruit, himotoshi through the stem and signature KOGYOKU. Condition: Minor wear, very good condition. Estimate EUR 600,- trying to get out. The underside with fine, large himotoshi and 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Starting price EUR 300,- signed …YUKI within a reserve. LENGHT 4.2 cm Estimate EUR 600,- LENGHT 4 cm Condition: Very good condition. Starting price EUR 300,- Provenance: European private collection. Condition: Very good condition. Provenance: European private collection. Estimate EUR 700,- Starting price EUR 350,- Estimate EUR 800,- Starting price EUR 400,- 46 47 131 | MASANAO: A RARE IVORY NETSUKE 134 | IKKOSAI: A FINE IVORY NETSUKE OF TWO GROOMING MONKEYS OF A MONKEY WITH OCTOPUS Signed Masanao %\ΖNNRVDLVLJQHGΖNNRVDL Japan, Kyoto, late 18th/19th century, Edo period (1615-1868) Japan, Tokyo, late 19th century A fine ivory netsuke depicting a large male monkey picking fleas off A superbly detailed and finely polished ivory netsuke depicting a a smaller monkey, which is lying on its stomach, lying straightened monkey quarreling with an octopus which is seated on a bell- out, and visibly enjoying his grooming. Their feets are touching and shaped vessel. The octopus is wearing a shirt and is holding the overall composition of their bodies is very amusing. Natural a mallet up high menacingly, while the monkey is gripping its himotoshi, very good patina and signature in an oval reserve tentacles. The netsuke references a legend in which the octopus- MASANAO. physician to Ryujin, the Dragon King of the Sea, prescribes a monkey’s liver to heal the King’s daughter. Natural himotoshi and HEIGHT 3.3 cm, LENGTH 4.1 cm the signature IKKOSAI in a polished reserve. Condition: Considerable wear and age cracks, the two hands of the HEIGHT 4.3 cm smaller monkey have been restored and one hand and the tail of the larger monkey is reattached (please consult further images for Condition: The ivory slightly worn in some areas, some age cracks, more details), one or more eyes are replaced. generally in good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 1.000,- Starting price EUR 300,- Starting price EUR 500,- 132 | AN AMUSING AND RARE IVORY NETSUKE OF THE SANBIKI SARU 135 | IKKOSAI: A FINE IVORY NETSUKE Unsigned OF MONKEYS MOUNTING A HORSE Japan, 18th century, Edo period (1615-1868) %\ΖNNRVDLVLJQHGΖNNRVDL Japan, Edo, late 19th century, Meiji period (1868-1912) An ivory netsuke of the three wise monkeys, also known as sanbiki saru, shown here as a large monkey with two of its young. The larger monkey is holding the mouth of the young monkey on his An animated study, more a miniature okimono than a netsuke, shoulder and the eyes of the other child to his right. In return, of lively and finely carved monkeys mounting the horse Onikage, the monkey on its shoulder is holding his ears, thus completing which is balancing on a go-board. Immaculate staining. The the representation of the three wise monkeys, which embody the underside with four silver floral studs and signature IKKOSAI. proverbial principle of ‘speak no evil’, ‘hear no evil’ and ‘see no evil’. A charming and unusual netsuke with a beautiful honey-patina and HEIGHT 4.2 cm good, large himotoshi to the reverse and side. Condition: The reigns of the horse show some wear and have HEIGHT 5.9 cm possibly been restored. Minor chip to the rattle one monkey is holding. Otherwise excellent condition. Condition: Good condition, expected age cracks. Provenance: Austrian private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 85. Estimate EUR 1.000,- Starting price EUR 500,- Estimate EUR 500,- Starting price EUR 250,- 133 | IKKOSAI: AN IVORY NETSUKE 136 | IKKOSAI: A RARE IVORY NETSUKE OF A MONKEY GROOMING HIS YOUNG OF THE SAMBIKI SARU %\ΖNNRVDLVLJQHGΖNNRVDL %\ΖNNRVDLVLJQHGΖNNRVDL Japan, Tokyo, late 19th century Japan, Edo, late 19th century, Meiji period (1868-1912) An idiosyncratic and popular model by Ikkosai depicting a male The three wise monkeys are placed closely together, the fur monkey picking fleas of his sleeping young which he holds firmly minutely incised and eyes inlaid. The manner of the carving is very against his body. Natural himotoshi and signature in a polished close to Kaigyokusai. Signature IKKOSAI in a polished reserve and reserve IKKOSAI. central natural himotoshi. HEIGHT 3.1 cm HEIGHT 3.2 cm Condition: Some expected horizontal age cracks, the stained ivory is Condition: Very good condition, one age crack to the base and slightly worn. Generally, in very good and complete condition. some overall wear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Provenance: Austrian private collection. Estimate EUR 600,- Estimate EUR 1.500,- Starting price EUR 300,- Starting price EUR 750,- 48 49 131 | MASANAO: A RARE IVORY NETSUKE 134 | IKKOSAI: A FINE IVORY NETSUKE OF TWO GROOMING MONKEYS OF A MONKEY WITH OCTOPUS Signed Masanao %\ΖNNRVDLVLJQHGΖNNRVDL Japan, Kyoto, late 18th/19th century, Edo period (1615-1868) Japan, Tokyo, late 19th century A fine ivory netsuke depicting a large male monkey picking fleas off A superbly detailed and finely polished ivory netsuke depicting a a smaller monkey, which is lying on its stomach, lying straightened monkey quarreling with an octopus which is seated on a bell- out, and visibly enjoying his grooming. Their feets are touching and shaped vessel. The octopus is wearing a shirt and is holding the overall composition of their bodies is very amusing. Natural a mallet up high menacingly, while the monkey is gripping its himotoshi, very good patina and signature in an oval reserve tentacles. The netsuke references a legend in which the octopus- MASANAO. physician to Ryujin, the Dragon King of the Sea, prescribes a monkey’s liver to heal the King’s daughter. Natural himotoshi and HEIGHT 3.3 cm, LENGTH 4.1 cm the signature IKKOSAI in a polished reserve. Condition: Considerable wear and age cracks, the two hands of the HEIGHT 4.3 cm smaller monkey have been restored and one hand and the tail of the larger monkey is reattached (please consult further images for Condition: The ivory slightly worn in some areas, some age cracks, more details), one or more eyes are replaced. generally in good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 1.000,- Starting price EUR 300,- Starting price EUR 500,- 132 | AN AMUSING AND RARE IVORY NETSUKE OF THE SANBIKI SARU 135 | IKKOSAI: A FINE IVORY NETSUKE Unsigned OF MONKEYS MOUNTING A HORSE Japan, 18th century, Edo period (1615-1868) %\ΖNNRVDLVLJQHGΖNNRVDL Japan, Edo, late 19th century, Meiji period (1868-1912) An ivory netsuke of the three wise monkeys, also known as sanbiki saru, shown here as a large monkey with two of its young. The larger monkey is holding the mouth of the young monkey on his An animated study, more a miniature okimono than a netsuke, shoulder and the eyes of the other child to his right. In return, of lively and finely carved monkeys mounting the horse Onikage, the monkey on its shoulder is holding his ears, thus completing which is balancing on a go-board. Immaculate staining. The the representation of the three wise monkeys, which embody the underside with four silver floral studs and signature IKKOSAI. proverbial principle of ‘speak no evil’, ‘hear no evil’ and ‘see no evil’. A charming and unusual netsuke with a beautiful honey-patina and HEIGHT 4.2 cm good, large himotoshi to the reverse and side. Condition: The reigns of the horse show some wear and have HEIGHT 5.9 cm possibly been restored. Minor chip to the rattle one monkey is holding. Otherwise excellent condition. Condition: Good condition, expected age cracks. Provenance: Austrian private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 85. Estimate EUR 1.000,- Starting price EUR 500,- Estimate EUR 500,- Starting price EUR 250,- 133 | IKKOSAI: AN IVORY NETSUKE 136 | IKKOSAI: A RARE IVORY NETSUKE OF A MONKEY GROOMING HIS YOUNG OF THE SAMBIKI SARU %\ΖNNRVDLVLJQHGΖNNRVDL %\ΖNNRVDLVLJQHGΖNNRVDL Japan, Tokyo, late 19th century Japan, Edo, late 19th century, Meiji period (1868-1912) An idiosyncratic and popular model by Ikkosai depicting a male The three wise monkeys are placed closely together, the fur monkey picking fleas of his sleeping young which he holds firmly minutely incised and eyes inlaid. The manner of the carving is very against his body. Natural himotoshi and signature in a polished close to Kaigyokusai. Signature IKKOSAI in a polished reserve and reserve IKKOSAI. central natural himotoshi. HEIGHT 3.1 cm HEIGHT 3.2 cm Condition: Some expected horizontal age cracks, the stained ivory is Condition: Very good condition, one age crack to the base and slightly worn. Generally, in very good and complete condition. some overall wear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Provenance: Austrian private collection. Estimate EUR 600,- Estimate EUR 1.500,- Starting price EUR 300,- Starting price EUR 750,- 48 49 141 | A RARE MARINE IVORY NETSUKE OF THREE WISE MONKEYS Signed Japan, Meiji period (1868-1912) The three wise monkeys, or sanbiki no saru, embody the principle “see no evil, hear no evil, speak no evil”. Here pictured sitting in line on a base. The underside with small himotoshi and signature. LENGHT 4.5 cm Condition: A crack to the base, otherwise good age-related condition. 137 | A WOOD NETSUKE OF A PLAYFUL DOG 138 | AN IVORY NETSUKE OF A MONKEY Provenance: European private collection. WITH LOQUATS AFTER OKATOMO Unsigned Estimate EUR 500,- Japan, 19th century, Edo period (1615-1868) Signed Okatomo Starting price EUR 250,- Japan, Kyoto, first half 19th century, Edo period (1615-1868) A netsuke of a puppy dog raising his front paws whilst looking back. Wearing a collar, with inlaid eyes and his tail curled upon The monkey with finely incised fur is depicted holding a branch of 142 | KOICHI: A WOOD NETSUKE his back. loquats, the stems of the fruit inlaid in dark horn. His expression OF A MONKEY PICKING FLEA is naturalistic, the eyes are inlaid in black horn. Natural himotoshi, LENGTH 4 cm and the signature is found in a rectangular reserve on one leg %\.RLFKLVLJQHG.RLFKL OKATOMO ᛂƤ. A good and detailed work from the Okatomo Japan, 19th century Condition: A chip to the collar, otherwise good condition. school. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 2.8 cm, LENGTH 4.5 cm Finely carved to depict a monkey picking Estimate EUR 800,- fleas, with inlaid eyes, natural himotoshi Starting price EUR 400,- Condition: Very good condition. through the legs and signature in a polished 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ reserve KOICHI. Estimate EUR 600,- HEIGHT 3.4 cm 139 | A FINE IVORY NETSUKE OF A MONKEY Starting price EUR 300,- CARRYING A LARGE MUSHROOM Condition: Good condition, one fine crack through one of the legs, probably Unsigned reattached. Japan, 19th century, Edo period (1615-1868) 140 | A FINE WOOD NETSUKE OF 3URYHQDQFH%ULWLVKFROOHFWLRQ THREE MONKEYS WITH FRUITS Estimate EUR 800,- The seated monkey is carrying a large shimeji mushroom on Unsigned Starting price EUR 400,- his back, the radial gills well expressed and with a smooth cap Japan, 19th century, Edo period (1615-1868) with a beautiful honey patina. His exhaustion is so great that he is contracting his toes, trying to lift the slipping mushroom. The eyes inlaid in pale translucent horn and the himotoshi in the Depicted is a large female monkey holding her two young, while smooth mushroom cap. one climbs over her back, the other reaches for a fruit. A lively scene with fine details and expressions. The backside with HEIGHT 3.7 cm himotoshi. Condition: Very good condition, minor imperfection to one eye, LENGHT 5.5 cm and a gorgeous patina. Provenance: The 40-Year Collection of a London Gentleman. Condition: A crack to one leg, otherwise very good condition. Provenance: European private collection. Estimate EUR 1.000,- Starting price EUR 500,- Estimate EUR 1.000,- 143 | A GROUP OF THREE WOOD Starting price EUR 500,- NETSUKE OF MONKEYS The second signed Yoshinobu Japan, 19th century, Edo period (1615-1868) Two netsuke of monkeys holding fruits, and one of a monkey covering its ears and signed <26+Ζ12%8 HEIGHT 3.3 - 4 cm Condition: Overall good worn condition with few small chips. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- Starting price EUR 400,- 50 51 141 | A RARE MARINE IVORY NETSUKE OF THREE WISE MONKEYS Signed Japan, Meiji period (1868-1912) The three wise monkeys, or sanbiki no saru, embody the principle “see no evil, hear no evil, speak no evil”. Here pictured sitting in line on a base. The underside with small himotoshi and signature. LENGHT 4.5 cm Condition: A crack to the base, otherwise good age-related condition. 137 | A WOOD NETSUKE OF A PLAYFUL DOG 138 | AN IVORY NETSUKE OF A MONKEY Provenance: European private collection. WITH LOQUATS AFTER OKATOMO Unsigned Estimate EUR 500,- Japan, 19th century, Edo period (1615-1868) Signed Okatomo Starting price EUR 250,- Japan, Kyoto, first half 19th century, Edo period (1615-1868) A netsuke of a puppy dog raising his front paws whilst looking back. Wearing a collar, with inlaid eyes and his tail curled upon The monkey with finely incised fur is depicted holding a branch of 142 | KOICHI: A WOOD NETSUKE his back. loquats, the stems of the fruit inlaid in dark horn. His expression OF A MONKEY PICKING FLEA is naturalistic, the eyes are inlaid in black horn. Natural himotoshi, LENGTH 4 cm and the signature is found in a rectangular reserve on one leg %\.RLFKLVLJQHG.RLFKL OKATOMO ᛂƤ. A good and detailed work from the Okatomo Japan, 19th century Condition: A chip to the collar, otherwise good condition. school. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 2.8 cm, LENGTH 4.5 cm Finely carved to depict a monkey picking Estimate EUR 800,- fleas, with inlaid eyes, natural himotoshi Starting price EUR 400,- Condition: Very good condition. through the legs and signature in a polished 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ reserve KOICHI. Estimate EUR 600,- HEIGHT 3.4 cm 139 | A FINE IVORY NETSUKE OF A MONKEY Starting price EUR 300,- CARRYING A LARGE MUSHROOM Condition: Good condition, one fine crack through one of the legs, probably Unsigned reattached. Japan, 19th century, Edo period (1615-1868) 140 | A FINE WOOD NETSUKE OF 3URYHQDQFH%ULWLVKFROOHFWLRQ THREE MONKEYS WITH FRUITS Estimate EUR 800,- The seated monkey is carrying a large shimeji mushroom on Unsigned Starting price EUR 400,- his back, the radial gills well expressed and with a smooth cap Japan, 19th century, Edo period (1615-1868) with a beautiful honey patina. His exhaustion is so great that he is contracting his toes, trying to lift the slipping mushroom. The eyes inlaid in pale translucent horn and the himotoshi in the Depicted is a large female monkey holding her two young, while smooth mushroom cap. one climbs over her back, the other reaches for a fruit. A lively scene with fine details and expressions. The backside with HEIGHT 3.7 cm himotoshi. Condition: Very good condition, minor imperfection to one eye, LENGHT 5.5 cm and a gorgeous patina. Provenance: The 40-Year Collection of a London Gentleman. Condition: A crack to one leg, otherwise very good condition. Provenance: European private collection. Estimate EUR 1.000,- Starting price EUR 500,- Estimate EUR 1.000,- 143 | A GROUP OF THREE WOOD Starting price EUR 500,- NETSUKE OF MONKEYS The second signed Yoshinobu Japan, 19th century, Edo period (1615-1868) Two netsuke of monkeys holding fruits, and one of a monkey covering its ears and signed <26+Ζ12%8 HEIGHT 3.3 - 4 cm Condition: Overall good worn condition with few small chips. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- Starting price EUR 400,- 50 51 144 | A WOOD NETSUKE OF 147 | FOUR IVORY A DOG WITH A BALL NETSUKE OF DOGS Unsigned Japan, 19th century, Edo period Unsigned (1615-1868) Japan, 19th century, Edo period (1615-1868) The dog is sitting and has his left paw placed on a ball, wears a collar with hanging HEIGHT 2.3 – 3.4 cm bells and shows a friendly expression, eyes inlaid in black horn and smooth polished Condition: All in good surface. condition. The rope in the mouth of the fourth dog HEIGHT 4.8 cm is chipped. Some minor expected age cracks. Condition: Good worn condition, a chip to 3URYHQDQFH%ULWLVK one paw. collection. Provenance: European private collection. Estimate EUR 800,- Estimate EUR 700,- Starting price EUR 400,- Starting price EUR 350,- 148 | AN AMUSING WOOD 145 | KOGYOKUSAI: AN IVORY NETSUKE OF A DOG NETSUKE OF CHICKENS, WAR DRUM AND RABBIT Unsigned Japan, first half of 19th century, Edo period %\.RJ\RNXVDLVLJQHG.RJ\RNXVDL (1615-1868) Japan, Tokyo, Meiji period (1868-1912) Carved from a grainy dark wood and The composition set on a rock showing depicting a dog, not your usual dog, but a war drum with a cockerel, hen and two rather a somewhat frightening wolf-like chicks, one of them amusingly bursting creature. The dog is seated and looking through the skin of the drum. The sides downwards, its mouth is voraciously of the drum are inlaid with rows of horn opened revealing the teeth, and the bulging buttons. Next to the drum is a little rabbit, eyes are inlaid in ivory with horn pupils. with inlaid eyes of bright orange coral. The fur is sparsely incised, the grain of Signature KOGYOKUSAI in a wavy reserve the wood adding to the texture, its tail is on the underside of the rabbit. Natural curling, and the spine and rib cage are himotoshi. well-expressed. Very good, large himotoshi through the underside and side. HEIGHT 3.8 cm HEIGHT 3.6 cm Condition: Good condition, the ivory slightly worn. Condition: Very good condition with a nice 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ glossy patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Starting price EUR 300,- Estimate EUR 500,- Starting price EUR 250,- 146 | KOKU: A STAG ANTLER 149 | ONE SILVER CHUBBY DOG NETSUKE AND THREE IVORY NETSUKE Signed Koku OF DOGS Japan, second half of 19th century The first signed Hakuo, The fourth signed Mitsuo, the A rustic and old stag antler netsuke with others unsigned worn-down features and nice patina. Japan, 19th century, The chubby dog is seated and shows an Edo period (1615-1868) amusing expression. The underside shows the himotoshi, one of them cleverly used to represent the signature Koku, for Kokusai. HEIGHT 3.4 – 6 cm LENGTH 4 cm Condition: All in good condition. Some minor Condition: Good condition with stunning expected age cracks. patina and wear. 3URYHQDQFH%ULWLVK Provenance: European private collection. collection. Estimate EUR 400,- Estimate EUR 800,- Starting price EUR 200,- Starting price EUR 400,- 52 53 144 | A WOOD NETSUKE OF 147 | FOUR IVORY A DOG WITH A BALL NETSUKE OF DOGS Unsigned Japan, 19th century, Edo period Unsigned (1615-1868) Japan, 19th century, Edo period (1615-1868) The dog is sitting and has his left paw placed on a ball, wears a collar with hanging HEIGHT 2.3 – 3.4 cm bells and shows a friendly expression, eyes inlaid in black horn and smooth polished Condition: All in good surface. condition. The rope in the mouth of the fourth dog HEIGHT 4.8 cm is chipped. Some minor expected age cracks. Condition: Good worn condition, a chip to 3URYHQDQFH%ULWLVK one paw. collection. Provenance: European private collection. Estimate EUR 800,- Estimate EUR 700,- Starting price EUR 400,- Starting price EUR 350,- 148 | AN AMUSING WOOD 145 | KOGYOKUSAI: AN IVORY NETSUKE OF A DOG NETSUKE OF CHICKENS, WAR DRUM AND RABBIT Unsigned Japan, first half of 19th century, Edo period %\.RJ\RNXVDLVLJQHG.RJ\RNXVDL (1615-1868) Japan, Tokyo, Meiji period (1868-1912) Carved from a grainy dark wood and The composition set on a rock showing depicting a dog, not your usual dog, but a war drum with a cockerel, hen and two rather a somewhat frightening wolf-like chicks, one of them amusingly bursting creature. The dog is seated and looking through the skin of the drum. The sides downwards, its mouth is voraciously of the drum are inlaid with rows of horn opened revealing the teeth, and the bulging buttons. Next to the drum is a little rabbit, eyes are inlaid in ivory with horn pupils. with inlaid eyes of bright orange coral. The fur is sparsely incised, the grain of Signature KOGYOKUSAI in a wavy reserve the wood adding to the texture, its tail is on the underside of the rabbit. Natural curling, and the spine and rib cage are himotoshi. well-expressed. Very good, large himotoshi through the underside and side. HEIGHT 3.8 cm HEIGHT 3.6 cm Condition: Good condition, the ivory slightly worn. Condition: Very good condition with a nice 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ glossy patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Starting price EUR 300,- Estimate EUR 500,- Starting price EUR 250,- 146 | KOKU: A STAG ANTLER 149 | ONE SILVER CHUBBY DOG NETSUKE AND THREE IVORY NETSUKE Signed Koku OF DOGS Japan, second half of 19th century The first signed Hakuo, The fourth signed Mitsuo, the A rustic and old stag antler netsuke with others unsigned worn-down features and nice patina. Japan, 19th century, The chubby dog is seated and shows an Edo period (1615-1868) amusing expression. The underside shows the himotoshi, one of them cleverly used to represent the signature Koku, for Kokusai. HEIGHT 3.4 – 6 cm LENGTH 4 cm Condition: All in good condition. Some minor Condition: Good condition with stunning expected age cracks. patina and wear. 3URYHQDQFH%ULWLVK Provenance: European private collection. collection. Estimate EUR 400,- Estimate EUR 800,- Starting price EUR 200,- Starting price EUR 400,- 52 53 154 | AN IVORY NETSUKE OF A DOG ON A MAT Signed Japan, 19th century, Edo period (1615-1868) An ivory netsuke of a dog (inu) on a straw mat, with chubby paws and scratching his ear. The dog has a charming expression with finely inlaid eyes and is wearing a collar. Himotoshi on the underside and the signature on an inlaid mother of pearl tablet. HEIGHT 3.5 cm Condition: Several age cracks, otherwise good condition. Provenance: The 40-Year collection of a London Gentleman. 151 | A KYOTO SCHOOL IVORY NETSUKE OF A DOG WITH BALL Estimate EUR 400,- Starting price EUR 200,- Unsigned Japan, Kyoto, early 19th century, Edo period (1615-1868) 150 | TWO IVORY NETSUKE OF A DOG 155 | A FINE IVORY NETSUKE OF A PUPPY WITH AND A RAT IN A BASKET An ivory netsuke, carved in distinct Kyoto style, of a dog with its WARAJI BY RANICHI finely carved paws on a large and smooth ball. The dog (inu), Unsigned the eleventh animal of the zodiac, is looking backwards with %\5DQLFKLVLJQHG5DQLFKL Japan, 19th century, Edo period (1615-1868) unusually large inlaid eyes of black horn. Minutely incised fur and Japan, Kyoto, 19th century, Edo period (1615-1868) large himotoshi through the underside and side. LENGHT 5 and 6.3 cm HEIGHT 3.6 cm A fine and compact stained ivory study of a puppy with beady inlaid eyes heartily chewing on a sandal (waraji). The dog (inu) Condition: The first in good condition, the second with superficial Condition: Expected age cracks, good patina. Good condition. is the eleventh sign of the zodiac. Himotoshi through the waraji scratches and a restoration to the edge of the basket. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ6RWKHE\ȇVE\1HLO.'DYH\ and under one of the legs and signature RANICHI, a pupil of the 3URYHQDQFH%ULWLVKFROOHFWLRQ from 1974 & 1984, inventory no. 120. well-known Hogen Rantei, who showed individual character in his compositions, and made mainly carvings of animals, though Estimate EUR 600,- Estimate EUR 400,- netsuke of dogs are rather rare. Starting price EUR 300,- Starting price EUR 200,- HEIGHT 2.5 cm, LENGTH 3.8 cm Condition: One nerve channel on the back of the puppy, smaller 152 | A FINE AND RARE HIRADO PORCELAIN 153 | AN IVORY NETSUKE OF A MAN expected age cracks, the ivory slightly worn. Generally, in very good NETSUKE OF TWO DOGS ON A BASKET WEARING A MASK AND A DOG condition. Provenance: The 40-Year Collection of a London Gentleman. Unsigned Unsigned Japan, Hirado, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Estimate EUR 600,- Starting price EUR 300,- Two puppies playing about, one climbing on top of the other, A man seated on the ground, a dog sitting on his feet. The man and the other with a string from the basket in its mouth and is hiding his face behind a mask, which shows a peaceful smile. holding an awabi shell with one paw. Puppies symbolize good 7KHGRJRQWKHRWKHUKDQGVKRZVDUDWKHUJULPH[SUHVVLRQ%RWK health while dried awabi strips were a popular gift representing a are looking forward. A finely stained and polished work with large long life. This netsuke is made from pure white porcelain, with a himotoshi through the underside and back. 156 | FIVE IVORY NETSUKE OF DOGS beautiful shimmering glaze and an oily feel to it. Hirado netsuke of this quality are rare to find. HEIGHT 3.2 cm Unsigned Japan, late 18th to 19th century, Edo period (1615-1868) HEIGHT 4 cm Condition: Excellent condition, fine patina. Provenance: The 40-Year Collection of a London Gentleman. Condition: Good condition, possibly a small chip to the rope in HEIGHT 2 – 4.8 cm the mouth of one the puppies. Estimate EUR 500,- Provenance: The 40-Year Collection of a London Gentleman. Starting price EUR 250,- Condition: All in good condition with minor expected wear and age cracks. Estimate EUR 800,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Starting price EUR 400,- Estimate EUR 1.000,- Starting price EUR 500,- 54 55 154 | AN IVORY NETSUKE OF A DOG ON A MAT Signed Japan, 19th century, Edo period (1615-1868) An ivory netsuke of a dog (inu) on a straw mat, with chubby paws and scratching his ear. The dog has a charming expression with finely inlaid eyes and is wearing a collar. Himotoshi on the underside and the signature on an inlaid mother of pearl tablet. HEIGHT 3.5 cm Condition: Several age cracks, otherwise good condition. Provenance: The 40-Year collection of a London Gentleman. 151 | A KYOTO SCHOOL IVORY NETSUKE OF A DOG WITH BALL Estimate EUR 400,- Starting price EUR 200,- Unsigned Japan, Kyoto, early 19th century, Edo period (1615-1868) 150 | TWO IVORY NETSUKE OF A DOG 155 | A FINE IVORY NETSUKE OF A PUPPY WITH AND A RAT IN A BASKET An ivory netsuke, carved in distinct Kyoto style, of a dog with its WARAJI BY RANICHI finely carved paws on a large and smooth ball. The dog (inu), Unsigned the eleventh animal of the zodiac, is looking backwards with %\5DQLFKLVLJQHG5DQLFKL Japan, 19th century, Edo period (1615-1868) unusually large inlaid eyes of black horn. Minutely incised fur and Japan, Kyoto, 19th century, Edo period (1615-1868) large himotoshi through the underside and side. LENGHT 5 and 6.3 cm HEIGHT 3.6 cm A fine and compact stained ivory study of a puppy with beady inlaid eyes heartily chewing on a sandal (waraji). The dog (inu) Condition: The first in good condition, the second with superficial Condition: Expected age cracks, good patina. Good condition. is the eleventh sign of the zodiac. Himotoshi through the waraji scratches and a restoration to the edge of the basket. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ6RWKHE\ȇVE\1HLO.'DYH\ and under one of the legs and signature RANICHI, a pupil of the 3URYHQDQFH%ULWLVKFROOHFWLRQ from 1974 & 1984, inventory no. 120. well-known Hogen Rantei, who showed individual character in his compositions, and made mainly carvings of animals, though Estimate EUR 600,- Estimate EUR 400,- netsuke of dogs are rather rare. Starting price EUR 300,- Starting price EUR 200,- HEIGHT 2.5 cm, LENGTH 3.8 cm Condition: One nerve channel on the back of the puppy, smaller 152 | A FINE AND RARE HIRADO PORCELAIN 153 | AN IVORY NETSUKE OF A MAN expected age cracks, the ivory slightly worn. Generally, in very good NETSUKE OF TWO DOGS ON A BASKET WEARING A MASK AND A DOG condition. Provenance: The 40-Year Collection of a London Gentleman. Unsigned Unsigned Japan, Hirado, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Estimate EUR 600,- Starting price EUR 300,- Two puppies playing about, one climbing on top of the other, A man seated on the ground, a dog sitting on his feet. The man and the other with a string from the basket in its mouth and is hiding his face behind a mask, which shows a peaceful smile. holding an awabi shell with one paw. Puppies symbolize good 7KHGRJRQWKHRWKHUKDQGVKRZVDUDWKHUJULPH[SUHVVLRQ%RWK health while dried awabi strips were a popular gift representing a are looking forward. A finely stained and polished work with large long life. This netsuke is made from pure white porcelain, with a himotoshi through the underside and back. 156 | FIVE IVORY NETSUKE OF DOGS beautiful shimmering glaze and an oily feel to it. Hirado netsuke of this quality are rare to find. HEIGHT 3.2 cm Unsigned Japan, late 18th to 19th century, Edo period (1615-1868) HEIGHT 4 cm Condition: Excellent condition, fine patina. Provenance: The 40-Year Collection of a London Gentleman. Condition: Good condition, possibly a small chip to the rope in HEIGHT 2 – 4.8 cm the mouth of one the puppies. Estimate EUR 500,- Provenance: The 40-Year Collection of a London Gentleman. Starting price EUR 250,- Condition: All in good condition with minor expected wear and age cracks. Estimate EUR 800,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Starting price EUR 400,- Estimate EUR 1.000,- Starting price EUR 500,- 54 55 157 | A FINE KYOTO SCHOOL IVORY NETSUKE OF A DOG WITH AWABI Unsigned Japan, Kyoto, 18th century, Edo period (1615-1868) A relatively large and finely carved ivory netsuke of a dog holding an awabi shell between its paws – a symbol of good health and long life. The dog has a whimsical expression with large inlaid eyes of black horn. The fur is neatly incised and characteristically worn, and the patina is a beautifully changing hue of yellow to deep orange honey. The tail of the dog neatly curls upwards and the paws are carved crisply. The underside with the himotoshi – one through the characteristically soft underside of the awabi and the other through the belly of the dog. 160 | TANETOSHI: A CHARMING AND FINE IVORY 161 | AN IVORY NETSUKE OF A NETSUKE OF A DOG WITH PUP RECLINING SHAGGY DOG HEIGHT 4 cm, LENGTH 4 cm %\7DQHWRVKLVLJQHG7DQHWRVKLZLWKDUWLVWVHDO Unsigned Condition: Very good condition with expected age cracks and fine Japan, 20th century Japan, early 19th century, Edo period (1615-1868) and appealing patina. Provenance: The 40-Year Collection of a London Gentleman. A masterfully animated group of finely crafted figures. The quality An unusual and compact study of a shaggy dog lying down on Estimate EUR 1.000,- of this work is that of Kaigyokusai or Rantei. The dog is wearing a rounded rectangular base. A lot of care has been taken to Starting price EUR 500,- a collar, its anatomy is executed very precisely, the costal arch, express the ragged hair of the animal. The dog is the eleventh fine fur, dark inlaid eyes. Its tail is coiled, the younger dog is sign of the zodiac and is considered a friend. Large inlaid eyes of lying on its back between his front legs and is being held down deep-black horn and himotoshi on the underside. E\WKHIDWKHU%RWKH[SUHVVLRQVDUHFKDUPLQJQDWXUDOLVWLFDQG 158 | AN IVORY KYOTO SCHOOL NETSUKE masterfully executed. Underneath the signature TANETOSHI HEIGHT 2.4 cm, LENGTH 4.3 cm OF A DOG WITH A BALL with seal. The artist is the son of Meigyokusai, a Japanese contemporary artist from the lineage of Gyokuzan. Condition: Good condition with many age cracks and fine Unsigned yellowish patina. Japan, Kyoto, first half of the 19th century, Edo period (1615-1868) HEIGHT 3.5 cm 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Very good condition, beautiful patina. Estimate EUR 300,- The dog is carved in the style of the Kyoto school, its small head Provenance: Austrian private collection. Starting price EUR 150,- turned backwards and both front paws on a ball, note the beautiful details of the paws. The dog is wearing a collar around its neck, its Estimate EUR 1.500,- fur, ribs and spine are precisely executed. Its small head is carved Starting price EUR 750,- in a very lively manner, with lustrous black inlaid eyes. Natural himotoshi between the legs and ball. The dog (inu) is one of the twelve signs of the Japanese zodiac. 162 | AN IVORY NETSUKE OF 163 | DERKACHENKO: A BOXWOOD NETSUKE HEIGHT 3.4 cm, LENGTH 4.2 cm A JUMPING BOAR OF A PUPPY WITH FEATHER Condition: The tail has been chipped. Otherwise good condition Unsigned %\$OH[DQGHU'HUNDFKHQNRVLJQHG with a beautiful honey patina. Japan, 19th century, Edo period (1615-1868) Ukraine, 2019 Provenance: The 40-Year Collection of a London gentleman. Estimate EUR 1.000,- The boar (inoshishi) is a symbol of daredevilry and the bravest This work was inspired by an inro Alexander Derkachenko saw Starting price EUR 500,- of all animals as well as one of the signs of the Japanese in the International Netsuke Society Journal depicting a cat with zodiac. This boar has its head raised upwards and its front feather. The design is very much executed in the manner of the legs tucked up, creating the appearance of the boar being Ise-Yamada coiled rat netsuke and shows a coiled puppy with 159 | TOMONOBU: A WOOD NETSUKE about to jump. Dense fur pattern, the animal’s muscles are amusingly large inlaid eyes, holding a large feather in its mouth OF A BITCH AND TWO PUPS accentuated, its wild expression captured well. Himotoshi on and lifting its right hindleg to scratch its ear. The feather is carved the belly. over the back of the puppy and cleverly merges with the fur. %\7RPRQREXVLJQHG7RPRQREX Large himotoshi next to the inlaid artist’s signature. Japan, 19th century, Edo period (1615-1868) LENGTH 3.4 cm HEIGHT 4 cm Condition: One hoof is chipped, otherwise good condition. A charming study of a reclining bitch with two pups, one nestling up Provenance: Private collection of London-based gentleman. Condition: Excellent condition. to her underneath her head and the other climbing onto her back. The wood of a very good color, with a fine dark red hue, especially Estimate EUR 400,- Estimate EUR 1.000,- YLVLEOHRQWKHXQGHUVLGH6LJQDWXUH720212%8QH[WWRWKHXGGHUV Starting price EUR 200,- Starting price EUR 500,- of the female dog on the underside. LENGTH 4.5 cm Condition: One leg of the reclining puppy is chipped. Otherwise good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Probably the Tomonobu mentioned as from the Tomochika school, however the tone of the wood could suggest Nagoya school, which could make it a very unusual subject by Arima Tomonobu. Estimate EUR 600,- Starting price EUR 300,- 56 57 157 | A FINE KYOTO SCHOOL IVORY NETSUKE OF A DOG WITH AWABI Unsigned Japan, Kyoto, 18th century, Edo period (1615-1868) A relatively large and finely carved ivory netsuke of a dog holding an awabi shell between its paws – a symbol of good health and long life. The dog has a whimsical expression with large inlaid eyes of black horn. The fur is neatly incised and characteristically worn, and the patina is a beautifully changing hue of yellow to deep orange honey. The tail of the dog neatly curls upwards and the paws are carved crisply. The underside with the himotoshi – one through the characteristically soft underside of the awabi and the other through the belly of the dog. 160 | TANETOSHI: A CHARMING AND FINE IVORY 161 | AN IVORY NETSUKE OF A NETSUKE OF A DOG WITH PUP RECLINING SHAGGY DOG HEIGHT 4 cm, LENGTH 4 cm %\7DQHWRVKLVLJQHG7DQHWRVKLZLWKDUWLVWVHDO Unsigned Condition: Very good condition with expected age cracks and fine Japan, 20th century Japan, early 19th century, Edo period (1615-1868) and appealing patina. Provenance: The 40-Year Collection of a London Gentleman. A masterfully animated group of finely crafted figures. The quality An unusual and compact study of a shaggy dog lying down on Estimate EUR 1.000,- of this work is that of Kaigyokusai or Rantei. The dog is wearing a rounded rectangular base. A lot of care has been taken to Starting price EUR 500,- a collar, its anatomy is executed very precisely, the costal arch, express the ragged hair of the animal. The dog is the eleventh fine fur, dark inlaid eyes. Its tail is coiled, the younger dog is sign of the zodiac and is considered a friend. Large inlaid eyes of lying on its back between his front legs and is being held down deep-black horn and himotoshi on the underside. E\WKHIDWKHU%RWKH[SUHVVLRQVDUHFKDUPLQJQDWXUDOLVWLFDQG 158 | AN IVORY KYOTO SCHOOL NETSUKE masterfully executed. Underneath the signature TANETOSHI HEIGHT 2.4 cm, LENGTH 4.3 cm OF A DOG WITH A BALL with seal. The artist is the son of Meigyokusai, a Japanese contemporary artist from the lineage of Gyokuzan. Condition: Good condition with many age cracks and fine Unsigned yellowish patina. Japan, Kyoto, first half of the 19th century, Edo period (1615-1868) HEIGHT 3.5 cm 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Very good condition, beautiful patina. Estimate EUR 300,- The dog is carved in the style of the Kyoto school, its small head Provenance: Austrian private collection. Starting price EUR 150,- turned backwards and both front paws on a ball, note the beautiful details of the paws. The dog is wearing a collar around its neck, its Estimate EUR 1.500,- fur, ribs and spine are precisely executed. Its small head is carved Starting price EUR 750,- in a very lively manner, with lustrous black inlaid eyes. Natural himotoshi between the legs and ball. The dog (inu) is one of the twelve signs of the Japanese zodiac. 162 | AN IVORY NETSUKE OF 163 | DERKACHENKO: A BOXWOOD NETSUKE HEIGHT 3.4 cm, LENGTH 4.2 cm A JUMPING BOAR OF A PUPPY WITH FEATHER Condition: The tail has been chipped. Otherwise good condition Unsigned %\$OH[DQGHU'HUNDFKHQNRVLJQHG with a beautiful honey patina. Japan, 19th century, Edo period (1615-1868) Ukraine, 2019 Provenance: The 40-Year Collection of a London gentleman. Estimate EUR 1.000,- The boar (inoshishi) is a symbol of daredevilry and the bravest This work was inspired by an inro Alexander Derkachenko saw Starting price EUR 500,- of all animals as well as one of the signs of the Japanese in the International Netsuke Society Journal depicting a cat with zodiac. This boar has its head raised upwards and its front feather. The design is very much executed in the manner of the legs tucked up, creating the appearance of the boar being Ise-Yamada coiled rat netsuke and shows a coiled puppy with 159 | TOMONOBU: A WOOD NETSUKE about to jump. Dense fur pattern, the animal’s muscles are amusingly large inlaid eyes, holding a large feather in its mouth OF A BITCH AND TWO PUPS accentuated, its wild expression captured well. Himotoshi on and lifting its right hindleg to scratch its ear. The feather is carved the belly. over the back of the puppy and cleverly merges with the fur. %\7RPRQREXVLJQHG7RPRQREX Large himotoshi next to the inlaid artist’s signature. Japan, 19th century, Edo period (1615-1868) LENGTH 3.4 cm HEIGHT 4 cm Condition: One hoof is chipped, otherwise good condition. A charming study of a reclining bitch with two pups, one nestling up Provenance: Private collection of London-based gentleman. Condition: Excellent condition. to her underneath her head and the other climbing onto her back. The wood of a very good color, with a fine dark red hue, especially Estimate EUR 400,- Estimate EUR 1.000,- YLVLEOHRQWKHXQGHUVLGH6LJQDWXUH720212%8QH[WWRWKHXGGHUV Starting price EUR 200,- Starting price EUR 500,- of the female dog on the underside. LENGTH 4.5 cm Condition: One leg of the reclining puppy is chipped. Otherwise good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Probably the Tomonobu mentioned as from the Tomochika school, however the tone of the wood could suggest Nagoya school, which could make it a very unusual subject by Arima Tomonobu. Estimate EUR 600,- Starting price EUR 300,- 56 57 164 | FIVE WOOD NETSUKE, 168 | FIVE WOOD NETSUKE THREE SIGNED Unsigned The first signed Minko, the second Shuzan and Japan, 19th century, Edo period the third Hokei (1615-1868) Japan, 19th century The first a street entertainer, the The first an ebony netsuke of a dog, signed second depicting Hotei with a karako MINKO, the second a boy with a puppy, signed WRKLVOHIWbDQGZLWKUHPQDQWVRIZRUQ SHUZAN, the third a rat catcher, signed HOKEI, Negoro lacquer, the third Kanzan the fourth a boy holding a dog and the fifth a and Jittoku standing side by side, the skinny wolf with a skull, the eyes inlaid in ivory. fourth a boy peeling a hozuki fruit inlaid in coral and the fifth of Hotei HEIGHT 2.8 – 4.9 cm with bag. Condition: Overall good worn condition with fine HEIGHT 3.5 – 5.8 cm patina, the second with a chip. 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: The second with a foot slightly chipped and worn off lacquer, Estimate EUR 1.000,- the third with worn features and Starting price EUR 500,- a drilled hole, the fourth with a natural flaw to the coral, the fifth with chipped feet. 3URYHQDQFH%ULWLVKFROOHFWLRQ 165 | A WOOD NETSUKE OF KANZAN WITH A SCROLL Estimate EUR 1.000,- Unsigned Starting price EUR 500,- Japan, 18th century, Edo period (1615-1868) The netsuke shows Kanzan with a scroll. Very good large himotoshi on the back. 169 | A VERY RARE 17TH CENTURY IVORY NETSUKE OF TWO CHINESE BOYS WITH HOTEI’S SACK HEIGHT 7 cm Unsigned &RQGLWLRQ%HDXWLIXOZRUQSDWLQDDQGVLJQVRIDJH*RRGFRQGLWLRQ Japan, 17th century, Edo period (1615-1868) 3URYHQDQFH%ULWLVK&ROOHFWLRQ Estimate EUR 400,- This netsuke shows a popular theme, adopted from China, and used for some Starting price EUR 200,- of the earliest Japanese netsuke which derived from Chinese toggles. Depicted are two Chinese boys, their facial expressions executed very much in the style of the Ming dynasty, dressed in Chinese robes and holding a fan together DERYHDWLHGVDFNȂDQDOOXVLRQWRWKHOXFN\GHLW\+RWHL LQ&KLQHVH%XGDL 166 | FIVE IVORY NETSUKE OF KARAKO HEIGHT 3.5 cm, LENGTH 4.6 cm The first signed Masahiro, the second signed Condition: Worn condition, very appealing patina, age cracks and the fan is %XQVHLWKHWKLUGVLQJHG7DGDFKLNDWKHIRXUWK slightly chipped. signed Homin, the last unsigned Provenance: Austrian private collection. Japan, mid-19th century, to Meiji period (1868- 1912) Estimate EUR 400,- Starting price EUR 200,- Consisting of a karako with daruma snowman, a boy pulling the skin off a drum, two karako playing horse riding, two karako fishing in a bowl 170 | AN IVORY NETSUKE AND AN IVORY OKIMONO and two karako playing with a tengu mask. The first signed Tomokazu, the second unsigned HEIGHT 2.9 – 4.8 cm Japan, mid to late 19th century, Edo period (1615-1868) Condition: All in good condition with expected 167 | A GROUP OF THREE WOOD NETSUKE wear or age cracks. The first depicting a Chinese boy (karako) holding down a fan, 3URYHQDQFH%ULWLVKFROOHFWLRQ 7KHVHFRQGVLJQHG%RNXWDNXGR0RNNXWKHWKLUGVLJQHGLQVHDOIRUP presumably trying to catch a butterfly. Signature TOMOKAZU in a Japan, 19th century rounded reserve on the underside. The second a finely carved and Estimate EUR 1.000,- attractively stained okimono of a Chinese boy holding a puppy with Starting price EUR 500,- finely carved fur and a charming expression. The first depicting a boy holding a hozuki fruit inlaid in coral, the second a boy with a PRNXJ\RWHPSOHEHOOZLWKIXOOVLJQDWXUH%2.87$.8'202..8 DSXSLORI0LZD DQG HEIGHT 3.4 – 5 cm the third another boy making the bekkanko gesture. &RQGLWLRQ%RWKLQJRRGFRQGLWLRQ7KHILUVWZLWKH[SHFWHGDJH HEIGHT 3.4 – 4.4 cm cracks and minor soiling near the himotoshi. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ7KHVHFRQGZLWKWZR Condition: Very good condition, the third with a tiny chip to one eye. valuations from Sotheby’s, by Neil K. Davey, dated 1974 & 1984, 3URYHQDQFH%ULWLVKFROOHFWLRQ inventory no. 135. Estimate EUR 800,- Estimate EUR 600,- Starting price EUR 400,- Starting price EUR 300,- 58 59 164 | FIVE WOOD NETSUKE, 168 | FIVE WOOD NETSUKE THREE SIGNED Unsigned The first signed Minko, the second Shuzan and Japan, 19th century, Edo period the third Hokei (1615-1868) Japan, 19th century The first a street entertainer, the The first an ebony netsuke of a dog, signed second depicting Hotei with a karako MINKO, the second a boy with a puppy, signed WRKLVOHIWbDQGZLWKUHPQDQWVRIZRUQ SHUZAN, the third a rat catcher, signed HOKEI, Negoro lacquer, the third Kanzan the fourth a boy holding a dog and the fifth a and Jittoku standing side by side, the skinny wolf with a skull, the eyes inlaid in ivory. fourth a boy peeling a hozuki fruit inlaid in coral and the fifth of Hotei HEIGHT 2.8 – 4.9 cm with bag. Condition: Overall good worn condition with fine HEIGHT 3.5 – 5.8 cm patina, the second with a chip. 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: The second with a foot slightly chipped and worn off lacquer, Estimate EUR 1.000,- the third with worn features and Starting price EUR 500,- a drilled hole, the fourth with a natural flaw to the coral, the fifth with chipped feet. 3URYHQDQFH%ULWLVKFROOHFWLRQ 165 | A WOOD NETSUKE OF KANZAN WITH A SCROLL Estimate EUR 1.000,- Unsigned Starting price EUR 500,- Japan, 18th century, Edo period (1615-1868) The netsuke shows Kanzan with a scroll. Very good large himotoshi on the back. 169 | A VERY RARE 17TH CENTURY IVORY NETSUKE OF TWO CHINESE BOYS WITH HOTEI’S SACK HEIGHT 7 cm Unsigned &RQGLWLRQ%HDXWLIXOZRUQSDWLQDDQGVLJQVRIDJH*RRGFRQGLWLRQ Japan, 17th century, Edo period (1615-1868) 3URYHQDQFH%ULWLVK&ROOHFWLRQ Estimate EUR 400,- This netsuke shows a popular theme, adopted from China, and used for some Starting price EUR 200,- of the earliest Japanese netsuke which derived from Chinese toggles. Depicted are two Chinese boys, their facial expressions executed very much in the style of the Ming dynasty, dressed in Chinese robes and holding a fan together DERYHDWLHGVDFNȂDQDOOXVLRQWRWKHOXFN\GHLW\+RWHL LQ&KLQHVH%XGDL 166 | FIVE IVORY NETSUKE OF KARAKO HEIGHT 3.5 cm, LENGTH 4.6 cm The first signed Masahiro, the second signed Condition: Worn condition, very appealing patina, age cracks and the fan is %XQVHLWKHWKLUGVLQJHG7DGDFKLNDWKHIRXUWK slightly chipped. signed Homin, the last unsigned Provenance: Austrian private collection. Japan, mid-19th century, to Meiji period (1868- 1912) Estimate EUR 400,- Starting price EUR 200,- Consisting of a karako with daruma snowman, a boy pulling the skin off a drum, two karako playing horse riding, two karako fishing in a bowl 170 | AN IVORY NETSUKE AND AN IVORY OKIMONO and two karako playing with a tengu mask. The first signed Tomokazu, the second unsigned HEIGHT 2.9 – 4.8 cm Japan, mid to late 19th century, Edo period (1615-1868) Condition: All in good condition with expected 167 | A GROUP OF THREE WOOD NETSUKE wear or age cracks. The first depicting a Chinese boy (karako) holding down a fan, 3URYHQDQFH%ULWLVKFROOHFWLRQ 7KHVHFRQGVLJQHG%RNXWDNXGR0RNNXWKHWKLUGVLJQHGLQVHDOIRUP presumably trying to catch a butterfly. Signature TOMOKAZU in a Japan, 19th century rounded reserve on the underside. The second a finely carved and Estimate EUR 1.000,- attractively stained okimono of a Chinese boy holding a puppy with Starting price EUR 500,- finely carved fur and a charming expression. The first depicting a boy holding a hozuki fruit inlaid in coral, the second a boy with a PRNXJ\RWHPSOHEHOOZLWKIXOOVLJQDWXUH%2.87$.8'202..8 DSXSLORI0LZD DQG HEIGHT 3.4 – 5 cm the third another boy making the bekkanko gesture. &RQGLWLRQ%RWKLQJRRGFRQGLWLRQ7KHILUVWZLWKH[SHFWHGDJH HEIGHT 3.4 – 4.4 cm cracks and minor soiling near the himotoshi. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ7KHVHFRQGZLWKWZR Condition: Very good condition, the third with a tiny chip to one eye. valuations from Sotheby’s, by Neil K. Davey, dated 1974 & 1984, 3URYHQDQFH%ULWLVKFROOHFWLRQ inventory no. 135. Estimate EUR 800,- Estimate EUR 600,- Starting price EUR 400,- Starting price EUR 300,- 58 59 171 | DERKACHENKO: 174 | HIDE: AN IVORY NETSUKE OF FUKUROKUJU A SET OF SHICHI FUKUJIN %\+LGHPDVDVLJQHG+LGH MAMMOTH IVORY Japan, 19th century, Edo period (1615-1868) NETSUKE %\$OH[DQGHU'HUNDFKHQNR Osaka school. Very nice representation of the god of longevity signed Derkachenko leaning on a small stool and holding a hossu (buddhist ‘fly Ukraine, contemporary swatter’). Skillfully executed details and signed HIDE, most likely abbreviated for Hidemasa. Derkachenko has always had a HEIGHT 4.6 cm special talent for carving faces, evident in this set. In this work, Condition: Very good condition. he has carved the Shichi Fukujin, Provenance: French-German private collection acquired in late the Seven Lucky Gods of Japan. 2000. Hotei is laughing happily, as is Ebisu, the god of fishermen, who Estimate EUR 600,- is holding a big fish he just caught. Starting price EUR 300,- Fukurokuju, the god of wisdom and longevity, with the typical elongated forehead, and Daikoku, the god of wealth, naturally also appear happy. On the other hand, 175 | A LARGE KUROGAKI WOOD Jurojin, next to a crane, and the NETSUKE OF JUROJIN PDUWLDO%LVKDPRQDSSHDUUDWKHU morose. The only female Lucky Unsigned *RG%HQWHQLVSOD\LQJWKHOXWH Japan, 18th to 19th century, Edo period (1615-1868) HEIGHT 3.3 - 4.1 cm A beautifully balanced and large wood netsuke representing Condition: Excellent condition. Jurojin holding a staff and a fan, fine patina and natural mottled wood. Estimate EUR 6.000,- Starting price EUR 3.000,- HEIGHT 7.8 cm Condition: Expected age cracks and a chip to the lower area, otherwise good worn condition. 173 | A WOOD NETSUKE OF Provenance: French Private collection acquired in 1995 from an DAIKOKU WITH KARAKO antiques dealer in Italy, by repute. Signed Gengensai Estimate EUR 500,- Japan, mid-19th century, Edo period (1615-1868) Starting price EUR 250,- Daikoku, one of the seven gods of good fortune is represented here with his characteristic flat beret 177 | TOMOCHIKA: AN IVORY NETSUKE OF and holding a buddhist temple bell (mokugyo) DAIKOKU AND ONI AT SETSUBUN which he hits with a mallet, his mouth wide open 176 | A LARGE AND RARE WOOD NETSUKE as if calling for prayer; the boy besides him raises OF BENTEN AND BISHAMON %\&KLNX\RVDL7RPRFKLNDVLJQHG7RPRFKLND his hand in a gesture of offering. Good patina Japan, mid-19th century, Edo period (1615-1868) and signed GENGENSAI under the himotoshi on Unsigned the back. Japan, 18th century, Edo period (1868-1912) A scene from the oni-yarai festival (also known as setsubun). HEIGHT 4.6 cm Daikoku is gleefully throwing kuromame (roasted beans) to drive 7KHWZROXFN\JRGVGHSLFWHGULGLQJDFORXG%RWKDUHUDUHLQ away the oni, who kneels fearfully at his feet. Himotoshi through Condition: Very good worn condition. netsuke art. the back and signature TOMOCHIKA. 172 | THREE FIGURAL IVORY NETSUKE Provenance: French Private collection acquired in AND TWO WALRUS NETSUKE 1995 from an antiques dealer in Italy, by repute. HEIGHT 5.5 cm, LENGTH 5.7 cm HEIGHT 4 cm The first signed Tomomasa, the fifth signed on an inlaid mother-of-pearl tablet, Estimate EUR 800,- Condition: Good worn condition. Condition: Very good condition with expected age cracks. the others unsigned Starting price EUR 400,- Provenance: French private collection. Provenance: French private collection. Japan, 19th century Estimate EUR 1.200,- Estimate EUR 600,- Starting price EUR 600,- Starting price EUR 300,- The first a rare and fine walrus ivory Ebisu holding down a sea bream, the second an ivory netsuke of a woman polishing the floor and the third a walrus ivory netsuke of Kinko sennin. The fourth depicting two oni being pelted by roasted beans during Setsubon, the last a mask carver taking a smoking break. HEIGHT 3.3 - 4.3 cm Condition: All in good condition, one minor age crack through the polishing lady. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 700,- Starting price EUR 350,- 60 61 171 | DERKACHENKO: 174 | HIDE: AN IVORY NETSUKE OF FUKUROKUJU A SET OF SHICHI FUKUJIN %\+LGHPDVDVLJQHG+LGH MAMMOTH IVORY Japan, 19th century, Edo period (1615-1868) NETSUKE %\$OH[DQGHU'HUNDFKHQNR Osaka school. Very nice representation of the god of longevity signed Derkachenko leaning on a small stool and holding a hossu (buddhist ‘fly Ukraine, contemporary swatter’). Skillfully executed details and signed HIDE, most likely abbreviated for Hidemasa. Derkachenko has always had a HEIGHT 4.6 cm special talent for carving faces, evident in this set. In this work, Condition: Very good condition. he has carved the Shichi Fukujin, Provenance: French-German private collection acquired in late the Seven Lucky Gods of Japan. 2000. Hotei is laughing happily, as is Ebisu, the god of fishermen, who Estimate EUR 600,- is holding a big fish he just caught. Starting price EUR 300,- Fukurokuju, the god of wisdom and longevity, with the typical elongated forehead, and Daikoku, the god of wealth, naturally also appear happy. On the other hand, 175 | A LARGE KUROGAKI WOOD Jurojin, next to a crane, and the NETSUKE OF JUROJIN PDUWLDO%LVKDPRQDSSHDUUDWKHU morose. The only female Lucky Unsigned *RG%HQWHQLVSOD\LQJWKHOXWH Japan, 18th to 19th century, Edo period (1615-1868) HEIGHT 3.3 - 4.1 cm A beautifully balanced and large wood netsuke representing Condition: Excellent condition. Jurojin holding a staff and a fan, fine patina and natural mottled wood. Estimate EUR 6.000,- Starting price EUR 3.000,- HEIGHT 7.8 cm Condition: Expected age cracks and a chip to the lower area, otherwise good worn condition. 173 | A WOOD NETSUKE OF Provenance: French Private collection acquired in 1995 from an DAIKOKU WITH KARAKO antiques dealer in Italy, by repute. Signed Gengensai Estimate EUR 500,- Japan, mid-19th century, Edo period (1615-1868) Starting price EUR 250,- Daikoku, one of the seven gods of good fortune is represented here with his characteristic flat beret 177 | TOMOCHIKA: AN IVORY NETSUKE OF and holding a buddhist temple bell (mokugyo) DAIKOKU AND ONI AT SETSUBUN which he hits with a mallet, his mouth wide open 176 | A LARGE AND RARE WOOD NETSUKE as if calling for prayer; the boy besides him raises OF BENTEN AND BISHAMON %\&KLNX\RVDL7RPRFKLNDVLJQHG7RPRFKLND his hand in a gesture of offering. Good patina Japan, mid-19th century, Edo period (1615-1868) and signed GENGENSAI under the himotoshi on Unsigned the back. Japan, 18th century, Edo period (1868-1912) A scene from the oni-yarai festival (also known as setsubun). HEIGHT 4.6 cm Daikoku is gleefully throwing kuromame (roasted beans) to drive 7KHWZROXFN\JRGVGHSLFWHGULGLQJDFORXG%RWKDUHUDUHLQ away the oni, who kneels fearfully at his feet. Himotoshi through Condition: Very good worn condition. netsuke art. the back and signature TOMOCHIKA. 172 | THREE FIGURAL IVORY NETSUKE Provenance: French Private collection acquired in AND TWO WALRUS NETSUKE 1995 from an antiques dealer in Italy, by repute. HEIGHT 5.5 cm, LENGTH 5.7 cm HEIGHT 4 cm The first signed Tomomasa, the fifth signed on an inlaid mother-of-pearl tablet, Estimate EUR 800,- Condition: Good worn condition. Condition: Very good condition with expected age cracks. the others unsigned Starting price EUR 400,- Provenance: French private collection. Provenance: French private collection. Japan, 19th century Estimate EUR 1.200,- Estimate EUR 600,- Starting price EUR 600,- Starting price EUR 300,- The first a rare and fine walrus ivory Ebisu holding down a sea bream, the second an ivory netsuke of a woman polishing the floor and the third a walrus ivory netsuke of Kinko sennin. The fourth depicting two oni being pelted by roasted beans during Setsubon, the last a mask carver taking a smoking break. HEIGHT 3.3 - 4.3 cm Condition: All in good condition, one minor age crack through the polishing lady. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 700,- Starting price EUR 350,- 60 61 178 | MASAKAZU: A FINE IVORY NETSUKE 182 | FIVE IVORY NETSUKE OF FUKUROKUJU The second signed Yoshinobu, the third %\0DVDND]XVLJQHG0DVDND]X signed Tomotsugu, the fourth signed Japan, early 19th century, Edo period (1615-1868) Gessan, the fifth signed Tomonobu, the first unsigned Japan, 19th century A fine carving showing the lucky deity Fukurokuju with a large and smooth-shiny head, gleefully laughing. His robes are finely adorned, and the backside shows good himotoshi and an appealing patina. The underside with the MASAKAZU signature in a typical reserve. &RQVLVWLQJRID%LMLQZLWKDEDOODVKXQJD netsuke of a man paying a Geisha (with HEIGHT 5.5 cm visible genitals on the underside), a woman VFUXEELQJWKHIORRU%HQWHQZLWKER\DQG Condition: Good condition with expected wear and age cracks. Possibly some old minor rabbit and Hotei with boy. damage to the edge of his foot. 179 | A GROUP OF FOUR NEGORO Provenance: French-German private collection acquired in late 2000. LACQUER NETSUKE HEIGHT 2.9 – 4.5 cm 183 | FIVE WOOD NETSUKE Estimate EUR 1.200,- Condition: All in good condition with Unsigned The first signed Masamitsu Starting price EUR 600,- expected wear. Japan, 19th century, Edo period (1615-1868) Japan, 19th century 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- The first depicting a boy wearing a lion mask, The first depicting a Shojo dancing, signed Starting price EUR 400,- as is used for the traditional Chinese lion MASAMITSU, the second a yawning daruma dance known as Shishimai - when peeking with inlaid eyes, the third a meditating inside the mask one can see the boy´s face. Daruma, the fourth a boy holding a coin and The second depicting a Karako leaning on the fifth two skeletons wrestling on a lotus a bamboo basket, the third Daikoku, one of leaf. the Seven Lucky Gods of Japan, dragging a daikon radish. The fourth depicting a Shishi HEIGHT 3.5 – 4.7 cm sitting on a rectangular two-leveled base with four legs. Condition: The first with two chips and red stains, the second with a crack, missing an HEIGHT 2 - 3 cm eye inlay and with restored arms; the third and fourth in good worn condition and the Condition: Good age-related condition with fourth with a chip and crack to the lotus leaf. expected wear and discoloration to lacquer. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- Estimate EUR 900,- Starting price EUR 500,- Starting price EUR 450,- 184 | FIVE WOOD NETSUKE 180 | KIYOCHIKA: A STAG ANTLER NETSUKE OF A BOY WITH ONI MASK Unsigned Japan, 19th century Signed Kiyochika Japan, late 19th century, Meiji period (1868-1912) The first depicting Tenaga and Ashinaga, the second a repenting Oni, the third a Nicely carved and depicting a teasing boy hiding an oni mask behind his back, the hair is blind masseur working his skills on a seated accentuated with black ink, his expression is playful and his tongue movable. The mask clients’ shoulders, the fourth Daikoku and has inlaid eyes and the underside is signed KIYOCHIKA within a mother-of-pearl inlaid Ebisu and the fifth a temple servant washing cartouche. a bell. HEIGHT 4 cm HEIGHT 3.2 – 5.5 cm Condition: One finger is chipped, otherwise good condition. Condition: The first, third and fifth in good, Provenance: French-German private collection acquired in late 2000. 181 | FIVE WOOD NETSUKE, worn condition, the second with chipped TWO SIGNED feet and the fourth with red stains to base, 185 | A GROUP OF SIX BONE Estimate EUR 500,- otherwise good condition. AND STAG ANTLER NETSUKE Starting price EUR 250,- The second signed Shinzan, the fourth 3URYHQDQFH%ULWLVKFROOHFWLRQ signed ..Tei Unsigned Japan, 19th century to Meiji period (1868- Estimate EUR 1.000,- Japan, 18th to 19th century, Edo period 1912) Starting price EUR 500,- (1615-1868) The first depicting Hotei on an armchair, The first depicting an octopus on a pile the second Okame in a bathtub, signed of various leaves, the second the god of SHINZAN, the third Hotei with bag, the fourth longevity and scholarly success, Jurojin, the a fisherman wearing only a loincloth, which is third a candle, the fourth a recumbent ox, partly stuck in the hamaguri clam, trying his the fifth a fox (kitsune) as a monk, the sixth a best to break free, and the fifth a worker. dutchman and. HEIGHT 4 – 4.5 cm HEIGHT 2 – 8.5 cm Condition: Overall good condition, the first Condition: Good age-related condition with with a chip to the fan, the second and fifth natural ‘flaws’ in the material. The fifth with a with a crack. chip to the staff´s tip. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- Estimate EUR 600,- Starting price EUR 500,- Starting price EUR 300,- 62 63 178 | MASAKAZU: A FINE IVORY NETSUKE 182 | FIVE IVORY NETSUKE OF FUKUROKUJU The second signed Yoshinobu, the third %\0DVDND]XVLJQHG0DVDND]X signed Tomotsugu, the fourth signed Japan, early 19th century, Edo period (1615-1868) Gessan, the fifth signed Tomonobu, the first unsigned Japan, 19th century A fine carving showing the lucky deity Fukurokuju with a large and smooth-shiny head, gleefully laughing. His robes are finely adorned, and the backside shows good himotoshi and an appealing patina. The underside with the MASAKAZU signature in a typical reserve. &RQVLVWLQJRID%LMLQZLWKDEDOODVKXQJD netsuke of a man paying a Geisha (with HEIGHT 5.5 cm visible genitals on the underside), a woman VFUXEELQJWKHIORRU%HQWHQZLWKER\DQG Condition: Good condition with expected wear and age cracks. Possibly some old minor rabbit and Hotei with boy. damage to the edge of his foot. 179 | A GROUP OF FOUR NEGORO Provenance: French-German private collection acquired in late 2000. LACQUER NETSUKE HEIGHT 2.9 – 4.5 cm 183 | FIVE WOOD NETSUKE Estimate EUR 1.200,- Condition: All in good condition with Unsigned The first signed Masamitsu Starting price EUR 600,- expected wear. Japan, 19th century, Edo period (1615-1868) Japan, 19th century 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- The first depicting a boy wearing a lion mask, The first depicting a Shojo dancing, signed Starting price EUR 400,- as is used for the traditional Chinese lion MASAMITSU, the second a yawning daruma dance known as Shishimai - when peeking with inlaid eyes, the third a meditating inside the mask one can see the boy´s face. Daruma, the fourth a boy holding a coin and The second depicting a Karako leaning on the fifth two skeletons wrestling on a lotus a bamboo basket, the third Daikoku, one of leaf. the Seven Lucky Gods of Japan, dragging a daikon radish. The fourth depicting a Shishi HEIGHT 3.5 – 4.7 cm sitting on a rectangular two-leveled base with four legs. Condition: The first with two chips and red stains, the second with a crack, missing an HEIGHT 2 - 3 cm eye inlay and with restored arms; the third and fourth in good worn condition and the Condition: Good age-related condition with fourth with a chip and crack to the lotus leaf. expected wear and discoloration to lacquer. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- Estimate EUR 900,- Starting price EUR 500,- Starting price EUR 450,- 184 | FIVE WOOD NETSUKE 180 | KIYOCHIKA: A STAG ANTLER NETSUKE OF A BOY WITH ONI MASK Unsigned Japan, 19th century Signed Kiyochika Japan, late 19th century, Meiji period (1868-1912) The first depicting Tenaga and Ashinaga, the second a repenting Oni, the third a Nicely carved and depicting a teasing boy hiding an oni mask behind his back, the hair is blind masseur working his skills on a seated accentuated with black ink, his expression is playful and his tongue movable. The mask clients’ shoulders, the fourth Daikoku and has inlaid eyes and the underside is signed KIYOCHIKA within a mother-of-pearl inlaid Ebisu and the fifth a temple servant washing cartouche. a bell. HEIGHT 4 cm HEIGHT 3.2 – 5.5 cm Condition: One finger is chipped, otherwise good condition. Condition: The first, third and fifth in good, Provenance: French-German private collection acquired in late 2000. 181 | FIVE WOOD NETSUKE, worn condition, the second with chipped TWO SIGNED feet and the fourth with red stains to base, 185 | A GROUP OF SIX BONE Estimate EUR 500,- otherwise good condition. AND STAG ANTLER NETSUKE Starting price EUR 250,- The second signed Shinzan, the fourth 3URYHQDQFH%ULWLVKFROOHFWLRQ signed ..Tei Unsigned Japan, 19th century to Meiji period (1868- Estimate EUR 1.000,- Japan, 18th to 19th century, Edo period 1912) Starting price EUR 500,- (1615-1868) The first depicting Hotei on an armchair, The first depicting an octopus on a pile the second Okame in a bathtub, signed of various leaves, the second the god of SHINZAN, the third Hotei with bag, the fourth longevity and scholarly success, Jurojin, the a fisherman wearing only a loincloth, which is third a candle, the fourth a recumbent ox, partly stuck in the hamaguri clam, trying his the fifth a fox (kitsune) as a monk, the sixth a best to break free, and the fifth a worker. dutchman and. HEIGHT 4 – 4.5 cm HEIGHT 2 – 8.5 cm Condition: Overall good condition, the first Condition: Good age-related condition with with a chip to the fan, the second and fifth natural ‘flaws’ in the material. The fifth with a with a crack. chip to the staff´s tip. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- Estimate EUR 600,- Starting price EUR 500,- Starting price EUR 300,- 62 63 187 | A TALL IVORY 190 | TWO INLAID EBONY NETSUKE NETSUKE OF AFTER HASEGAWA IKKO CHOKARO SENNIN Unsigned, after Hasegawa Ikko Japan, early 19th century, Edo period (1615-1868) Unsigned Japan, 18th century, Edo period (1615-1868) Depicting two Chinese sages wearing a cloak carved from ebony, the second with the face, hands, feet and staff inlaid in ivory; the first inlaid in boxwood and ivory. Chokaro Sennin, recognizable by the HEIGHT 6.6 – 7.5 cm gigantic gourd attached to his back, is smiling and Condition: Good age-related condition, few chips and wear. The looking upwards to his first missing the staff. right and holding his very 3URYHQDQFH%ULWLVKFROOHFWLRQ large flowing beard in 186 | FIVE WOOD NETSUKE, ONE SIGNED his hand. He is wearing a Estimate EUR 800,- mugwort leaf cloak with Starting price EUR 400,- The second signed Dai Hyuga flowing folds. Himotoshi Japan, 19th century to Meiji period (1868-1912) in the backside. HEIGHT 8.8 cm The first a depiction of Okame washing herself, the second an ebony Sanbaso dancer, signed DAI HYUGA, the third a pressed horn netsuke of a Condition: The ivory street performer - ‘sneezer’ - who uses a stick to make himself sneeze, the slightly worn, minor age fourth netsuke of Jurojin, the lucky god, and a boy and the fifth showing a cracks, very attractive man applying moxa, with movable head. yellowish patina on the backside. 191 | AN EBONY WOOD NETSUKE HEIGHT 3.7 – 5.4 cm Provenance: The 40-Year OF TEKKAI SENNIN Collection of a London Condition: Overall good, worn condition with few surface scratches, the Gentleman. Unsigned second with a crack and a chip to one foot, the third with age cracks and the Japan, 19th century, Edo period (1615-1868) fourth with a restored foot. Estimate EUR 400,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Starting price EUR 200,- A finely crafted ebony wood netsuke of Tekkai Sennin leaning on a Estimate EUR 1.000,- cane and holding his beard. His facial features are expressive, with Starting price EUR 500,- a wide grin as he looks up into the heavenly skies towards Lao Zi. Well-carved garment folds of the mugwort leaf cloak and himotoshi 189 | MINKO: A through the back. TALL WOOD 188 | NAGAMICHI SHUZAN: NETSUKE HEIGHT 6.5 cm TWO POLYCHROME WOOD NETSUKE OF TEKKAI SENNIN Condition: Loss to the top of one foot. Signs of age and use, %\1DJDPLFKL6KX]DQWKHVHFRQGVLJQHG6KX]DQ otherwise in good condition. Japan, 19th century Signed Minko 3URYHQDQFH%ULWLVK&ROOHFWLRQ Japan, 18th century, Edo period (1615-1868) Estimate EUR 400,- One depicting Tobosaku Sennin and another depicting a Chinese official. Starting price EUR 200,- %RWKEHDULQJROGFROOHFWLRQODEHOVDQGWKHVHFRQGVLJQHG6+8=$1 Dynamically and boldly HEIGHT 5.5 cm carved as Tekkai Sennin with an amusing Condition: Good age-related condition, the second with a chip. expression, leaning on his 3URYHQDQFH%ULWLVKFROOHFWLRQ cane. One arm is swinging upwards and one foot is Estimate EUR 400,- raised. A hyotan is tied to 192 | AN IVORY NETSUKE OF GAMA Starting price EUR 200,- his obi. Good himotoshi, SENNIN WITH LARGE TOAD one cleverly placed in the opening of his sleeve. Unsigned The underside shows the Japan, 19th century, Edo period (1615-1868) signature MINKO. HEIGHT 8.1 cm A charming ivory netsuke depicting Gama Sennin, dressed in a mugwort leaf cloak and with a bag draped over his shoulder, Condition: Very good holding a large toad by the ‘hand’. The bulky toad with huge inlaid age-related condition. eyes of dark horn has a slightly dumbfounded expression, while the Appealing patina, minor Sennin is gleefully smiling. Himotoshi through the back. surface wear, remnants of black lacquer. HEIGHT 4.2 cm Provenance: Sold at %RQKDPV)LQH-DSDQHVH Condition: The sleeve of the Sennin with a chip, otherwise good Works of Art, 19 March condition. 2013, New York, lot 2182. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 300,- Starting price EUR 300,- Starting price EUR 150,- 64 65 187 | A TALL IVORY 190 | TWO INLAID EBONY NETSUKE NETSUKE OF AFTER HASEGAWA IKKO CHOKARO SENNIN Unsigned, after Hasegawa Ikko Japan, early 19th century, Edo period (1615-1868) Unsigned Japan, 18th century, Edo period (1615-1868) Depicting two Chinese sages wearing a cloak carved from ebony, the second with the face, hands, feet and staff inlaid in ivory; the first inlaid in boxwood and ivory. Chokaro Sennin, recognizable by the HEIGHT 6.6 – 7.5 cm gigantic gourd attached to his back, is smiling and Condition: Good age-related condition, few chips and wear. The looking upwards to his first missing the staff. right and holding his very 3URYHQDQFH%ULWLVKFROOHFWLRQ large flowing beard in 186 | FIVE WOOD NETSUKE, ONE SIGNED his hand. He is wearing a Estimate EUR 800,- mugwort leaf cloak with Starting price EUR 400,- The second signed Dai Hyuga flowing folds. Himotoshi Japan, 19th century to Meiji period (1868-1912) in the backside. HEIGHT 8.8 cm The first a depiction of Okame washing herself, the second an ebony Sanbaso dancer, signed DAI HYUGA, the third a pressed horn netsuke of a Condition: The ivory street performer - ‘sneezer’ - who uses a stick to make himself sneeze, the slightly worn, minor age fourth netsuke of Jurojin, the lucky god, and a boy and the fifth showing a cracks, very attractive man applying moxa, with movable head. yellowish patina on the backside. 191 | AN EBONY WOOD NETSUKE HEIGHT 3.7 – 5.4 cm Provenance: The 40-Year OF TEKKAI SENNIN Collection of a London Condition: Overall good, worn condition with few surface scratches, the Gentleman. Unsigned second with a crack and a chip to one foot, the third with age cracks and the Japan, 19th century, Edo period (1615-1868) fourth with a restored foot. Estimate EUR 400,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Starting price EUR 200,- A finely crafted ebony wood netsuke of Tekkai Sennin leaning on a Estimate EUR 1.000,- cane and holding his beard. His facial features are expressive, with Starting price EUR 500,- a wide grin as he looks up into the heavenly skies towards Lao Zi. Well-carved garment folds of the mugwort leaf cloak and himotoshi 189 | MINKO: A through the back. TALL WOOD 188 | NAGAMICHI SHUZAN: NETSUKE HEIGHT 6.5 cm TWO POLYCHROME WOOD NETSUKE OF TEKKAI SENNIN Condition: Loss to the top of one foot. Signs of age and use, %\1DJDPLFKL6KX]DQWKHVHFRQGVLJQHG6KX]DQ otherwise in good condition. Japan, 19th century Signed Minko 3URYHQDQFH%ULWLVK&ROOHFWLRQ Japan, 18th century, Edo period (1615-1868) Estimate EUR 400,- One depicting Tobosaku Sennin and another depicting a Chinese official. Starting price EUR 200,- %RWKEHDULQJROGFROOHFWLRQODEHOVDQGWKHVHFRQGVLJQHG6+8=$1 Dynamically and boldly HEIGHT 5.5 cm carved as Tekkai Sennin with an amusing Condition: Good age-related condition, the second with a chip. expression, leaning on his 3URYHQDQFH%ULWLVKFROOHFWLRQ cane. One arm is swinging upwards and one foot is Estimate EUR 400,- raised. A hyotan is tied to 192 | AN IVORY NETSUKE OF GAMA Starting price EUR 200,- his obi. Good himotoshi, SENNIN WITH LARGE TOAD one cleverly placed in the opening of his sleeve. Unsigned The underside shows the Japan, 19th century, Edo period (1615-1868) signature MINKO. HEIGHT 8.1 cm A charming ivory netsuke depicting Gama Sennin, dressed in a mugwort leaf cloak and with a bag draped over his shoulder, Condition: Very good holding a large toad by the ‘hand’. The bulky toad with huge inlaid age-related condition. eyes of dark horn has a slightly dumbfounded expression, while the Appealing patina, minor Sennin is gleefully smiling. Himotoshi through the back. surface wear, remnants of black lacquer. HEIGHT 4.2 cm Provenance: Sold at %RQKDPV)LQH-DSDQHVH Condition: The sleeve of the Sennin with a chip, otherwise good Works of Art, 19 March condition. 2013, New York, lot 2182. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 300,- Starting price EUR 300,- Starting price EUR 150,- 64 65 198 | A GOOD IVORY NETSUKE OF CHINNAN SENNIN Unsigned Japan, early 19th century, Edo period (1615-1868) Chinnan Sennin is shown wearing a mugwort leaf cloak with long flowing robes, clenching one fist next to his cheek and holding a vessel up high with his other hand. He uses this vessel to conjure 197 | KOHOSAI: A FINE IVORY NETSUKE OF A a dragon, which is about to emerge from the vessel with all 193 | AN IVORY NETSUKE OF CALLIGRAPHIST its might. The Sennin is visibly A CHINESE SAGE %\8HGD.RKRVDLVLJQHG.RKRVDL excited with wide-opened eyes and mouth. Good, irregular and Unsigned 194 | MASAMORI: AN IVORY NETSUKE OF Japan, Osaka, late 19th century, Meiji period (1868-1912) large himotoshi on the backside. Japan, 18th century, Edo period (1615-1868) GAMMA SENNIN HEIGHT 9 cm %\0DVDPRULVLJQHG0DVDPRUL Very finely carved and beautifully stained, depicting a A man standing on a large, rectangular, decoratively executed base, with Japan, early 19th century, Edo period (1615-1868) calligraphist, his finely carved bony fingers holding a quill with an Condition: Good condition. his right hand on his right ear to hear better, his facial expression also amusingly pensive expression. Extraordinarily detailed flowing The stained ivory is worn with showing heightened attentiveness. He is wearing a Chinese garment robes with the natural himotoshi cleverly hidden in a fold. The some age cracks, minor areas and a Daoist cap on his head; he could be one of the Seven Sages of the Kyoto/Yoshi School. A classical representation of Gama underside with the signature KOHOSAI. of soiling around the left side of %DPERR*URYHQDPHO\.HLNRZKRLVGHSLFWHGZLWKWKLVKDQGSRVLWLRQ7KH Sennin standing, a three-legged toad over his right the face and in the crevices near large pedestal beside him, possibly a box, is decorated with a landscape shoulder and holding a blooming peach branch. Good HEIGHT 4 cm the vessel. and plants. Himotoshi in the sage’s back. patina and signature MASAMORI. Condition: One plugged nerve channel at the back of the head, Provenance: The 40-Year Collection of a London HEIGHT 5 cm HEIGHT 7.2 cm very minor discoloration of ivory, generally in very good condition. Provenance: The 40-Year Collection of a London Gentleman. Gentleman. Condition: Good condition with an attractive patina; age cracks. Condition: Good worn condition with expected age Estimate EUR 400,- Provenance: The 40-Year Collection of a London Gentleman. cracks. Estimate EUR 600,- Starting price EUR 200,- Provenance: French-German private collection acquired Starting price EUR 300,- Estimate EUR 500,- in late 2000s. Starting price EUR 250,- Estimate EUR 1.200,- Starting price EUR 600,- 199 | AN EARLY IVORY NETSUKE DEPICTING A 200 | A RARE IVORY 195 | FIVE WOOD NETSUKE, CHINESE SAGE ON A DECORATED BASE NETSUKE OF A TWO SIGNED SENNIN WITH 196 | AN IVORY NETSUKE OF GAMA SENNIN Unsigned MONKEY The first signed Jissai, the third signed Ryumin Japan, early to mid-18th century, Edo period (1615-1868) Japan, 19th century Unsigned Unsigned Japan, Meiji period (1868-1912) Japan, early to mid-18th century, An early ivory netsuke of a Chinese sage wearing a cap, gently Edo period (1615-1868) The first depicting a blind stone lifter, signed JISSAI, the second a Sennin smiling and leaning on a Chinese table, his robe incised with with gourd, the third depicting three carpenters - one is movable, signed A skillfully carved netsuke of Gama Sennin carrying a scrolling vines. The entire composition is set on a large and thick RYUMIN, the fourth a meditating Hotei and the fifth a street vendor with huge toad on his back. Well-achieved expressions and hexagonal base with incised floral and wave motifs. Very large A slender and rather tall ivory kid. good movement. and hollowed out himotoshi through the underside and back. netsuke of a Sennin holding a monkey (saru). The monkey is HEIGHT 3 – 8.5 cm HEIGHT 4.2 cm HEIGHT 4.1 cm small and tugging on the beard of the Sennin, who is wearing Condition: The first, second and fourth with a tiny chip, otherwise good Condition: Good condition. Condition: Good condition with age-related wear and very the characteristic mugwort worn condition. Provenance: French German private collection acquired appealing patina, as well as expected age cracks. leafcloak, adorned with swirling 3URYHQDQFH%ULWLVKFROOHFWLRQ in late 2000s. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ clouds. He is holding a taming stick in his left hand. Probably Estimate EUR 1.000,- Estimate EUR 600,- Estimate EUR 400,- he is the precursor to the Starting price EUR 500,- Starting price EUR 300,- Starting price EUR 200,- peddling sarumawashi (monkey trainer). The ivory has taken on a beautiful golden honey patina over many years of handling. Very good himotoshi in the back. HEIGHT 8.3 cm Condition: Very good condition, expected minor age cracks. Provenance: French private collection. Estimate EUR 800,- Starting price EUR 400,- 66 67 198 | A GOOD IVORY NETSUKE OF CHINNAN SENNIN Unsigned Japan, early 19th century, Edo period (1615-1868) Chinnan Sennin is shown wearing a mugwort leaf cloak with long flowing robes, clenching one fist next to his cheek and holding a vessel up high with his other hand. He uses this vessel to conjure 197 | KOHOSAI: A FINE IVORY NETSUKE OF A a dragon, which is about to emerge from the vessel with all 193 | AN IVORY NETSUKE OF CALLIGRAPHIST its might. The Sennin is visibly A CHINESE SAGE %\8HGD.RKRVDLVLJQHG.RKRVDL excited with wide-opened eyes and mouth. Good, irregular and Unsigned 194 | MASAMORI: AN IVORY NETSUKE OF Japan, Osaka, late 19th century, Meiji period (1868-1912) large himotoshi on the backside. Japan, 18th century, Edo period (1615-1868) GAMMA SENNIN HEIGHT 9 cm %\0DVDPRULVLJQHG0DVDPRUL Very finely carved and beautifully stained, depicting a A man standing on a large, rectangular, decoratively executed base, with Japan, early 19th century, Edo period (1615-1868) calligraphist, his finely carved bony fingers holding a quill with an Condition: Good condition. his right hand on his right ear to hear better, his facial expression also amusingly pensive expression. Extraordinarily detailed flowing The stained ivory is worn with showing heightened attentiveness. He is wearing a Chinese garment robes with the natural himotoshi cleverly hidden in a fold. The some age cracks, minor areas and a Daoist cap on his head; he could be one of the Seven Sages of the Kyoto/Yoshi School. A classical representation of Gama underside with the signature KOHOSAI. of soiling around the left side of %DPERR*URYHQDPHO\.HLNRZKRLVGHSLFWHGZLWKWKLVKDQGSRVLWLRQ7KH Sennin standing, a three-legged toad over his right the face and in the crevices near large pedestal beside him, possibly a box, is decorated with a landscape shoulder and holding a blooming peach branch. Good HEIGHT 4 cm the vessel. and plants. Himotoshi in the sage’s back. patina and signature MASAMORI. Condition: One plugged nerve channel at the back of the head, Provenance: The 40-Year Collection of a London HEIGHT 5 cm HEIGHT 7.2 cm very minor discoloration of ivory, generally in very good condition. Provenance: The 40-Year Collection of a London Gentleman. Gentleman. Condition: Good condition with an attractive patina; age cracks. Condition: Good worn condition with expected age Estimate EUR 400,- Provenance: The 40-Year Collection of a London Gentleman. cracks. Estimate EUR 600,- Starting price EUR 200,- Provenance: French-German private collection acquired Starting price EUR 300,- Estimate EUR 500,- in late 2000s. Starting price EUR 250,- Estimate EUR 1.200,- Starting price EUR 600,- 199 | AN EARLY IVORY NETSUKE DEPICTING A 200 | A RARE IVORY 195 | FIVE WOOD NETSUKE, CHINESE SAGE ON A DECORATED BASE NETSUKE OF A TWO SIGNED SENNIN WITH 196 | AN IVORY NETSUKE OF GAMA SENNIN Unsigned MONKEY The first signed Jissai, the third signed Ryumin Japan, early to mid-18th century, Edo period (1615-1868) Japan, 19th century Unsigned Unsigned Japan, Meiji period (1868-1912) Japan, early to mid-18th century, An early ivory netsuke of a Chinese sage wearing a cap, gently Edo period (1615-1868) The first depicting a blind stone lifter, signed JISSAI, the second a Sennin smiling and leaning on a Chinese table, his robe incised with with gourd, the third depicting three carpenters - one is movable, signed A skillfully carved netsuke of Gama Sennin carrying a scrolling vines. The entire composition is set on a large and thick RYUMIN, the fourth a meditating Hotei and the fifth a street vendor with huge toad on his back. Well-achieved expressions and hexagonal base with incised floral and wave motifs. Very large A slender and rather tall ivory kid. good movement. and hollowed out himotoshi through the underside and back. netsuke of a Sennin holding a monkey (saru). The monkey is HEIGHT 3 – 8.5 cm HEIGHT 4.2 cm HEIGHT 4.1 cm small and tugging on the beard of the Sennin, who is wearing Condition: The first, second and fourth with a tiny chip, otherwise good Condition: Good condition. Condition: Good condition with age-related wear and very the characteristic mugwort worn condition. Provenance: French German private collection acquired appealing patina, as well as expected age cracks. leafcloak, adorned with swirling 3URYHQDQFH%ULWLVKFROOHFWLRQ in late 2000s. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ clouds. He is holding a taming stick in his left hand. Probably Estimate EUR 1.000,- Estimate EUR 600,- Estimate EUR 400,- he is the precursor to the Starting price EUR 500,- Starting price EUR 300,- Starting price EUR 200,- peddling sarumawashi (monkey trainer). The ivory has taken on a beautiful golden honey patina over many years of handling. Very good himotoshi in the back. HEIGHT 8.3 cm Condition: Very good condition, expected minor age cracks. Provenance: French private collection. Estimate EUR 800,- Starting price EUR 400,- 66 67 202 | DERKACHENKO: OKAME WITH TENGU 205 | HOGEN: A FINE WOOD NETSUKE MASK MAMMOTH IVORY NETSUKE OF A YAWNING OKAME %\$OH[DQGHU'HUNDFKHQNRVLJQHG'HUNDFKHQNR Signed Hogen Ukraine, 2018 Japan, 19th century, Edo period (1615-1868) Alexander Derkachenko’s vision of the famous subject “Okame Exquisitely carved as Okame, also known as Otafuku, kneeling with Tengu mask”. Carved from colored mammoth ivory with bare-chested with her supple, delicately carved breasts shown. heavy shunga undertones – a playful and fun Okame. She is yawning and stretching her arms up high – in the manner of Daruma during his nine-year meditation – therefore this depiction HEIGHT 5.2 cm is also referred to as Onna Daruma (“Woman Daruma”), which is also slang for a courtesan. Her features are delicate and sensitive. Condition: Excellent condition. Himotoshi through the back and signature HOGEN, which is an honorary title. Estimate EUR 1.200,- Starting price EUR 600,- HEIGHT 4.6 cm 201 | TWO IVORY NETSUKE, ONE SIGNED Condition: Excellent patina. Minor surface wear, notably on the right foot. Very good condition. One signed Tomonaga, the other one signed 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Japan, Meiji period (1868-1912) Estimate EUR 400,- Starting price EUR 200,- This lot consists of two ivory netsuke, one depicting Okame brushing her hair, while an oni sneaks out of her loincloth, signed. The other one shows the scene of Kanshin forced to crawl away 206 | KEIMIN: AN IVORY AND LACQUER NETSUKE between the legs of two brigands, signed TOMONAGA. Himotoshi OF OKAME WITH A SAKE CUP through the back. %\.HLPLQVLJQHG.HLPLQ HEIGHT of each netsuke c. 4.3 cm Japan, late 19th century, Meiji period (1868-1912) Condition: The netsuke of the Kanshin scene with a worn patina and a crack through the arm of one of the brigands and thin age The large head of Okame is carved separately and inserted into cracks. The other netsuke with a worn patina and a chip to one the body. The hair is black lacquer and her hairpin is inlaid with red foot of the oni. coral. Her garments show ribbons and floral decorations in fine Provenance: Old Zagreb private collection. gold takamaki-e. The legs are bare, she is kneeling on the ground and holding a small cup with sake, the swirling liquid inlaid in pale Estimate EUR 600,- horn, in front of her. The good and irregular himotoshi are in a Starting price EUR 300,- somewhat naughty place next to the signature KEIMIN. HEIGHT 3.8 cm 203 | A RARE HIDA SCHOOL ITTOBORI SHUNGA NETSUKE Condition: Good condition, one crack through the back and possibly a small loss or an imperfection to the top of the hair. Unsigned 204 | A RARE IVORY NETSUKE OF OKAME 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Japan, 19th century, Edo period (1615-1868) ON A PILLOW Estimate EUR 300,- Unsigned Starting price EUR 150,- Depicting a mother nursing a young child, carved from wood Japan, 19th century, Edo period (1615-1868) and using the ittobori technique (using one knife). The underside shows the shunga-aspect of this netsuke. Himotoshi through the back. The Shinto goddess Okame is lying on top of a large pillow, armed with a knife. She is cheekily smiling, and her robes are HEIGHT 3.7 cm ornately decorated. Large himotoshi and beautiful honey patina on the underside. Condition: Excellent condition with minor expected surface wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 2.1 cm, LENGTH 3.5 cm 207 | A WOOD NETSUKE OF A LADY WITH BOOK AND UMBRELLA Estimate EUR 300,- Condition: Expected age cracks, the ivory slightly worn, very good Starting price EUR 150,- patina. Japan, 1st half of 19th century, Edo period (1615-1868) 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,- The courtly robe, noble features and book indicate that this netsuke Starting price EUR 150,- possibly depicts the waka poet Ono no Komachi, who lived in the 9th century and is the best-known among the Rokkasen, the six greatest waka poets of the early Heian period, who was a figure surrounded by legends. Powerful patina, himotoshi on the reverse. HEIGHT 6.1 cm Condition: Excellent condition with good patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,- Starting price EUR 150,- 68 69 202 | DERKACHENKO: OKAME WITH TENGU 205 | HOGEN: A FINE WOOD NETSUKE MASK MAMMOTH IVORY NETSUKE OF A YAWNING OKAME %\$OH[DQGHU'HUNDFKHQNRVLJQHG'HUNDFKHQNR Signed Hogen Ukraine, 2018 Japan, 19th century, Edo period (1615-1868) Alexander Derkachenko’s vision of the famous subject “Okame Exquisitely carved as Okame, also known as Otafuku, kneeling with Tengu mask”. Carved from colored mammoth ivory with bare-chested with her supple, delicately carved breasts shown. heavy shunga undertones – a playful and fun Okame. She is yawning and stretching her arms up high – in the manner of Daruma during his nine-year meditation – therefore this depiction HEIGHT 5.2 cm is also referred to as Onna Daruma (“Woman Daruma”), which is also slang for a courtesan. Her features are delicate and sensitive. Condition: Excellent condition. Himotoshi through the back and signature HOGEN, which is an honorary title. Estimate EUR 1.200,- Starting price EUR 600,- HEIGHT 4.6 cm 201 | TWO IVORY NETSUKE, ONE SIGNED Condition: Excellent patina. Minor surface wear, notably on the right foot. Very good condition. One signed Tomonaga, the other one signed 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Japan, Meiji period (1868-1912) Estimate EUR 400,- Starting price EUR 200,- This lot consists of two ivory netsuke, one depicting Okame brushing her hair, while an oni sneaks out of her loincloth, signed. The other one shows the scene of Kanshin forced to crawl away 206 | KEIMIN: AN IVORY AND LACQUER NETSUKE between the legs of two brigands, signed TOMONAGA. Himotoshi OF OKAME WITH A SAKE CUP through the back. %\.HLPLQVLJQHG.HLPLQ HEIGHT of each netsuke c. 4.3 cm Japan, late 19th century, Meiji period (1868-1912) Condition: The netsuke of the Kanshin scene with a worn patina and a crack through the arm of one of the brigands and thin age The large head of Okame is carved separately and inserted into cracks. The other netsuke with a worn patina and a chip to one the body. The hair is black lacquer and her hairpin is inlaid with red foot of the oni. coral. Her garments show ribbons and floral decorations in fine Provenance: Old Zagreb private collection. gold takamaki-e. The legs are bare, she is kneeling on the ground and holding a small cup with sake, the swirling liquid inlaid in pale Estimate EUR 600,- horn, in front of her. The good and irregular himotoshi are in a Starting price EUR 300,- somewhat naughty place next to the signature KEIMIN. HEIGHT 3.8 cm 203 | A RARE HIDA SCHOOL ITTOBORI SHUNGA NETSUKE Condition: Good condition, one crack through the back and possibly a small loss or an imperfection to the top of the hair. Unsigned 204 | A RARE IVORY NETSUKE OF OKAME 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Japan, 19th century, Edo period (1615-1868) ON A PILLOW Estimate EUR 300,- Unsigned Starting price EUR 150,- Depicting a mother nursing a young child, carved from wood Japan, 19th century, Edo period (1615-1868) and using the ittobori technique (using one knife). The underside shows the shunga-aspect of this netsuke. Himotoshi through the back. The Shinto goddess Okame is lying on top of a large pillow, armed with a knife. She is cheekily smiling, and her robes are HEIGHT 3.7 cm ornately decorated. Large himotoshi and beautiful honey patina on the underside. Condition: Excellent condition with minor expected surface wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 2.1 cm, LENGTH 3.5 cm 207 | A WOOD NETSUKE OF A LADY WITH BOOK AND UMBRELLA Estimate EUR 300,- Condition: Expected age cracks, the ivory slightly worn, very good Starting price EUR 150,- patina. Japan, 1st half of 19th century, Edo period (1615-1868) 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,- The courtly robe, noble features and book indicate that this netsuke Starting price EUR 150,- possibly depicts the waka poet Ono no Komachi, who lived in the 9th century and is the best-known among the Rokkasen, the six greatest waka poets of the early Heian period, who was a figure surrounded by legends. Powerful patina, himotoshi on the reverse. HEIGHT 6.1 cm Condition: Excellent condition with good patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,- Starting price EUR 150,- 68 69 208 | A POWERFUL 209 | A FINE WOOD 212 | A WOOD NETSUKE OF KIKUJIDO AND LARGE NETSUKE OF BONE KAN’U Unsigned NETSUKE OF Japan, 18th century, Edo period (1615-1868) KAN’U Unsigned Japan, 19th century, Unsigned Edo period (1615-1868) Carved as the chrysanthemum boy seated on a dense bundle of Japan, 18th century, kiku (chrysanthemum) blossoms, appearing like a cloud, on which Edo period (1615-1868) he floats. Draped over his shoulder is a blossoming kiku branch, Depicting the god of war DSSHDULQJOLNHD%XGGKLVWQ\RLVFHSWHU+HLVELWLQJKLVWHHWKDQG Kan’u standing proudly his glaring eyes are inlaid with dark horn. A compact, functional An exceptional netsuke with a slightly arched netsuke with large, hollow himotoshi – the smaller one cleverly depicting the god of war back, stroking his beard hidden behind one kiku flower. Kan’U. The patina is a and holding his halberd striking, glossy honey behind his back. Good HEIGHT 5.5 cm color. The god of war is himotoshi. stroking his beard whilst Condition: Excellent worn condition, the himotoshi show wear maintaining a fierce HEIGHT 6.1 cm showing this netsuke was worn. expression, his eyes Provenance: Formerly Helen and Jack Mang collection, then inlaid. The other hand Condition: Very good Luxembourg private collection acquired at Quinn’s auction galleries, holds his characteristic condition with minor 7 December 2012, lot 553. halberd. Large himotoshi associated wear. through the back. 3URYHQDQFH%ULWLVK Estimate EUR 600,- collection. Starting price EUR 300,- HEIGHT 12.5 cm Estimate EUR 600,- Condition: Excellent age- Starting price EUR 300,- related condition with a stunning patina. 3URYHQDQFH%ULWLVK collection. 213 | A WOOD NETSUKE OF DARUMA Estimate EUR 2.000,- Starting price EUR 1.000,- Japan, late 19th century, Meiji period (1868-1912) $ZHOOURXQGHGbQHWVXNHRID'DUXPDWKHILUVWSDWULDUFKRI=HQ %XGGKLVPKHUHZLWKVPDOOH\HVVWXEEOHGEHDUGDQGVFUHDPLQJLQ agony. HEIGHT 4 cm Condition: Good condition. Provenance: European private collection. Estimate EUR 700,- Starting price EUR 350,- 210 | A BOXWOOD 211 | TOYO: A NETSUKE OF RARE WOOD KAN’U NETSUKE OF AMATERASU Unsigned Japan, early 19th century, Signed Toyo Edo period (1615-1868) Japan, 19th century, 214 | HOZAN: A WOOD NETSUKE Edo period (1615-1868) OF A PUMPKIN DARUMA The god of war standing %\+R]DQVLJQHG+R]DQ and holding a halberd in The sun-goddess is Japan, 19th century, Edo period (1615-1868) one hand and clutching depicted standing and his beard with the other. wearing flowing robes A wood netsuke of daruma yawning and stretching after his nine- %HDXWLIXOO\FDUYHGUREH with wide sleeves. The and fine, differently sized back is flattened and year meditation, also known as Menpeki Kunen. Amusingly, his himotoshi to the back. shows the himotoshi and body is in the shape of a pumpkin – a popular caricaturistic motif signature TOYO. in netsuke art. Daruma’s expression is finely carved with minutely HEIGHT 7.7 cm inlaid eyes. The underside with an offset base and signature in a HEIGHT 6.7 cm wavy reserve HOZAN. Irregular himotoshi in the backside. Condition: A chip to the hat tip and cheek, Condition: Very good HEIGHT 5.2 cm otherwise good condition. worn condition. Provenance: European Provenance: European Condition: Very good condition. private collection. private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 500,- Estimate EUR 400,- Estimate EUR 600,- Starting price EUR 250,- Starting price EUR 200,- Starting price EUR 300,- 70 71 208 | A POWERFUL 209 | A FINE WOOD 212 | A WOOD NETSUKE OF KIKUJIDO AND LARGE NETSUKE OF BONE KAN’U Unsigned NETSUKE OF Japan, 18th century, Edo period (1615-1868) KAN’U Unsigned Japan, 19th century, Unsigned Edo period (1615-1868) Carved as the chrysanthemum boy seated on a dense bundle of Japan, 18th century, kiku (chrysanthemum) blossoms, appearing like a cloud, on which Edo period (1615-1868) he floats. Draped over his shoulder is a blossoming kiku branch, Depicting the god of war DSSHDULQJOLNHD%XGGKLVWQ\RLVFHSWHU+HLVELWLQJKLVWHHWKDQG Kan’u standing proudly his glaring eyes are inlaid with dark horn. A compact, functional An exceptional netsuke with a slightly arched netsuke with large, hollow himotoshi – the smaller one cleverly depicting the god of war back, stroking his beard hidden behind one kiku flower. Kan’U. The patina is a and holding his halberd striking, glossy honey behind his back. Good HEIGHT 5.5 cm color. The god of war is himotoshi. stroking his beard whilst Condition: Excellent worn condition, the himotoshi show wear maintaining a fierce HEIGHT 6.1 cm showing this netsuke was worn. expression, his eyes Provenance: Formerly Helen and Jack Mang collection, then inlaid. The other hand Condition: Very good Luxembourg private collection acquired at Quinn’s auction galleries, holds his characteristic condition with minor 7 December 2012, lot 553. halberd. Large himotoshi associated wear. through the back. 3URYHQDQFH%ULWLVK Estimate EUR 600,- collection. Starting price EUR 300,- HEIGHT 12.5 cm Estimate EUR 600,- Condition: Excellent age- Starting price EUR 300,- related condition with a stunning patina. 3URYHQDQFH%ULWLVK collection. 213 | A WOOD NETSUKE OF DARUMA Estimate EUR 2.000,- Starting price EUR 1.000,- Japan, late 19th century, Meiji period (1868-1912) $ZHOOURXQGHGbQHWVXNHRID'DUXPDWKHILUVWSDWULDUFKRI=HQ %XGGKLVPKHUHZLWKVPDOOH\HVVWXEEOHGEHDUGDQGVFUHDPLQJLQ agony. HEIGHT 4 cm Condition: Good condition. Provenance: European private collection. Estimate EUR 700,- Starting price EUR 350,- 210 | A BOXWOOD 211 | TOYO: A NETSUKE OF RARE WOOD KAN’U NETSUKE OF AMATERASU Unsigned Japan, early 19th century, Signed Toyo Edo period (1615-1868) Japan, 19th century, 214 | HOZAN: A WOOD NETSUKE Edo period (1615-1868) OF A PUMPKIN DARUMA The god of war standing %\+R]DQVLJQHG+R]DQ and holding a halberd in The sun-goddess is Japan, 19th century, Edo period (1615-1868) one hand and clutching depicted standing and his beard with the other. wearing flowing robes A wood netsuke of daruma yawning and stretching after his nine- %HDXWLIXOO\FDUYHGUREH with wide sleeves. The and fine, differently sized back is flattened and year meditation, also known as Menpeki Kunen. Amusingly, his himotoshi to the back. shows the himotoshi and body is in the shape of a pumpkin – a popular caricaturistic motif signature TOYO. in netsuke art. Daruma’s expression is finely carved with minutely HEIGHT 7.7 cm inlaid eyes. The underside with an offset base and signature in a HEIGHT 6.7 cm wavy reserve HOZAN. Irregular himotoshi in the backside. Condition: A chip to the hat tip and cheek, Condition: Very good HEIGHT 5.2 cm otherwise good condition. worn condition. Provenance: European Provenance: European Condition: Very good condition. private collection. private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 500,- Estimate EUR 400,- Estimate EUR 600,- Starting price EUR 250,- Starting price EUR 200,- Starting price EUR 300,- 70 71 219 | A MINUTELY CARVED IVORY NETSUKE OF ONI, KAPPA AND MONK SIGNED TENMIN Signed Tenmin Japan, 19th century, Edo period (1615-1868) An unusual ivory netsuke, minutely carved and depicting an amusing scene of an oni trying to lift the tea-kettle shell off a kappa, next to a gesticulating monk. The details of this small and fragile carving are incredibly precise. All set on a stippled and thin base. Singular himotoshi on the underside as well as the signature TENMIN in a jar shaped reserve. HEIGHT 2.6 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 220 | AN AMUSING IVORY NETSUKE OF SHOKI AND ONI 215 | FIVE WOOD NETSUKE, TWO SIGNED 216 | AN OLD IVORY NETSUKE OF AN Estimate EUR 400,- ONI Starting price EUR 200,- The second signed Tomichi, the third signed Somin Unsigned Japan, 19th century Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 17th century, Edo period (1615-1868) The first depicting a rat catcher with a rat on his back, both with inlaid eyes, A fine and amusing ivory netsuke of the demon hunter Shoki, the second Shoki with a bag full of oni, signed TOMICHI, the third a boy with a This old and worn ivory netsuke shows an oni seated with drawn ken-sword, pulling an elusive oni by the hand which Shishi mask, signed SOMIN, the fourth an eggplant and the fifth a Shishi with on a rock. Good himotoshi through the back and the is hiding on top of Shoki’s wide-brimmed hat. Himotoshi through ball. base. Stunning patina. the back. HEIGHT 2 – 4.5 cm HEIGHT 4.5 cm HEIGHT 6.4 cm Condition: Overall good worn condition, the first with a microscopic chip and Condition: Signs of age and wear. Deep honey- Condition: Excellent condition, the ivory bearing a fine yellowish the fifth with chips to mouth and paw. colored patina; age cracks and chipping. patina. 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Old Zagreb private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 1.000,- Estimate EUR 700,- Estimate EUR 400,- Starting price EUR 500,- Starting price EUR 350,- Starting price EUR 200,- 217 | THREE IVORY NETSUKE 218 | AN IVORY NETSUKE OF AN ONI 221 | TOMOCHIKA: AN IVORY NETSUKE WITH THE HAND OF RASHOMON OF A DEMON WITH ATTENDANT The third signed Hidekazu, the others unsigned AND ONI IN A BOAT Japan, late 18th to 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) %\&KLNX\RVDL7RPRFKLNDVLJQHG7RPRFKLND Japan, early 19th century, Edo period (1615-1868) Consisting of Kiyohime with the bell of Dojo-ji, a Rakan seated on a rock, and Raijin banging a large drum amongst clouds, the sides of the drum inlaid with A weeping oni, with one clawed hand over his face horn buttons; signed HIDEKAZU. and the other holding a rosary, is lamenting the 'HSLFWHGLVDGHPRQZLWKDIHPDOHSRVVLEO\%HQWHQSRXULQJ severed hand of the demon Rashomon. The world sake into the sakazuki he is holding - accordingly he has a slightly HEIGHT 2.9 – 4.1 cm of demons went into deep despair after Watanabe GUXQNHQH[SUHVVLRQ%HKLQGWKHPLVDQRQLZKRLVJOHHIXOO\ no Tsuna severed Rashomon’s arm in the year 976. rowing the boat. Finely carved waves on the sides. Himotoshi and Condition: All in very good condition with the ivory slightly worn and minor This event is parodied in netsuke art, as really it was signature TOMOCHIKA on the underside. age cracks. only a ‘drop in the ocean’. The demon’s muscular 3URYHQDQFH%ULWLVKFROOHFWLRQ arm is clenched into a fist, showing its might. Small LENGTH 5 cm himotoshi through one of the buttocks of the oni. Estimate EUR 600,- Condition: Minor age-related wear and a crack through the Starting price EUR 300,- HEIGHT 3 cm underside. Generally, in good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: The rosary is chipped, one minor age 222 | TOMOCHIKA: SMALL IVORY NETSUKE crack, fine yellowish patina to the backside. Estimate EUR 400,- OF TRAVELERS IN A BOAT Starting price EUR 200,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Signed Tomochika Estimate EUR 400,- Japan, Meiji period (1868-1912) Starting price EUR 200,- Depicted is a group of travelers on a boat with finely carved waves on the sides. Himotoshi and signature TOMOCHIKA on the underside. LENGHT 4.5 cm Condition: Very good condition with only a small chip to base. Provenance: European private collection. Estimate EUR 400,- Starting price EUR 200,- 72 73 219 | A MINUTELY CARVED IVORY NETSUKE OF ONI, KAPPA AND MONK SIGNED TENMIN Signed Tenmin Japan, 19th century, Edo period (1615-1868) An unusual ivory netsuke, minutely carved and depicting an amusing scene of an oni trying to lift the tea-kettle shell off a kappa, next to a gesticulating monk. The details of this small and fragile carving are incredibly precise. All set on a stippled and thin base. Singular himotoshi on the underside as well as the signature TENMIN in a jar shaped reserve. HEIGHT 2.6 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 220 | AN AMUSING IVORY NETSUKE OF SHOKI AND ONI 215 | FIVE WOOD NETSUKE, TWO SIGNED 216 | AN OLD IVORY NETSUKE OF AN Estimate EUR 400,- ONI Starting price EUR 200,- The second signed Tomichi, the third signed Somin Unsigned Japan, 19th century Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 17th century, Edo period (1615-1868) The first depicting a rat catcher with a rat on his back, both with inlaid eyes, A fine and amusing ivory netsuke of the demon hunter Shoki, the second Shoki with a bag full of oni, signed TOMICHI, the third a boy with a This old and worn ivory netsuke shows an oni seated with drawn ken-sword, pulling an elusive oni by the hand which Shishi mask, signed SOMIN, the fourth an eggplant and the fifth a Shishi with on a rock. Good himotoshi through the back and the is hiding on top of Shoki’s wide-brimmed hat. Himotoshi through ball. base. Stunning patina. the back. HEIGHT 2 – 4.5 cm HEIGHT 4.5 cm HEIGHT 6.4 cm Condition: Overall good worn condition, the first with a microscopic chip and Condition: Signs of age and wear. Deep honey- Condition: Excellent condition, the ivory bearing a fine yellowish the fifth with chips to mouth and paw. colored patina; age cracks and chipping. patina. 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Old Zagreb private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 1.000,- Estimate EUR 700,- Estimate EUR 400,- Starting price EUR 500,- Starting price EUR 350,- Starting price EUR 200,- 217 | THREE IVORY NETSUKE 218 | AN IVORY NETSUKE OF AN ONI 221 | TOMOCHIKA: AN IVORY NETSUKE WITH THE HAND OF RASHOMON OF A DEMON WITH ATTENDANT The third signed Hidekazu, the others unsigned AND ONI IN A BOAT Japan, late 18th to 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) %\&KLNX\RVDL7RPRFKLNDVLJQHG7RPRFKLND Japan, early 19th century, Edo period (1615-1868) Consisting of Kiyohime with the bell of Dojo-ji, a Rakan seated on a rock, and Raijin banging a large drum amongst clouds, the sides of the drum inlaid with A weeping oni, with one clawed hand over his face horn buttons; signed HIDEKAZU. and the other holding a rosary, is lamenting the 'HSLFWHGLVDGHPRQZLWKDIHPDOHSRVVLEO\%HQWHQSRXULQJ severed hand of the demon Rashomon. The world sake into the sakazuki he is holding - accordingly he has a slightly HEIGHT 2.9 – 4.1 cm of demons went into deep despair after Watanabe GUXQNHQH[SUHVVLRQ%HKLQGWKHPLVDQRQLZKRLVJOHHIXOO\ no Tsuna severed Rashomon’s arm in the year 976. rowing the boat. Finely carved waves on the sides. Himotoshi and Condition: All in very good condition with the ivory slightly worn and minor This event is parodied in netsuke art, as really it was signature TOMOCHIKA on the underside. age cracks. only a ‘drop in the ocean’. The demon’s muscular 3URYHQDQFH%ULWLVKFROOHFWLRQ arm is clenched into a fist, showing its might. Small LENGTH 5 cm himotoshi through one of the buttocks of the oni. Estimate EUR 600,- Condition: Minor age-related wear and a crack through the Starting price EUR 300,- HEIGHT 3 cm underside. Generally, in good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: The rosary is chipped, one minor age 222 | TOMOCHIKA: SMALL IVORY NETSUKE crack, fine yellowish patina to the backside. Estimate EUR 400,- OF TRAVELERS IN A BOAT Starting price EUR 200,- 3URYHQDQFH%ULWLVKFROOHFWLRQ Signed Tomochika Estimate EUR 400,- Japan, Meiji period (1868-1912) Starting price EUR 200,- Depicted is a group of travelers on a boat with finely carved waves on the sides. Himotoshi and signature TOMOCHIKA on the underside. LENGHT 4.5 cm Condition: Very good condition with only a small chip to base. Provenance: European private collection. Estimate EUR 400,- Starting price EUR 200,- 72 73 223 | TWO IVORY NETSUKE, 228 | TWO IVORY NETSUKE, SIGNED ONE BY SHINKEISAI MASATOSHI The gourd signed Ryoji, the farmer signed Shounsai The first signed Shinkeisai, the second unsigned Japan, Meiji period (1868-1912) Japan, 19th century, Edo period (1615-1868) This lot consists of two ivory netsuke. One depicting a man carrying a The first finely carved as a rocky pavilion landscape, signed large gourd, signed RYOJI and small himotoshi on the base, the other SHINKEISAI. The second as Sennin Koreijin with tiger. one a farmer holding a sycle and sitting in front of a basket, signature SHOUNSAI (Joryu) and himotoshi through the base. HEIGHT 3.2 and 4.6 cm HEIGHT 3 – 4 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: The hand of the gourd-carrier restored; remnants of glue. Signs of age and minor chipping. The farmer with age cracks and signs of Estimate EUR 300,- age and wear. Starting price EUR 150,- Provenance: Old Zagreb private collection. 224 | A WOOD NETSUKE OF TRAVELERS IN 227 | AN IVORY NETSUKE OF A DANCER, A MUSICIAN AND A MONKEY A SHIP ATTRIBUTED TO KAGETOSHI Estimate EUR 500,- Starting price EUR 250,- Unsigned, attributed to Kagetoshi Unsigned Japan, 19th century Japan, Meiji period (1868-1912) Carved from a dark reddish wood and depicting a ship with The ivory netsuke shows a festive scene with one dancer carved dragon on its bow, on board a group of people and and a musician holding a drum. A monkey is sitting on a horse. The addition of the horse is very rare. Attributed to the bag of the musician, pulling the ear of the dancer with Kagetoshi. one and the hat with the other hand. LENGTH 4.5 cm HEIGHT c. 4.5 cm Condition: Very good age-related condition. Condition: The feet of the musician and the top of the Provenance: European private collection. feet of the dancer reattached. One chip to the rope that runs along the monkey and the bag. Signs of age and use. Estimate EUR 1.000,- Provenance: Old Zagreb private collection. Starting price EUR 500,- Estimate EUR 500,- Starting price EUR 250,- 225 | A RARE IVORY NETSUKE OF A CRAFTSMAN Unsigned 229 | AN AMUSING WOOD NETSUKE OF 230 | FOUR IVORY NETSUKE WITH Japan, late 18th to early 19th century, Edo period (1615-1868) A NOODLE EATER ‘SCENES FROM DAILY LIFE’ Unsigned The first unsigned, the second signed Homin with kao, the third A rather large and rare depiction of a craftsman, wearing an Japan, 19th century unsigned, the fourth signed Ono Ryoko apron adorned with sunflowers, and pushing down on a box. His Japan, Meiji period (1868-1912) facial features are finely crafted – he visibly takes joy in his work. His almost naked body is smooth with a very appealing honey This amusing netsuke is made from wood and shows a patina in the back. Large himotoshi through the underside and seated man with a satisfied expression eating noodles Consisting of a Shishimai group, a street performer with boy, a boy with back. with chopsticks. Natural himotoshi. dog, and a man with boy, tortoise and dog. HEIGHT 4.2 cm HEIGHT c. 3.6 cm HEIGHT 3.5 – 4.7 cm Condition: Some age cracks (one large one through the left Condition: The end of the chopsticks with a chip. Condition: Generally, in good condition with minor expected wear. The hand), imperfections and one foot reattached. Age-related and Otherwise fine condition. third netsuke with a reattached paw of the dog. good condition. Provenance: Old Zagreb private collection. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 300,- Starting price EUR 200,- 226 | MASA: A WOODEN NETSUKE OF A MASK CARVER Signed masa with Kakihan Japan, 19th century, Edo period (1615-1868) The carver is working on a large Tengu mask with a chisel and a hammer. The underside with himotoshi and signature MASA with Kakihan. LENGHT 5.2 cm Condition: Good condition, few surface scratches. Provenance: European private collection. Estimate EUR 400,- Starting price EUR 200,- 74 75 223 | TWO IVORY NETSUKE, 228 | TWO IVORY NETSUKE, SIGNED ONE BY SHINKEISAI MASATOSHI The gourd signed Ryoji, the farmer signed Shounsai The first signed Shinkeisai, the second unsigned Japan, Meiji period (1868-1912) Japan, 19th century, Edo period (1615-1868) This lot consists of two ivory netsuke. One depicting a man carrying a The first finely carved as a rocky pavilion landscape, signed large gourd, signed RYOJI and small himotoshi on the base, the other SHINKEISAI. The second as Sennin Koreijin with tiger. one a farmer holding a sycle and sitting in front of a basket, signature SHOUNSAI (Joryu) and himotoshi through the base. HEIGHT 3.2 and 4.6 cm HEIGHT 3 – 4 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: The hand of the gourd-carrier restored; remnants of glue. Signs of age and minor chipping. The farmer with age cracks and signs of Estimate EUR 300,- age and wear. Starting price EUR 150,- Provenance: Old Zagreb private collection. 224 | A WOOD NETSUKE OF TRAVELERS IN 227 | AN IVORY NETSUKE OF A DANCER, A MUSICIAN AND A MONKEY A SHIP ATTRIBUTED TO KAGETOSHI Estimate EUR 500,- Starting price EUR 250,- Unsigned, attributed to Kagetoshi Unsigned Japan, 19th century Japan, Meiji period (1868-1912) Carved from a dark reddish wood and depicting a ship with The ivory netsuke shows a festive scene with one dancer carved dragon on its bow, on board a group of people and and a musician holding a drum. A monkey is sitting on a horse. The addition of the horse is very rare. Attributed to the bag of the musician, pulling the ear of the dancer with Kagetoshi. one and the hat with the other hand. LENGTH 4.5 cm HEIGHT c. 4.5 cm Condition: Very good age-related condition. Condition: The feet of the musician and the top of the Provenance: European private collection. feet of the dancer reattached. One chip to the rope that runs along the monkey and the bag. Signs of age and use. Estimate EUR 1.000,- Provenance: Old Zagreb private collection. Starting price EUR 500,- Estimate EUR 500,- Starting price EUR 250,- 225 | A RARE IVORY NETSUKE OF A CRAFTSMAN Unsigned 229 | AN AMUSING WOOD NETSUKE OF 230 | FOUR IVORY NETSUKE WITH Japan, late 18th to early 19th century, Edo period (1615-1868) A NOODLE EATER ‘SCENES FROM DAILY LIFE’ Unsigned The first unsigned, the second signed Homin with kao, the third A rather large and rare depiction of a craftsman, wearing an Japan, 19th century unsigned, the fourth signed Ono Ryoko apron adorned with sunflowers, and pushing down on a box. His Japan, Meiji period (1868-1912) facial features are finely crafted – he visibly takes joy in his work. His almost naked body is smooth with a very appealing honey This amusing netsuke is made from wood and shows a patina in the back. Large himotoshi through the underside and seated man with a satisfied expression eating noodles Consisting of a Shishimai group, a street performer with boy, a boy with back. with chopsticks. Natural himotoshi. dog, and a man with boy, tortoise and dog. HEIGHT 4.2 cm HEIGHT c. 3.6 cm HEIGHT 3.5 – 4.7 cm Condition: Some age cracks (one large one through the left Condition: The end of the chopsticks with a chip. Condition: Generally, in good condition with minor expected wear. The hand), imperfections and one foot reattached. Age-related and Otherwise fine condition. third netsuke with a reattached paw of the dog. good condition. Provenance: Old Zagreb private collection. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 300,- Starting price EUR 200,- 226 | MASA: A WOODEN NETSUKE OF A MASK CARVER Signed masa with Kakihan Japan, 19th century, Edo period (1615-1868) The carver is working on a large Tengu mask with a chisel and a hammer. The underside with himotoshi and signature MASA with Kakihan. LENGHT 5.2 cm Condition: Good condition, few surface scratches. Provenance: European private collection. Estimate EUR 400,- Starting price EUR 200,- 74 75 231 | A GROTESQUE IVORY NETSUKE OF 232 | AN IVORY NETSUKE OF CHORYO A KABUKI ACTOR AND KOSEKIKO Unsigned Unsigned 235 | TWO WOOD NETSUKE OF BLIND MEN 236 | GYOKKEI: A FINE INLAID WOOD NETSUKE Japan, 18th century, Edo period (1615-1868) Japan, early 19th century, Edo period (1615-1868) APPLYING MOXA OF A STONE LIFTER Unsigned %\*\RNNHLVLJQHG*\RNNHL The kabuki actor is standing in a dancing posture, with one leg The netsuke shows the famous scene of Choryo and Kosekiko– Japan, 19th century, Edo period (1615-1868) Japan, late 19th century, Meiji period (1868-1912) raised above the other, wearing an eboshi and holding two the proud Choryo, with one foot on a dragon’s head, is mallets next to his face, on which he wears a grotesque mask presenting the shoe to Kosekiko who is mounted on a horse from a Kabuki play. The apron is carved in relief with a dragon, atop a bridge. According to legend Choryo used the teachings %RWKGHSLFWLQJEOLQGPHQDSSO\LQJ0R[DILQHSDWLQDRQHZLWKDQ A fine and compact netsuke depicting a stone lifter. His blinded with inlaid eyes, whose expression is amusingly very much like RI.RVHNLNRDVDPLOLWDU\DGYLVHUWR/LX%DQJIRXQGHURIWKH+DQ inlaid eye. eye and teeth are inlaid in ivory. Large himotoshi through the that of the mask. Good patina and large himotoshi in the back. Dynasty. Natural himotoshi. underside and signature GYOKKEI on an inlaid ivory tablet. HEIGHT approx. 3.7 cm HEIGHT 8 cm HEIGHT 7 cm HEIGHT 3.5 cm Condition: Good worn condition, the first with a restored foot, the Condition: Very good condition with good patina. Condition: Very good condition, the ivory slightly worn. second with a chip on the cheek. Condition: Excellent condition. Provenance: Luxembourg private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- Estimate EUR 500,- Estimate EUR 400,- Estimate EUR 400,- Starting price EUR 400,- Starting price EUR 250,- Starting price EUR 200,- Starting price EUR 200,- 233 | AN IVORY NETSUKE OF AN OIL THIEF 234 | A FINE WOOD NETSUKE OF 237 | MIWA: A DARK WOOD NETSUKE 238 | GYOKUZAN: A WOOD NETSUKE A NOH ACTOR OF A BOY WITH SHISHIMAI MASK OF HANASAKA JIJI Unsigned Japan, early 19th century, Edo period (1615-1868) Unsigned %\0LZDVLJQHG0LZD %\*\RNX]DQVLJQHG*\RNX]DQ Japan, 19th century, Edo period (1615-1868) Japan, early 19th century, Edo period (1615-1868) Japan, 19th century Showing Taira no Tadamori grabbing the oil thief from behind. Tadamori’s expression is serious, while he grabs the oil thief by A finely caved and stained wood netsuke depicting a seated Carved from a dark-stained wood showing an appealing patina A wood netsuke of Hanasaka-jiji sitting on his resurrected tree the arm and robe, the thief is holding an ewer and has a foot Noh-actor wearing a mask and holding a fan. The wood is of a and depicting a boy wearing a festive Shishimai mask, banging stump, in his hands a basket of ashes with which he uses to revive lifted. Himotoshi to the back. very attractive color – the natural grain of the wood is used to full on a drum before him. The boy’s face is carved minutely on the the dead trees, here shown by the ivory inlaid flowers on the tree effect. Himotoshi through the underside and back. inside. The underside shows the characteristically large himotoshi trunk. The underside shows the himotoshi, the smaller ringed in HEIGHT 5 cm and signature MIWA. green-stained ivory and the signature inlaid in ivory GYOKUZAN. HEIGHT 3.9 cm Condition: Worn condition with expected age cracks, a foot and HEIGHT 3.1 cm HEIGHT 3.8 cm the sandal have been restored. Condition: Excellent condition. Provenance: European private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Good, worn condition. No damages. Condition: Very good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.500,- Estimate EUR 400,- Starting price EUR 750,- Starting price EUR 200,- Estimate EUR 400,- Estimate EUR 400,- Starting price EUR 200,- Starting price EUR 200,- 76 77 231 | A GROTESQUE IVORY NETSUKE OF 232 | AN IVORY NETSUKE OF CHORYO A KABUKI ACTOR AND KOSEKIKO Unsigned Unsigned 235 | TWO WOOD NETSUKE OF BLIND MEN 236 | GYOKKEI: A FINE INLAID WOOD NETSUKE Japan, 18th century, Edo period (1615-1868) Japan, early 19th century, Edo period (1615-1868) APPLYING MOXA OF A STONE LIFTER Unsigned %\*\RNNHLVLJQHG*\RNNHL The kabuki actor is standing in a dancing posture, with one leg The netsuke shows the famous scene of Choryo and Kosekiko– Japan, 19th century, Edo period (1615-1868) Japan, late 19th century, Meiji period (1868-1912) raised above the other, wearing an eboshi and holding two the proud Choryo, with one foot on a dragon’s head, is mallets next to his face, on which he wears a grotesque mask presenting the shoe to Kosekiko who is mounted on a horse from a Kabuki play. The apron is carved in relief with a dragon, atop a bridge. According to legend Choryo used the teachings %RWKGHSLFWLQJEOLQGPHQDSSO\LQJ0R[DILQHSDWLQDRQHZLWKDQ A fine and compact netsuke depicting a stone lifter. His blinded with inlaid eyes, whose expression is amusingly very much like RI.RVHNLNRDVDPLOLWDU\DGYLVHUWR/LX%DQJIRXQGHURIWKH+DQ inlaid eye. eye and teeth are inlaid in ivory. Large himotoshi through the that of the mask. Good patina and large himotoshi in the back. Dynasty. Natural himotoshi. underside and signature GYOKKEI on an inlaid ivory tablet. HEIGHT approx. 3.7 cm HEIGHT 8 cm HEIGHT 7 cm HEIGHT 3.5 cm Condition: Good worn condition, the first with a restored foot, the Condition: Very good condition with good patina. Condition: Very good condition, the ivory slightly worn. second with a chip on the cheek. Condition: Excellent condition. Provenance: Luxembourg private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- Estimate EUR 500,- Estimate EUR 400,- Estimate EUR 400,- Starting price EUR 400,- Starting price EUR 250,- Starting price EUR 200,- Starting price EUR 200,- 233 | AN IVORY NETSUKE OF AN OIL THIEF 234 | A FINE WOOD NETSUKE OF 237 | MIWA: A DARK WOOD NETSUKE 238 | GYOKUZAN: A WOOD NETSUKE A NOH ACTOR OF A BOY WITH SHISHIMAI MASK OF HANASAKA JIJI Unsigned Japan, early 19th century, Edo period (1615-1868) Unsigned %\0LZDVLJQHG0LZD %\*\RNX]DQVLJQHG*\RNX]DQ Japan, 19th century, Edo period (1615-1868) Japan, early 19th century, Edo period (1615-1868) Japan, 19th century Showing Taira no Tadamori grabbing the oil thief from behind. Tadamori’s expression is serious, while he grabs the oil thief by A finely caved and stained wood netsuke depicting a seated Carved from a dark-stained wood showing an appealing patina A wood netsuke of Hanasaka-jiji sitting on his resurrected tree the arm and robe, the thief is holding an ewer and has a foot Noh-actor wearing a mask and holding a fan. The wood is of a and depicting a boy wearing a festive Shishimai mask, banging stump, in his hands a basket of ashes with which he uses to revive lifted. Himotoshi to the back. very attractive color – the natural grain of the wood is used to full on a drum before him. The boy’s face is carved minutely on the the dead trees, here shown by the ivory inlaid flowers on the tree effect. Himotoshi through the underside and back. inside. The underside shows the characteristically large himotoshi trunk. The underside shows the himotoshi, the smaller ringed in HEIGHT 5 cm and signature MIWA. green-stained ivory and the signature inlaid in ivory GYOKUZAN. HEIGHT 3.9 cm Condition: Worn condition with expected age cracks, a foot and HEIGHT 3.1 cm HEIGHT 3.8 cm the sandal have been restored. Condition: Excellent condition. Provenance: European private collection. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: Good, worn condition. No damages. Condition: Very good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.500,- Estimate EUR 400,- Starting price EUR 750,- Starting price EUR 200,- Estimate EUR 400,- Estimate EUR 400,- Starting price EUR 200,- Starting price EUR 200,- 76 77 243 | FIVE WOOD NETSUKE, TWO SIGNED HEIGHT 2.5 – 5.4 cm 239 | A GOOD TALL IVORY NETSUKE OF A 240 | A RARE IVORY NETSUKE OF A SARUMAWASHI The second signed Tomotada, the fifth signed Tomoyuki Japan, 19th century to Meiji period (1868-1912) Condition: The second with small damages, a crack and a restored STANDING SARUMAWASHI WITH MONKEY WITH TWO MONKEYS paw, the fourth missing a snail’s tentacle and with a thin crack and the fifth with a tiny chip to the eye. The other two in good, worn Unsigned Unsigned The first depicting a rat in a basket of mushrooms, the second a condition. Japan, 18th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) recumbent ox, signed TOMOTADA, the third a tiger, the fourth 3URYHQDQFH%ULWLVKFROOHFWLRQ a snail on a bamboo stalk with octopus tentacles and the fifth a Published:%DUU\'DYLHV2ULHQWDO$UW1HWVXNHDQGΖQURIURP standing frog wearing a pair of geta and carrying a lotus flower, Estimate EUR 1.000,- European Collections (London, 2002), no. 100, & Galerie Gemini A humorous ivory netsuke of a sarumawashi (monkey trainer) inlaid eyes and signature TOMOYUKI. Starting price EUR 500,- & Ichimonji Art (Munich, 2004), no. 199. with his trained monkey climbing on his back and holding the arm of a large wild monkey. The proportions of the monkey and sarumawashi are very amusing. Furthermore, the monkey An ivory netsuke of a sarumawashi (monkey trainer) standing and appears to be blind. The present netsuke appears to be a variant 244 | ANRAKU: AN IVORY NETSUKE laughing with large glaring eyes inlaid in black lustrous horn. He of Kintaro with two monkeys motif, though with a humorous OF A MAN AND WOMAN WITH TIGER is wearing a cap with an incised peach branch, has a food basket twist. Good himotoshi through the underside and side. tied to his obi in front of him and is holding a taming stick in one %\$QUDNXVLJQHG$QUDNX hand and the monkey’s paw in the other. The monkey is seated HEIGHT 3.1 cm Japan, Osaka, 19th century, Edo period (1615-1868) on his shoulder, mischievously holding his mouth as if he was about to laugh. The backside with a very good patina and angular Condition: Very good condition, appealing patina. himotoshi. Provenance: The 40-Year Collection of a London Gentleman. A rather large ivory netsuke depicting a man and woman dressed in elaborately decorated clothes, holding a large tiger. The tiger HEIGHT 8.8 cm Estimate EUR 400,- is finely carved with a well-expressed fur pattern, curling tail and Starting price EUR 200,- snarling expression with inlaid pupils of dark horn. The woman Condition: Good, worn condition with expected age cracks and is holding the tiger, while the man is looking at a food basket and good patina. A section of the taming stick with an old and worn- scratching his head in confusion. Possibly they are wondering what down loss. to feed the tiger. Himotoshi on the underside and signature on an 242 | A FINE IVORY NETSUKE OF A SLEEPING 3URYHQDQFH%DUU\'DYLHVWKHQ*DOHULH*HPLQL ΖFKLPRQMLDUW inlaid mother of pearl tablet ANRAKU. then Luxembourg private collection. SARUMAWASHI WITH MONKEY HEIGHT 4 cm, LENGTH 4.5 cm Estimate EUR 800,- Unsigned Japan, 18th century, Edo period (1615-1868) Starting price EUR 400,- Condition: Very good condition, minor imperfections to material. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ The Sarumawashi (monkey trainer) was a street artist who Estimate EUR 600,- 241 | SHUNZAN: A WOOD NETSUKE OF YORIMASA performed tricks with his monkey. In this netsuke the monkey Starting price EUR 300,- KILLING THE NUE trainer is depicted sleeping, with a serene facial expression, while the normally obedient monkey is grabbing the basket of the food Signed Shunzan behind his back. The ivory bearing a very good patina and the Japan, 19th century large himotoshi on the underside. 245 | AN UNUSUAL AND EARLY IVORY NETSUKE OF A CHINESE SAGE WITH TIGER LENGTH 5.1 cm Finely carved and depicting a Yorimasa in full armor holding Unsigned down a large nue while ramming his sword into the legendary Condition: Minor expected age cracks, the ivory slightly worn - Japan, 18th century, Edo period (1615-1868) beast’s head; standing by side, his servant Ino Hayata stays alert. very good condition. Provenance: The 40-Year Collection of a London Gentleman. LENGTH 4 cm A large ivory netsuke set on a large, thick and quadratic base with Estimate EUR 400,- sizable and well-hollowed out himotoshi. Depicted is a Chinese sage Condition: Good condition. Starting price EUR 200,- with a bemused facial expression as the little tiger in front of him Provenance: European private collection. is lying on his side, baring his genitals and scratching his ear with a mischievous grin. The immortal is wearing a cap and Chinese robes Estimate EUR 1.200,- DQGLVOHDQLQJRQDQRUQDWHO\FDUYHGWDEOH%HDXWLIXO\HOORZLVKDQG Starting price EUR 600,- honey patina. HEIGHT 4.7 cm Condition: Excellent condition, expected age cracks, remnants of red painting on the underside. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,- Starting price EUR 200,- 78 79 243 | FIVE WOOD NETSUKE, TWO SIGNED HEIGHT 2.5 – 5.4 cm 239 | A GOOD TALL IVORY NETSUKE OF A 240 | A RARE IVORY NETSUKE OF A SARUMAWASHI The second signed Tomotada, the fifth signed Tomoyuki Japan, 19th century to Meiji period (1868-1912) Condition: The second with small damages, a crack and a restored STANDING SARUMAWASHI WITH MONKEY WITH TWO MONKEYS paw, the fourth missing a snail’s tentacle and with a thin crack and the fifth with a tiny chip to the eye. The other two in good, worn Unsigned Unsigned The first depicting a rat in a basket of mushrooms, the second a condition. Japan, 18th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) recumbent ox, signed TOMOTADA, the third a tiger, the fourth 3URYHQDQFH%ULWLVKFROOHFWLRQ a snail on a bamboo stalk with octopus tentacles and the fifth a Published:%DUU\'DYLHV2ULHQWDO$UW1HWVXNHDQGΖQURIURP standing frog wearing a pair of geta and carrying a lotus flower, Estimate EUR 1.000,- European Collections (London, 2002), no. 100, & Galerie Gemini A humorous ivory netsuke of a sarumawashi (monkey trainer) inlaid eyes and signature TOMOYUKI. Starting price EUR 500,- & Ichimonji Art (Munich, 2004), no. 199. with his trained monkey climbing on his back and holding the arm of a large wild monkey. The proportions of the monkey and sarumawashi are very amusing. Furthermore, the monkey An ivory netsuke of a sarumawashi (monkey trainer) standing and appears to be blind. The present netsuke appears to be a variant 244 | ANRAKU: AN IVORY NETSUKE laughing with large glaring eyes inlaid in black lustrous horn. He of Kintaro with two monkeys motif, though with a humorous OF A MAN AND WOMAN WITH TIGER is wearing a cap with an incised peach branch, has a food basket twist. Good himotoshi through the underside and side. tied to his obi in front of him and is holding a taming stick in one %\$QUDNXVLJQHG$QUDNX hand and the monkey’s paw in the other. The monkey is seated HEIGHT 3.1 cm Japan, Osaka, 19th century, Edo period (1615-1868) on his shoulder, mischievously holding his mouth as if he was about to laugh. The backside with a very good patina and angular Condition: Very good condition, appealing patina. himotoshi. Provenance: The 40-Year Collection of a London Gentleman. A rather large ivory netsuke depicting a man and woman dressed in elaborately decorated clothes, holding a large tiger. The tiger HEIGHT 8.8 cm Estimate EUR 400,- is finely carved with a well-expressed fur pattern, curling tail and Starting price EUR 200,- snarling expression with inlaid pupils of dark horn. The woman Condition: Good, worn condition with expected age cracks and is holding the tiger, while the man is looking at a food basket and good patina. A section of the taming stick with an old and worn- scratching his head in confusion. Possibly they are wondering what down loss. to feed the tiger. Himotoshi on the underside and signature on an 242 | A FINE IVORY NETSUKE OF A SLEEPING 3URYHQDQFH%DUU\'DYLHVWKHQ*DOHULH*HPLQL ΖFKLPRQMLDUW inlaid mother of pearl tablet ANRAKU. then Luxembourg private collection. SARUMAWASHI WITH MONKEY HEIGHT 4 cm, LENGTH 4.5 cm Estimate EUR 800,- Unsigned Japan, 18th century, Edo period (1615-1868) Starting price EUR 400,- Condition: Very good condition, minor imperfections to material. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ The Sarumawashi (monkey trainer) was a street artist who Estimate EUR 600,- 241 | SHUNZAN: A WOOD NETSUKE OF YORIMASA performed tricks with his monkey. In this netsuke the monkey Starting price EUR 300,- KILLING THE NUE trainer is depicted sleeping, with a serene facial expression, while the normally obedient monkey is grabbing the basket of the food Signed Shunzan behind his back. The ivory bearing a very good patina and the Japan, 19th century large himotoshi on the underside. 245 | AN UNUSUAL AND EARLY IVORY NETSUKE OF A CHINESE SAGE WITH TIGER LENGTH 5.1 cm Finely carved and depicting a Yorimasa in full armor holding Unsigned down a large nue while ramming his sword into the legendary Condition: Minor expected age cracks, the ivory slightly worn - Japan, 18th century, Edo period (1615-1868) beast’s head; standing by side, his servant Ino Hayata stays alert. very good condition. Provenance: The 40-Year Collection of a London Gentleman. LENGTH 4 cm A large ivory netsuke set on a large, thick and quadratic base with Estimate EUR 400,- sizable and well-hollowed out himotoshi. Depicted is a Chinese sage Condition: Good condition. Starting price EUR 200,- with a bemused facial expression as the little tiger in front of him Provenance: European private collection. is lying on his side, baring his genitals and scratching his ear with a mischievous grin. The immortal is wearing a cap and Chinese robes Estimate EUR 1.200,- DQGLVOHDQLQJRQDQRUQDWHO\FDUYHGWDEOH%HDXWLIXO\HOORZLVKDQG Starting price EUR 600,- honey patina. HEIGHT 4.7 cm Condition: Excellent condition, expected age cracks, remnants of red painting on the underside. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,- Starting price EUR 200,- 78 79 246 | THREE FINE IVORY NETSUKE 250 | TWO IVORY NETSUKE Unsigned The first signed Hoshinsai, the second signed Kisei Japan, 19th century, Edo period (1615-1868) Japan, Meiji period (1868-1912) 7KHJURXSFRQVLVWLQJRI.LQWDURD'XWFKPDQDQGD%LMLQZLWKFKLOG The first of two Shojo drinking sake, signed HOSHINSAI, and the second of a carpenter taking a break eating rice, signed KISEI. HEIGHT 4.4 – 5.2 cm HEIGHT 3.9 and 3.6 cm Condition: All in very good condition with expected wear, the Dutchman with some age cracks. &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 200,- 251 | AN AMUSING IVORY NETSUKE OF A MAN WITH MUSHROOM BASKET 247 | TWO IVORY NETSUKE, ONE OF A DUTCHMAN Unsigned Japan, 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) An amusing ivory netsuke of man, naked except for a loincloth, painfully exclaiming as his hand is stuck under a gigantic mushroom HEIGHT 5 and 5.2 cm on top of a basket. His expression is quite ambiguous as he is happy about his find, however he is also obviously in pain. The Condition: Minor age cracks and surface scratches, overall good weave pattern on the basket is very well carved. Large himotoshi condition. through the underside. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 3 cm, LENGTH 5 cm Estimate EUR 400,- Starting price EUR 200,- Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,- Starting price EUR 150,- 248 | FOUR WOOD NETSUKE 252 | TWO FIGURAL IVORY NETSUKE The fourth signed Tomokazu Japan, 19th century to Meiji period (1868-1912) The first unsigned, the second signed Ungai Japan, mid-19th century to Meiji period (1868-1912) The first depicting a boy with a Shishi mask, the second a boy pulling an ox, the third a tall netsuke of a Dutchmen with rooster 7KHILUVWRI%HQWHQDQGDWWHQGDQWVDQGWKHVHFRQG7RPRFKLND and the fourth Jurojin with crane, the crane’s eyes inlaid, signed VFKRRORID%LMLQZLWKER\V TOMOKAZU. HEIGHT 3.2 and 4.1 cm HEIGHT 3.2 – 9 cm Condition: The first one with some discoloration to ivory and a Condition: The second and third in very good condition, the first repaired foot. The second in very good condition. and fifth with a restoration and the third with a tiny chip. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,- Estimate EUR 800,- Starting price EUR 200,- Starting price EUR 400,- 253 | TWO IVORY NETSUKE, ONE MARINE IVORY Unsigned 249 | TWO IVORY NETSUKE OF BLIND MEN FIGHTING Japan, 19th century, Edo period (1615-1868) Unsigned, one with inlays Japan, Meiji period (1868-1912) Consisting of a reclining farmer on a mat of bamboo holding a sycle, and a marine ivory islander holding a sycle and fish. HEIGHT 3 and 4.6 cm LENGTH 5.6 cm and HEIGHT 6.7 cm Condition: The first with half of the cane missing, the second with Condition: The farmer with some discoloration to the underside. three minor losses to the inlays. Generally, both in very good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,- Estimate EUR 400,- Starting price EUR 200,- Starting price EUR 200,- 80 81 246 | THREE FINE IVORY NETSUKE 250 | TWO IVORY NETSUKE Unsigned The first signed Hoshinsai, the second signed Kisei Japan, 19th century, Edo period (1615-1868) Japan, Meiji period (1868-1912) 7KHJURXSFRQVLVWLQJRI.LQWDURD'XWFKPDQDQGD%LMLQZLWKFKLOG The first of two Shojo drinking sake, signed HOSHINSAI, and the second of a carpenter taking a break eating rice, signed KISEI. HEIGHT 4.4 – 5.2 cm HEIGHT 3.9 and 3.6 cm Condition: All in very good condition with expected wear, the Dutchman with some age cracks. &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 200,- 251 | AN AMUSING IVORY NETSUKE OF A MAN WITH MUSHROOM BASKET 247 | TWO IVORY NETSUKE, ONE OF A DUTCHMAN Unsigned Japan, 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) An amusing ivory netsuke of man, naked except for a loincloth, painfully exclaiming as his hand is stuck under a gigantic mushroom HEIGHT 5 and 5.2 cm on top of a basket. His expression is quite ambiguous as he is happy about his find, however he is also obviously in pain. The Condition: Minor age cracks and surface scratches, overall good weave pattern on the basket is very well carved. Large himotoshi condition. through the underside. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 3 cm, LENGTH 5 cm Estimate EUR 400,- Starting price EUR 200,- Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,- Starting price EUR 150,- 248 | FOUR WOOD NETSUKE 252 | TWO FIGURAL IVORY NETSUKE The fourth signed Tomokazu Japan, 19th century to Meiji period (1868-1912) The first unsigned, the second signed Ungai Japan, mid-19th century to Meiji period (1868-1912) The first depicting a boy with a Shishi mask, the second a boy pulling an ox, the third a tall netsuke of a Dutchmen with rooster 7KHILUVWRI%HQWHQDQGDWWHQGDQWVDQGWKHVHFRQG7RPRFKLND and the fourth Jurojin with crane, the crane’s eyes inlaid, signed VFKRRORID%LMLQZLWKER\V TOMOKAZU. HEIGHT 3.2 and 4.1 cm HEIGHT 3.2 – 9 cm Condition: The first one with some discoloration to ivory and a Condition: The second and third in very good condition, the first repaired foot. The second in very good condition. and fifth with a restoration and the third with a tiny chip. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,- Estimate EUR 800,- Starting price EUR 200,- Starting price EUR 400,- 253 | TWO IVORY NETSUKE, ONE MARINE IVORY Unsigned 249 | TWO IVORY NETSUKE OF BLIND MEN FIGHTING Japan, 19th century, Edo period (1615-1868) Unsigned, one with inlays Japan, Meiji period (1868-1912) Consisting of a reclining farmer on a mat of bamboo holding a sycle, and a marine ivory islander holding a sycle and fish. HEIGHT 3 and 4.6 cm LENGTH 5.6 cm and HEIGHT 6.7 cm Condition: The first with half of the cane missing, the second with Condition: The farmer with some discoloration to the underside. three minor losses to the inlays. Generally, both in very good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,- Estimate EUR 400,- Starting price EUR 200,- Starting price EUR 200,- 80 81 254 | FIVE WOOD NETSUKE, 258 | FIVE WOOD NETSUKE ONE SIGNED The fourth signed Hakugyoku The third signed Randa Japan, 19th century Japan, 19th century to Meiji period (1868-1912) The first of a temple servant in The first two small netsuke depicting a man with flowing robes holding a lantern and an ox, the third a kappa seated next to a tent-like a parasol, the second depicting lotus leaf with a tiny frog inside, signed RANDA, 255 | FIVE WOOD NETSUKE Jurojin - the lucky god - with a the fourth Hanasaka-jiji and the fifth a kid with boy, the third a man kneeling and a dog. The second signed Gyokko, the fourth signed polishing the floor, the fourth Masanao and the fifth signed Ryugyoku Kan’U holding a halberd, signed HEIGHT 3.3 – 3.8 cm Japan, 19th century HAKUGYOKU, and the fifth a carpenter. Condition: The first three in good condition, the fourth with a crack and a chip and the fifth with a The first depicting a blind stone lifter, his one open HEIGHT 3.5 – 6.5 cm restored paw of the dog. eye and two teeth are inlaid in ivory, the inlaid 3URYHQDQFH%ULWLVKFROOHFWLRQ Gyokkei signature is missing, the second depicting Condition: Overall good condition Hanasaka-jiji with a basket of ashes sitting on his with expected wear, the second Estimate EUR 1.000,- resurrected tree stump, ivory inlaid signature with a chip and a small restoration Starting price EUR 500,- GYOKKO, the third a farmer sleeping, the fourth a and the fourth with chips and red blind masseur working his skills on a seated client’s stains to base. shoulders, signed MASANAO, and the fifth a Nio on 3URYHQDQFH%ULWLVKFROOHFWLRQ a giant sandal, signed RYUGYOKU. Estimate EUR 1.000,- HEIGHT 2.5 – 4 cm Starting price EUR 500,- 259 | A GROUP OF THREE Condition: The first missing the inlaid signature and IVORY NETSUKE with minor chips to feet, the second with a hardly noticeable chip and worn patina, the third with a The third signed Ryoji crack, scratches and tiny chips, the fourth with a Japan, 19th century to Meiji period small chip and the fifth in good condition. (1868-1912) 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- The first a good netsuke of a Shishi with Starting price EUR 500,- young, its mouth wide open with a loose ball inside, the second two boys playing with a mask, the mask’s eyes inlaid in metal; the third depicting Ashinaga and Tenaga working 256 | FIVE WOOD NETSUKE, together to play a drum, signed RYOJI (a pupil TWO SIGNED of Ono Ryomin). The first signed Masatomo, the fourth signed HEIGHT 3.2 – 5.2 cm Hokei Japan, 19th century Condition: Overall good condition with expected age cracks, the third with a restored leg. The first a comical netsuke of the well-known 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ subject of the blind masseur working his skills on a seated client’s shoulders, signed MASATOMO, Estimate EUR 600,- the second a temple servant in flowing robes Starting price EUR 300,- holding a lantern and a parasol, the third a man kneeling and polishing the floor, the fourth a carpenter signed HOKEI, and the fifth a Sambaso dancer, the feet and head in ivory and with 260 | FIVE WOOD NETSUKE movable tongue. 257 | A GROUP OF FOUR IVORY NETSUKE The first signed Ohara, the third HEIGHT 3.5 – 6.7 cm The first signed, the fourth signed Masayuki signed illegibly Japan, Meiji period (1868-1912) Japan, 19th century Condition: Overall good condition with expected wear, the fifth with a drilled hole to base. 3URYHQDQFH%ULWLVKFROOHFWLRQ The first and third depicting carpenters, the first The first a netsuke of a Shishi with signed. The second finely carved as Hotei and two bell on a base, signed OHARA, the Estimate EUR 1.000,- boys playing a board game and the fourth a bell second depicting a frog, the third Starting price EUR 500,- maker, signed MASAYUKI. a boy wearing a Shishi mask, the fourth a recumbent ox and the fifth HEIGHT 2.3 – 6 cm a rat on a basket, inlaid eyes. Condition: The first missing an object that he had HEIGHT 1.2 – 3.5 cm between both feet. The second with a chip to base and expected age cracks. The third with cracks and a Condition: All generally in good restored hand. The fourth in good condition. condition, few surface scratches. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 1.000,- Starting price EUR 300,- Starting price EUR 500,- 82 83 254 | FIVE WOOD NETSUKE, 258 | FIVE WOOD NETSUKE ONE SIGNED The fourth signed Hakugyoku The third signed Randa Japan, 19th century Japan, 19th century to Meiji period (1868-1912) The first of a temple servant in The first two small netsuke depicting a man with flowing robes holding a lantern and an ox, the third a kappa seated next to a tent-like a parasol, the second depicting lotus leaf with a tiny frog inside, signed RANDA, 255 | FIVE WOOD NETSUKE Jurojin - the lucky god - with a the fourth Hanasaka-jiji and the fifth a kid with boy, the third a man kneeling and a dog. The second signed Gyokko, the fourth signed polishing the floor, the fourth Masanao and the fifth signed Ryugyoku Kan’U holding a halberd, signed HEIGHT 3.3 – 3.8 cm Japan, 19th century HAKUGYOKU, and the fifth a carpenter. Condition: The first three in good condition, the fourth with a crack and a chip and the fifth with a The first depicting a blind stone lifter, his one open HEIGHT 3.5 – 6.5 cm restored paw of the dog. eye and two teeth are inlaid in ivory, the inlaid 3URYHQDQFH%ULWLVKFROOHFWLRQ Gyokkei signature is missing, the second depicting Condition: Overall good condition Hanasaka-jiji with a basket of ashes sitting on his with expected wear, the second Estimate EUR 1.000,- resurrected tree stump, ivory inlaid signature with a chip and a small restoration Starting price EUR 500,- GYOKKO, the third a farmer sleeping, the fourth a and the fourth with chips and red blind masseur working his skills on a seated client’s stains to base. shoulders, signed MASANAO, and the fifth a Nio on 3URYHQDQFH%ULWLVKFROOHFWLRQ a giant sandal, signed RYUGYOKU. Estimate EUR 1.000,- HEIGHT 2.5 – 4 cm Starting price EUR 500,- 259 | A GROUP OF THREE Condition: The first missing the inlaid signature and IVORY NETSUKE with minor chips to feet, the second with a hardly noticeable chip and worn patina, the third with a The third signed Ryoji crack, scratches and tiny chips, the fourth with a Japan, 19th century to Meiji period small chip and the fifth in good condition. (1868-1912) 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,- The first a good netsuke of a Shishi with Starting price EUR 500,- young, its mouth wide open with a loose ball inside, the second two boys playing with a mask, the mask’s eyes inlaid in metal; the third depicting Ashinaga and Tenaga working 256 | FIVE WOOD NETSUKE, together to play a drum, signed RYOJI (a pupil TWO SIGNED of Ono Ryomin). The first signed Masatomo, the fourth signed HEIGHT 3.2 – 5.2 cm Hokei Japan, 19th century Condition: Overall good condition with expected age cracks, the third with a restored leg. The first a comical netsuke of the well-known 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ subject of the blind masseur working his skills on a seated client’s shoulders, signed MASATOMO, Estimate EUR 600,- the second a temple servant in flowing robes Starting price EUR 300,- holding a lantern and a parasol, the third a man kneeling and polishing the floor, the fourth a carpenter signed HOKEI, and the fifth a Sambaso dancer, the feet and head in ivory and with 260 | FIVE WOOD NETSUKE movable tongue. 257 | A GROUP OF FOUR IVORY NETSUKE The first signed Ohara, the third HEIGHT 3.5 – 6.7 cm The first signed, the fourth signed Masayuki signed illegibly Japan, Meiji period (1868-1912) Japan, 19th century Condition: Overall good condition with expected wear, the fifth with a drilled hole to base. 3URYHQDQFH%ULWLVKFROOHFWLRQ The first and third depicting carpenters, the first The first a netsuke of a Shishi with signed. The second finely carved as Hotei and two bell on a base, signed OHARA, the Estimate EUR 1.000,- boys playing a board game and the fourth a bell second depicting a frog, the third Starting price EUR 500,- maker, signed MASAYUKI. a boy wearing a Shishi mask, the fourth a recumbent ox and the fifth HEIGHT 2.3 – 6 cm a rat on a basket, inlaid eyes. Condition: The first missing an object that he had HEIGHT 1.2 – 3.5 cm between both feet. The second with a chip to base and expected age cracks. The third with cracks and a Condition: All generally in good restored hand. The fourth in good condition. condition, few surface scratches. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 1.000,- Starting price EUR 300,- Starting price EUR 500,- 82 83 261 | THREE IVORY NETSUKE OF SHISHI 265 | FOUR IVORY NETSUKE OF Unsigned SHISHI Japan, late 18th to early 19th century The fourth signed illegibly, the others unsigned HEIGHT 2.8 – 3.9 cm Japan, late 18th to early 19th century Condition: All in good condition with expected wear. The signature on the fourth Shishi is illegibly worn. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 3.1 – 3.8 cm Estimate EUR 700,- Condition: All in good condition Starting price EUR 350,- with expected wear. The 262 | AN IVORY NETSUKE OF A SHISHI WITH BALL signature on the fourth Shishi is illegibly worn. Unsigned 3URYHQDQFH%ULWLVKSULYDWH Japan, probably Osaka, early 19th century, Edo period (1615-1868) collection. Estimate EUR 800,- An amusing ivory netsuke of a Shishi with inlaid pupils of dark horn and a Starting price EUR 400,- wide grin with an opened mouth and a loose ball inside. The fur is finely incised, and the curls all over his body form little smooth balls. Himotoshi through the large ball and underside of the lion dog. 266 | AN IVORY NETSUKE OF TWO FIGHTING SHISHI HEIGHT 3.7 cm Unsigned Condition: Good condition, some age cracks and two teeth inside the Japan, 19th century, Edo period (1615-1868) mouth are chipped. 3URYHQDQFH%ULWLVKFROOHFWLRQ A rather large ivory netsuke of two fighting Shishi forming an ideally Estimate EUR 400,- rounded composition. Each lion dog is fiercely biting into the Starting price EUR 200,- opponents hindleg. Finely carved curls, inlaid pupils and natural himotoshi. LENGTH 5.5 cm 263 | A GOOD IVORY NETSUKE OF FOUR SHISHI Condition: Good condition, fine patina on the underside. Unsigned 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Japan, 19th century, Meiji period (1868-1912) Estimate EUR 400,- Starting price EUR 200,- An animated group depicting four Shishi, the adult Shishi is lying down and the three smaller ones try to get on his back. The bushy curls of the three Shishi are expressively carved. Small himotoshi through the underside and good honey patina. LENGHT 4.6 cm Condition: Good worn condition with expected age cracks, two microscopic chips to one paw. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,- 264 | AN IVORY NETSUKE OF THREE FIGHTING SHISHI Starting price EUR 200,- 267 | AN IVORY NETSUKE OF A SHISHI STATUE Unsigned SIGNED TOMOKAZU Japan, Kyoto, 18th century, Edo period (1615-1868) Signed Tomokazu Japan, Meiji period (1868-1912) An animated group depicting three fighting Shishi. The adult Shishi on the bottom is being ambushed by another adult and young. The young bites into his bushy tail, while the adult climbs on top of him, ferociously An amusing ivory netsuke of a Shishi statically standing upright snarling. The poor lion dog tries to defend himself, as he is visibly OLNHWKHVWDWXHVWKDWIODQNWKHHQWUDQFHVRI%XGGKLVWVKULQHVDQG frightened, kicking the jaw of his attacker. The two adults both have a temples. The guardian lion has its mouth opened, and a curly loose ball inside their mouths. Large, asymmetrical himotoshi through the mane and bushy tail accentuated with ink. Natural himotoshi and underside. signature TOMOKAZU in a wavy reserve in an unusual place near the tail. HEIGHT 3.3 cm, LENGTH 4 cm HEIGHT 5.4 cm Condition: One old, smooth chip to the edge of the lower Shishi’s left front paw. Otherwise very good condition with an appealing patina. Condition: Very good condition, minor age cracks. Provenance: French private collection. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 200,- 84 85 261 | THREE IVORY NETSUKE OF SHISHI 265 | FOUR IVORY NETSUKE OF Unsigned SHISHI Japan, late 18th to early 19th century The fourth signed illegibly, the others unsigned HEIGHT 2.8 – 3.9 cm Japan, late 18th to early 19th century Condition: All in good condition with expected wear. The signature on the fourth Shishi is illegibly worn. 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 3.1 – 3.8 cm Estimate EUR 700,- Condition: All in good condition Starting price EUR 350,- with expected wear. The 262 | AN IVORY NETSUKE OF A SHISHI WITH BALL signature on the fourth Shishi is illegibly worn. Unsigned 3URYHQDQFH%ULWLVKSULYDWH Japan, probably Osaka, early 19th century, Edo period (1615-1868) collection. Estimate EUR 800,- An amusing ivory netsuke of a Shishi with inlaid pupils of dark horn and a Starting price EUR 400,- wide grin with an opened mouth and a loose ball inside. The fur is finely incised, and the curls all over his body form little smooth balls. Himotoshi through the large ball and underside of the lion dog. 266 | AN IVORY NETSUKE OF TWO FIGHTING SHISHI HEIGHT 3.7 cm Unsigned Condition: Good condition, some age cracks and two teeth inside the Japan, 19th century, Edo period (1615-1868) mouth are chipped. 3URYHQDQFH%ULWLVKFROOHFWLRQ A rather large ivory netsuke of two fighting Shishi forming an ideally Estimate EUR 400,- rounded composition. Each lion dog is fiercely biting into the Starting price EUR 200,- opponents hindleg. Finely carved curls, inlaid pupils and natural himotoshi. LENGTH 5.5 cm 263 | A GOOD IVORY NETSUKE OF FOUR SHISHI Condition: Good condition, fine patina on the underside. Unsigned 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Japan, 19th century, Meiji period (1868-1912) Estimate EUR 400,- Starting price EUR 200,- An animated group depicting four Shishi, the adult Shishi is lying down and the three smaller ones try to get on his back. The bushy curls of the three Shishi are expressively carved. Small himotoshi through the underside and good honey patina. LENGHT 4.6 cm Condition: Good worn condition with expected age cracks, two microscopic chips to one paw. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,- 264 | AN IVORY NETSUKE OF THREE FIGHTING SHISHI Starting price EUR 200,- 267 | AN IVORY NETSUKE OF A SHISHI STATUE Unsigned SIGNED TOMOKAZU Japan, Kyoto, 18th century, Edo period (1615-1868) Signed Tomokazu Japan, Meiji period (1868-1912) An animated group depicting three fighting Shishi. The adult Shishi on the bottom is being ambushed by another adult and young. The young bites into his bushy tail, while the adult climbs on top of him, ferociously An amusing ivory netsuke of a Shishi statically standing upright snarling. The poor lion dog tries to defend himself, as he is visibly OLNHWKHVWDWXHVWKDWIODQNWKHHQWUDQFHVRI%XGGKLVWVKULQHVDQG frightened, kicking the jaw of his attacker. The two adults both have a temples. The guardian lion has its mouth opened, and a curly loose ball inside their mouths. Large, asymmetrical himotoshi through the mane and bushy tail accentuated with ink. Natural himotoshi and underside. signature TOMOKAZU in a wavy reserve in an unusual place near the tail. HEIGHT 3.3 cm, LENGTH 4 cm HEIGHT 5.4 cm Condition: One old, smooth chip to the edge of the lower Shishi’s left front paw. Otherwise very good condition with an appealing patina. Condition: Very good condition, minor age cracks. Provenance: French private collection. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 600,- Estimate EUR 400,- Starting price EUR 300,- Starting price EUR 200,- 84 85 268 | A WOOD NETSUKE OF A SHISHI 269 | MASATOMO: A POWERFUL WOOD 272 | A WOOD NETSUKE OF A SHISHI 273 | A WOOD NETSUKE OF A SHISHI ROLLED INTO A BALL NETSUKE OF A SHISHI WITH BALL ATTRIBUTED TO TOMOCHIKA IN TAMETAKA STYLE Unsigned %\0DVDWRPRVLJQHG0DVDWRPR Unsigned, attributed to Tomochika Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Japan, Nagoya, early 19th century, Edo period (1615-1868) The netsuke is carved from wood and the ball, which resembles Nagoya school. Depicted is a seated roaring Shishi with bared Depicting a Shishi with a slightly crazed expression, placing one The Shishi is firmly clutching a ball and looking to the side with a a tama (magical pearl), is made from ivory. The expression is grim fangs, eyes with inlaid pupils and dense finely carved bushy curls paw firmly on a smooth ball in front of it. The bushy mane and tail whimsical expression, eyes inlaid. Well-carved curls and excellent with double-inlaid ivory eyes. Natural himotoshi, loose ball inside covering its tail, beard and head. The Shishi holds a brocade ball are well-carved. Natural himotoshi. himotoshi to the underside. In the manner of Tametaka. the mouth, and another opening on the underside, as to be between two paws and has its head turned. The underside with mounted on a cane. natural himotoshi and signature MASATOMO within a rectangular HEIGHT 4.1 cm HEIGHT 3.7 cm reserve. HEIGHT 2.7 cm Condition: Excellent condition with minor surface wear. &RQGLWLRQ([FHOOHQWFRQGLWLRQ%HDXWLIXOSDWLQD HEIGHT 3.5 cm 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Austrian private collection. Condition: Good condition with few smaller cracks in the wood. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: A small part of the base has been restored, otherwise Auction comparison: Compare to a related model attributed to Estimate EUR 600,- very good condition. 7RPRFKLNDVROGE\%RQKDPV)LQH-DSDQHVH$UW0D\ Starting price EUR 300,- Estimate EUR 500,- Provenance: French Private collection acquired in 1995 from an London, lot 40. Starting price EUR 250,- antiques dealer in Italy, by repute. Estimate EUR 800,- Estimate EUR 1.200,- Starting price EUR 400,- 275 | TWO FINE WOOD NETSUKE Starting price EUR 600,- 270 | A LARGE POWERFUL WOOD NETSUKE The eggplants by Masanao of Ise Yamada, signed Masanao OF A SHISHI ON A ROCK Japan, 19th century 274 | A RARE AND LARGE INLAID Unsigned 271 | NAKATSUGU: A LARGE WOOD NETSUKE WOOD NETSUKE OF A SHISHI Japan, 18th century, Edo period (1615-1868) OF A SHISHI WITH BALL The first depicting a fine group of five eggplants (nasubi), signed Unsigned MASANAO, the second a fine netsuke of a Shishi with ball. Signed Nakatsugu with kakihan Japan, 19th century, Edo period (1615-1868) A powerfully carved composition of a Shishi seated on a rock and Japan, 19th century, Edo period (1615-1868) HEIGHT 2.5 – 3.5 cm looking backwards. Himotoshi to the underside. The lion dog has its hind paw raised to scratch its chin. The eyes Condition: Very good condition. HEIGHT 4 cm, LENGTH 6 cm A large and powerful wood netsuke of a Shishi with a comical and individual swirls covering its body are inlaid in mother-of- Provenance: French private collection. expression, enhanced by large eyes inlaid in pale horn. The pearl. Condition: Good condition, remnants of black and red lacquer Shishi lets out an enigmatic snarl and places one paw firmly Estimate EUR 600,- 3URYHQDQFH%ULWLVKFROOHFWLRQ on a smooth round ball. The underside shows the very large HEIGHT 5.3 cm, LENGTH 6 cm Starting price EUR 300,- himotoshi (the other through its side) and the signature inside a Estimate EUR 800,- rectangular reserve NAKATSUGU with kakihan. Condition: Minor surface wear. Good condition. Starting price EUR 400,- 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 4.5 cm, LENGTH 5.5 cm Estimate EUR 600,- Condition: Good condition. The surface is slightly worn and there Starting price EUR 300,- is one thin crack by the right front leg. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Starting price EUR 300,- 86 87 268 | A WOOD NETSUKE OF A SHISHI 269 | MASATOMO: A POWERFUL WOOD 272 | A WOOD NETSUKE OF A SHISHI 273 | A WOOD NETSUKE OF A SHISHI ROLLED INTO A BALL NETSUKE OF A SHISHI WITH BALL ATTRIBUTED TO TOMOCHIKA IN TAMETAKA STYLE Unsigned %\0DVDWRPRVLJQHG0DVDWRPR Unsigned, attributed to Tomochika Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Japan, Nagoya, early 19th century, Edo period (1615-1868) The netsuke is carved from wood and the ball, which resembles Nagoya school. Depicted is a seated roaring Shishi with bared Depicting a Shishi with a slightly crazed expression, placing one The Shishi is firmly clutching a ball and looking to the side with a a tama (magical pearl), is made from ivory. The expression is grim fangs, eyes with inlaid pupils and dense finely carved bushy curls paw firmly on a smooth ball in front of it. The bushy mane and tail whimsical expression, eyes inlaid. Well-carved curls and excellent with double-inlaid ivory eyes. Natural himotoshi, loose ball inside covering its tail, beard and head. The Shishi holds a brocade ball are well-carved. Natural himotoshi. himotoshi to the underside. In the manner of Tametaka. the mouth, and another opening on the underside, as to be between two paws and has its head turned. The underside with mounted on a cane. natural himotoshi and signature MASATOMO within a rectangular HEIGHT 4.1 cm HEIGHT 3.7 cm reserve. HEIGHT 2.7 cm Condition: Excellent condition with minor surface wear. &RQGLWLRQ([FHOOHQWFRQGLWLRQ%HDXWLIXOSDWLQD HEIGHT 3.5 cm 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Austrian private collection. Condition: Good condition with few smaller cracks in the wood. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Condition: A small part of the base has been restored, otherwise Auction comparison: Compare to a related model attributed to Estimate EUR 600,- very good condition. 7RPRFKLNDVROGE\%RQKDPV)LQH-DSDQHVH$UW0D\ Starting price EUR 300,- Estimate EUR 500,- Provenance: French Private collection acquired in 1995 from an London, lot 40. Starting price EUR 250,- antiques dealer in Italy, by repute. Estimate EUR 800,- Estimate EUR 1.200,- Starting price EUR 400,- 275 | TWO FINE WOOD NETSUKE Starting price EUR 600,- 270 | A LARGE POWERFUL WOOD NETSUKE The eggplants by Masanao of Ise Yamada, signed Masanao OF A SHISHI ON A ROCK Japan, 19th century 274 | A RARE AND LARGE INLAID Unsigned 271 | NAKATSUGU: A LARGE WOOD NETSUKE WOOD NETSUKE OF A SHISHI Japan, 18th century, Edo period (1615-1868) OF A SHISHI WITH BALL The first depicting a fine group of five eggplants (nasubi), signed Unsigned MASANAO, the second a fine netsuke of a Shishi with ball. Signed Nakatsugu with kakihan Japan, 19th century, Edo period (1615-1868) A powerfully carved composition of a Shishi seated on a rock and Japan, 19th century, Edo period (1615-1868) HEIGHT 2.5 – 3.5 cm looking backwards. Himotoshi to the underside. The lion dog has its hind paw raised to scratch its chin. The eyes Condition: Very good condition. HEIGHT 4 cm, LENGTH 6 cm A large and powerful wood netsuke of a Shishi with a comical and individual swirls covering its body are inlaid in mother-of- Provenance: French private collection. expression, enhanced by large eyes inlaid in pale horn. The pearl. Condition: Good condition, remnants of black and red lacquer Shishi lets out an enigmatic snarl and places one paw firmly Estimate EUR 600,- 3URYHQDQFH%ULWLVKFROOHFWLRQ on a smooth round ball. The underside shows the very large HEIGHT 5.3 cm, LENGTH 6 cm Starting price EUR 300,- himotoshi (the other through its side) and the signature inside a Estimate EUR 800,- rectangular reserve NAKATSUGU with kakihan. Condition: Minor surface wear. Good condition. Starting price EUR 400,- 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 4.5 cm, LENGTH 5.5 cm Estimate EUR 600,- Condition: Good condition. The surface is slightly worn and there Starting price EUR 300,- is one thin crack by the right front leg. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Starting price EUR 300,- 86 87 276 | TWO IVORY NETSUKE OF 280 | WAHEI: A RARE PORCELAIN NETSUKE A TANUKI WITH RABBIT OF A TANUKI The first signed Tomoyuki, the second signed Hogyoku Sealed Wahei Japan, Meiji period (1868-1912) Japan, 19th century, Edo period (1615-1868) HEIGHT 3.4 and 4 cm In the shape of a tanuki holding a gourd-shaped flask in front of him and wearing a wide-brimmed hat. Sealed on the underside WAHEI. &RQGLWLRQ%RWKLQH[FHOOHQWFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 4 cm 277 | HIROMITSU: RARE BRONZE AND IVORY NETSUKE DEPICTING THE BUNBUKU CHAGAMA Estimate EUR 400,- Condition: Very good condition with minor wear to glaze. Starting price EUR 200,- 3URYHQDQFH%ULWLVKFROOHFWLRQ %\+LURPLWVXVLJQHG+LURPLWVX Estimate EUR 700,- Japan, 19th century, Edo period (1615-1868) Starting price EUR 350,- An unusual netsuke consisting of a bronze bowl and a rectangular ivory plate with a himotoshi loop in the back. The ivory plate depicts WKHOHJHQGIURP-DSDQHVHIRONORUHRIWKH%XQEXNX&KDJDPD)LQHO\ carved in shishiabori (sunken relief), the man is visibly delighted holding the tanuki tea kettle. Signature HIROMITSU in the front. LENGTH 4 cm 281 | HOGYOKU: A FINE IVORY NETSUKE OF A TANUKI PRIEST Condition: Very good condition, the bowl with some oxidation on the inside. %\+RJ\RNXVLJQHG+RJ\RNX 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Japan, Edo, mid-19th century, Edo period (1615-1868) Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 167. Estimate EUR 300,- A fine and precisely carved work with dark brown contrasting Starting price EUR 150,- staining of the ivory. The old crouched man has a monkey-like face, but that is not all. He is wearing a full-length garment, his hair in a bun, and is operating a barrel with one finely carved “hand”. A peak 278 | SHORAKU: AN IVORY AND MIXED METAL on the underside however reveals paws and a thick tail, which is not KAGAMIBUTA OF THE BUNBUKU CHAGAMA a monkey tail but that of a tanuki, which has the ability to shapeshift FOLKTALE and could transform into a priest. Small himotoshi on the side and the signature on the underside of the barrel HOGYOKU. The artist Signed Raku was a student of the great Hojitsu from Edo/Tokyo. Japan, 19th century HEIGHT 4 cm The bowl is made of ivory and the lid of iron with gold details Condition: Very good condition, small nerve channel visible in the GHSLFWLQJWKHOHJHQGRIWKH%XPEXNX&KDJDPD EDGJHUWHDNHWWOH back. According to Japanese folklore, a poor man sets a tanuki free, which 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ in return transforms into a kettle, so that the man can perform with it on the street and become wealthy. Estimate EUR 800,- Starting price EUR 400,- DIAMETER 4 cm Condition: A crack to the ivory, otherwise good worn condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 282 | A TALL WOOD NETSUKE 279 | A FINE MARINE IVORY NETSUKE OF A FOX PRIEST OF A NAMAZU WITH MAN Estimate EUR 300,- Starting price EUR 150,- Unsigned Unsigned Japan, 18th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Kitsune (fox) are creatures imbued with a lot of mythological The namazu is a mythological creature, a giant catfish that causes meaning, as they can change forms, like a tanuki, and are earthquakes when it moves. The only way to calm it is by using a believed to be animated by devils. In this netsuke the fox with a magical double-gourd (hyotan). This netsuke also shows a man, sly expression is disguised as a priest wearing the corresponding naked except for a loincloth and without the hyotan, his hands laid flowing robes and leaning on a cane, the paw that is visible is that of on the fish, evidently attempting to calm it, but without the gourd a DIR[%HDXWLIXOSDWLQDDQGJRRGLUUHJXODUKLPRWRVKLVKRZLQJVLJQV futile endeavor. The namazu’s eyes are inlaid with dark horn, large of wear through the back. and appear lurking. Himotoshi on the underside. HEIGHT 8 cm LENGTH 4.6 cm Condition: Old and smooth chip to the hem of the robe, otherwise Condition: Good condition, beautiful patina, possibly one eye good condition with a very good patina. replaced. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQVWRUHGLQDEDQNYDXOWIRU 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ years, collection no. 82. Estimate EUR 400,- Estimate EUR 600,- Starting price EUR 200,- Starting price EUR 300,- 88 89 276 | TWO IVORY NETSUKE OF 280 | WAHEI: A RARE PORCELAIN NETSUKE A TANUKI WITH RABBIT OF A TANUKI The first signed Tomoyuki, the second signed Hogyoku Sealed Wahei Japan, Meiji period (1868-1912) Japan, 19th century, Edo period (1615-1868) HEIGHT 3.4 and 4 cm In the shape of a tanuki holding a gourd-shaped flask in front of him and wearing a wide-brimmed hat. Sealed on the underside WAHEI. &RQGLWLRQ%RWKLQH[FHOOHQWFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ HEIGHT 4 cm 277 | HIROMITSU: RARE BRONZE AND IVORY NETSUKE DEPICTING THE BUNBUKU CHAGAMA Estimate EUR 400,- Condition: Very good condition with minor wear to glaze. Starting price EUR 200,- 3URYHQDQFH%ULWLVKFROOHFWLRQ %\+LURPLWVXVLJQHG+LURPLWVX Estimate EUR 700,- Japan, 19th century, Edo period (1615-1868) Starting price EUR 350,- An unusual netsuke consisting of a bronze bowl and a rectangular ivory plate with a himotoshi loop in the back. The ivory plate depicts WKHOHJHQGIURP-DSDQHVHIRONORUHRIWKH%XQEXNX&KDJDPD)LQHO\ carved in shishiabori (sunken relief), the man is visibly delighted holding the tanuki tea kettle. Signature HIROMITSU in the front. LENGTH 4 cm 281 | HOGYOKU: A FINE IVORY NETSUKE OF A TANUKI PRIEST Condition: Very good condition, the bowl with some oxidation on the inside. %\+RJ\RNXVLJQHG+RJ\RNX 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Japan, Edo, mid-19th century, Edo period (1615-1868) Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 167. Estimate EUR 300,- A fine and precisely carved work with dark brown contrasting Starting price EUR 150,- staining of the ivory. The old crouched man has a monkey-like face, but that is not all. He is wearing a full-length garment, his hair in a bun, and is operating a barrel with one finely carved “hand”. A peak 278 | SHORAKU: AN IVORY AND MIXED METAL on the underside however reveals paws and a thick tail, which is not KAGAMIBUTA OF THE BUNBUKU CHAGAMA a monkey tail but that of a tanuki, which has the ability to shapeshift FOLKTALE and could transform into a priest. Small himotoshi on the side and the signature on the underside of the barrel HOGYOKU. The artist Signed Raku was a student of the great Hojitsu from Edo/Tokyo. Japan, 19th century HEIGHT 4 cm The bowl is made of ivory and the lid of iron with gold details Condition: Very good condition, small nerve channel visible in the GHSLFWLQJWKHOHJHQGRIWKH%XPEXNX&KDJDPD EDGJHUWHDNHWWOH back. According to Japanese folklore, a poor man sets a tanuki free, which 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ in return transforms into a kettle, so that the man can perform with it on the street and become wealthy. Estimate EUR 800,- Starting price EUR 400,- DIAMETER 4 cm Condition: A crack to the ivory, otherwise good worn condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 282 | A TALL WOOD NETSUKE 279 | A FINE MARINE IVORY NETSUKE OF A FOX PRIEST OF A NAMAZU WITH MAN Estimate EUR 300,- Starting price EUR 150,- Unsigned Unsigned Japan, 18th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Kitsune (fox) are creatures imbued with a lot of mythological The namazu is a mythological creature, a giant catfish that causes meaning, as they can change forms, like a tanuki, and are earthquakes when it moves. The only way to calm it is by using a believed to be animated by devils. In this netsuke the fox with a magical double-gourd (hyotan). This netsuke also shows a man, sly expression is disguised as a priest wearing the corresponding naked except for a loincloth and without the hyotan, his hands laid flowing robes and leaning on a cane, the paw that is visible is that of on the fish, evidently attempting to calm it, but without the gourd a DIR[%HDXWLIXOSDWLQDDQGJRRGLUUHJXODUKLPRWRVKLVKRZLQJVLJQV futile endeavor. The namazu’s eyes are inlaid with dark horn, large of wear through the back. and appear lurking. Himotoshi on the underside. HEIGHT 8 cm LENGTH 4.6 cm Condition: Old and smooth chip to the hem of the robe, otherwise Condition: Good condition, beautiful patina, possibly one eye good condition with a very good patina. replaced. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQVWRUHGLQDEDQNYDXOWIRU 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ years, collection no. 82. Estimate EUR 400,- Estimate EUR 600,- Starting price EUR 200,- Starting price EUR 300,- 88 89 283 | A POWERFUL WOOD NETSUKE 286 | FURAI: A WOOD NETSUKE OF A WOLF WITH A SKULL OF TENGU NO TAMAGO Unsigned Signed Furai Japan, 18th century, Edo period (1615-1868) Japan, 18th century The wolf is large as well as finely and expressively carved, the Depicting a tengu hatching from its egg, both wings spread reddish wood polished to a shine and with black staining for over the shell. The mythical creature wearing a tokin cap, the contrast. “Okami” for wolf is homophonous to Okami, meaning underside is signed “FURAI, eighty-two years old”. “great god”, as the wolf used to be called out of respect for the animal. Natural himotoshi between the legs and through the skull. A LENGHT 4 cm powerful and early netsuke. Condition: Very good condition. HEIGHT 3.6 cm, LENGTH 5.5 cm Provenance: European private collection. Condition: One of the lower incisors is chipped otherwise good Estimate EUR 400,- condition with minor wear and a good patina. Starting price EUR 200,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 105. 287 | TWO IVORY NETSUKE Estimate EUR 800,- The first signed Shungyoku, the other unsigned Starting price EUR 400,- Japan, 19th century, Edo period (1615-1868) The first an ivory netsuke of a monkey on top of a large and flat fish. Finely carved and the fish with finely inlaid eyes. The second of the luck deity Ebisu with puffer fish. HEIGHT 2.2 and 3 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQZLWKH[SHFWHGZHDUDQG minor age cracks. 284 | AN EBONY WOOD NETSUKE OF A SKULL 3URYHQDQFH%ULWLVKFROOHFWLRQ Unsigned Estimate EUR 800,- Japan, late 19th century Starting price EUR 400,- An anatomically quite accurate skull, a symbol of mortality. Large staring eyes and well-carved individual teeth in the upper jaw. 288 | DERKACHENKO: A BOXWOOD NETSUKE OF TENGU NO TOMAGO LENGTH 3.5 cm %\$OH[DQGHU'HUNDFKHQNRVLJQHG'HUNDFKHQNR Condition: Good worn condition with few surface scratches. Ukraine, 2018 Provenance: European private collection. Estimate EUR 800,- Finely carved from stained boxwood and depicting a tengu Starting price EUR 400,- hatching from an egg. Finely carved details, such as the feather work, expression and crisply carved claw visible on the underside. Himotoshi in the back next to the inlaid artist’s signature. HEIGHT 3 cm Condition: Excellent condition. 285 | A VERY RARE HORNBILL IVORY NETSUKE Estimate EUR 400,- OF A COCKEREL AND HEN Starting price EUR 200,- Unsigned 289 | TWO WOOD NETSUKE OF A FROG Japan, late 19th century AND A MINOGAME Unsigned Hornbill ivory netsuke (from the helmeted hornbill or rhinoplax vigil) Japan, 19th century are very rare. The shape of the beak is recognizable in this netsuke, with the tapering end being wafer-thin, and the red section of the bill being expressed on the sides. The two birds are huddled side The first depicting a frog on a lotus leaf and the second a by side looking askance at each other. The plumage is very well minogame on an awabi, both the “straw raincoat-turtle” carved, himotoshi on the reverse and the eyes inlaid with the red PLQRJDPHbDQGWKHDZDELVKHOODUHV\PEROVRIORQJHYLW\ material from the horn. LENGTH 4 - 4.7 cm HEIGHT 5 cm Condition: Overall good condition, the first with minor losses to Condition: Excellent condition. webbed feet, the second with two tiny chips. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 900,- Starting price EUR 300,- Starting price EUR 450,- 90 91 283 | A POWERFUL WOOD NETSUKE 286 | FURAI: A WOOD NETSUKE OF A WOLF WITH A SKULL OF TENGU NO TAMAGO Unsigned Signed Furai Japan, 18th century, Edo period (1615-1868) Japan, 18th century The wolf is large as well as finely and expressively carved, the Depicting a tengu hatching from its egg, both wings spread reddish wood polished to a shine and with black staining for over the shell. The mythical creature wearing a tokin cap, the contrast. “Okami” for wolf is homophonous to Okami, meaning underside is signed “FURAI, eighty-two years old”. “great god”, as the wolf used to be called out of respect for the animal. Natural himotoshi between the legs and through the skull. A LENGHT 4 cm powerful and early netsuke. Condition: Very good condition. HEIGHT 3.6 cm, LENGTH 5.5 cm Provenance: European private collection. Condition: One of the lower incisors is chipped otherwise good Estimate EUR 400,- condition with minor wear and a good patina. Starting price EUR 200,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 105. 287 | TWO IVORY NETSUKE Estimate EUR 800,- The first signed Shungyoku, the other unsigned Starting price EUR 400,- Japan, 19th century, Edo period (1615-1868) The first an ivory netsuke of a monkey on top of a large and flat fish. Finely carved and the fish with finely inlaid eyes. The second of the luck deity Ebisu with puffer fish. HEIGHT 2.2 and 3 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQZLWKH[SHFWHGZHDUDQG minor age cracks. 284 | AN EBONY WOOD NETSUKE OF A SKULL 3URYHQDQFH%ULWLVKFROOHFWLRQ Unsigned Estimate EUR 800,- Japan, late 19th century Starting price EUR 400,- An anatomically quite accurate skull, a symbol of mortality. Large staring eyes and well-carved individual teeth in the upper jaw. 288 | DERKACHENKO: A BOXWOOD NETSUKE OF TENGU NO TOMAGO LENGTH 3.5 cm %\$OH[DQGHU'HUNDFKHQNRVLJQHG'HUNDFKHQNR Condition: Good worn condition with few surface scratches. Ukraine, 2018 Provenance: European private collection. Estimate EUR 800,- Finely carved from stained boxwood and depicting a tengu Starting price EUR 400,- hatching from an egg. Finely carved details, such as the feather work, expression and crisply carved claw visible on the underside. Himotoshi in the back next to the inlaid artist’s signature. HEIGHT 3 cm Condition: Excellent condition. 285 | A VERY RARE HORNBILL IVORY NETSUKE Estimate EUR 400,- OF A COCKEREL AND HEN Starting price EUR 200,- Unsigned 289 | TWO WOOD NETSUKE OF A FROG Japan, late 19th century AND A MINOGAME Unsigned Hornbill ivory netsuke (from the helmeted hornbill or rhinoplax vigil) Japan, 19th century are very rare. The shape of the beak is recognizable in this netsuke, with the tapering end being wafer-thin, and the red section of the bill being expressed on the sides. The two birds are huddled side The first depicting a frog on a lotus leaf and the second a by side looking askance at each other. The plumage is very well minogame on an awabi, both the “straw raincoat-turtle” carved, himotoshi on the reverse and the eyes inlaid with the red PLQRJDPHbDQGWKHDZDELVKHOODUHV\PEROVRIORQJHYLW\ material from the horn. LENGTH 4 - 4.7 cm HEIGHT 5 cm Condition: Overall good condition, the first with minor losses to Condition: Excellent condition. webbed feet, the second with two tiny chips. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,- Estimate EUR 900,- Starting price EUR 300,- Starting price EUR 450,- 90 91 290 | RANSEN: AN IVORY NETSUKE 294 | A RARE IVORY NETSUKE OF A CAT OF A STAG ON BASE AND A SMALL MONKEY %\5DQVHQVLJQHG5DQVHQ Unsigned Japan, Kyoto, late 19th century Japan, first half of the 19th century, Edo period (1615-1868) The deer has its head titled backwards and is looking downwards The large, recumbent cat (neko) forms a circle, its long tail does with beautifully double-inlaid eyes in black and pale-translucent so as well. It is wearing a collar and appears to be quite pleased. horn. Its body is contorted and supported on finely carved thin legs. A small monkey, tiny compared to the cat, is climbing on its back, The entire composition is set on a stippled base, smooth on the 293 | AN EARLY AND FINE IVORY NETSUKE and holds a peach in its paw, a symbol of longevity. Very well- underside where also the two small himotoshi are located as well OF A PIEBALD CAT ON STRAW BROOM rounded composition, fine patina, very large himotoshi on the as the signature RANSEN in a rounded reserve. School of Hogen underside. Ranten of Kyoto. Unsigned Japan, mid-18th century, Edo period (1615-1868) HEIGHT 2.1 cm, LENGTH 3.8 cm HEIGHT 3.7 cm Condition: One paw reattached, otherwise good condition with Condition: Very good condition, four age cracks through the body An early ivory netsuke with an incredibly rich honey patina few age cracks and stunning patina, especially on the underside. and some wear to the black coloring across the spine. depicting a domesticated piebald cat lying densely curled up on 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP 3URYHQDQFH%ULWLVKFROOHFWLRQ a straw broom. The surface on the broom is very well carved and Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 33. the himotoshi are on the underside and exactly as they should Estimate EUR 400,- be. Estimate EUR 600,- Starting price EUR 200,- Starting price EUR 300,- LENGTH 4.5 cm Condition: Several age cracks, very fine patina. The stem of the broom has been lost. It appears that the cat is carved separately as a metal screw on the underside holds in place. Another metal screw has previously held the stem of the broom in place as well. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 291 | A FINE IVORY NETSUKE 159. OF A RECUMBENT DEER Estimate EUR 400,- Unsigned Starting price EUR 200,- Japan, first half of the 19th century, Edo period (1615-1868) A very sensitive, animated and finely elegant depiction of a spotted deer (shika). The deer has its head turned back with a friendly face with black inlaid eyes and long curved antlers attached on the back. The leg composition on the underside is appealing. Good himotoshi on the underside. 296 | A WOOD NETSUKE OF A CAPARISONED HEIGHT 2.7 cm, LENGTH 4.4 cm ELEPHANT ON A BASE Condition: Very good condition, the surface of the ivory slightly Unsigned worn, and one eye is not original. Japan, 19th century, Edo period (1615-1868) Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 1.500,- A wood netsuke depicting a caparisoned elephant with a jovial Starting price EUR 750,- expression standing on a base. The ornately decorated saddle is well-carved, as are the many skin folds and clawed feet. Singular central himotoshi through the base. 295 | A WOOD NETSUKE OF A SLEEPING PIEBALD CAT ON A FAN HEIGHT 3.6 cm Unsigned Condition: Very good and original condition. Japan, early 19th century, Edo period (1615-1868) 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP 292 | AN IVORY NETSUKE OF A Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. RECUMBENT SHIKA DEER 106. The well-fed piebald cat (neko) is lying curled up on a large fan Unsigned with its head resting on the crossed paws in front of it. The eyes Estimate EUR 400,- Japan, 19th century, Edo period (1615-1868) are closed, and its expression is the epitome of calmness with Starting price EUR 200,- a hint of fatigue. The underside with the finely carved ribbed surface of the fan and perfectly crafted, asymmetrical himotoshi. An elegant depiction of a spotted deer (shika). The deer has its head turned back, the eyes inlaid in black and with its tongue HEIGHT 2.2 cm, LENGTH 4.8 cm sticking out. Condition: Very good condition. Miniscule age-related nicks and LENGTH 5 cm wear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Condition: Good condition with expected age cracks. Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory Provenance: European private collection. no. 133. Estimate EUR 1.200,- Estimate EUR 600,- Starting price EUR 600,- Starting price EUR 300,- 92 93 290 | RANSEN: AN IVORY NETSUKE 294 | A RARE IVORY NETSUKE OF A CAT OF A STAG ON BASE AND A SMALL MONKEY %\5DQVHQVLJQHG5DQVHQ Unsigned Japan, Kyoto, late 19th century Japan, first half of the 19th century, Edo period (1615-1868) The deer has its head titled backwards and is looking downwards The large, recumbent cat (neko) forms a circle, its long tail does with beautifully double-inlaid eyes in black and pale-translucent so as well. It is wearing a collar and appears to be quite pleased. horn. Its body is contorted and supported on finely carved thin legs. A small monkey, tiny compared to the cat, is climbing on its back, The entire composition is set on a stippled base, smooth on the 293 | AN EARLY AND FINE IVORY NETSUKE and holds a peach in its paw, a symbol of longevity. Very well- underside where also the two small himotoshi are located as well OF A PIEBALD CAT ON STRAW BROOM rounded composition, fine patina, very large himotoshi on the as the signature RANSEN in a rounded reserve. School of Hogen underside. Ranten of Kyoto. Unsigned Japan, mid-18th century, Edo period (1615-1868) HEIGHT 2.1 cm, LENGTH 3.8 cm HEIGHT 3.7 cm Condition: One paw reattached, otherwise good condition with Condition: Very good condition, four age cracks through the body An early ivory netsuke with an incredibly rich honey patina few age cracks and stunning patina, especially on the underside. and some wear to the black coloring across the spine. depicting a domesticated piebald cat lying densely curled up on 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP 3URYHQDQFH%ULWLVKFROOHFWLRQ a straw broom. The surface on the broom is very well carved and Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 33. the himotoshi are on the underside and exactly as they should Estimate EUR 400,- be. Estimate EUR 600,- Starting price EUR 200,- Starting price EUR 300,- LENGTH 4.5 cm Condition: Several age cracks, very fine patina. The stem of the broom has been lost. It appears that the cat is carved separately as a metal screw on the underside holds in place. Another metal screw has previously held the stem of the broom in place as well. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 291 | A FINE IVORY NETSUKE 159. OF A RECUMBENT DEER Estimate EUR 400,- Unsigned Starting price EUR 200,- Japan, first half of the 19th century, Edo period (1615-1868) A very sensitive, animated and finely elegant depiction of a spotted deer (shika). The deer has its head turned back with a friendly face with black inlaid eyes and long curved antlers attached on the back. The leg composition on the underside is appealing. Good himotoshi on the underside. 296 | A WOOD NETSUKE OF A CAPARISONED HEIGHT 2.7 cm, LENGTH 4.4 cm ELEPHANT ON A BASE Condition: Very good condition, the surface of the ivory slightly Unsigned worn, and one eye is not original. Japan, 19th century, Edo period (1615-1868) Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 1.500,- A wood netsuke depicting a caparisoned elephant with a jovial Starting price EUR 750,- expression standing on a base. The ornately decorated saddle is well-carved, as are the many skin folds and clawed feet. Singular central himotoshi through the base. 295 | A WOOD NETSUKE OF A SLEEPING PIEBALD CAT ON A FAN HEIGHT 3.6 cm Unsigned Condition: Very good and original condition. Japan, early 19th century, Edo period (1615-1868) 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP 292 | AN IVORY NETSUKE OF A Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. RECUMBENT SHIKA DEER 106. The well-fed piebald cat (neko) is lying curled up on a large fan Unsigned with its head resting on the crossed paws in front of it. The eyes Estimate EUR 400,- Japan, 19th century, Edo period (1615-1868) are closed, and its expression is the epitome of calmness with Starting price EUR 200,- a hint of fatigue. The underside with the finely carved ribbed surface of the fan and perfectly crafted, asymmetrical himotoshi. An elegant depiction of a spotted deer (shika). The deer has its head turned back, the eyes inlaid in black and with its tongue HEIGHT 2.2 cm, LENGTH 4.8 cm sticking out. Condition: Very good condition. Miniscule age-related nicks and LENGTH 5 cm wear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Condition: Good condition with expected age cracks. Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory Provenance: European private collection. no. 133. Estimate EUR 1.200,- Estimate EUR 600,- Starting price EUR 600,- Starting price EUR 300,- 92 93 297 | A LARGE WOOD SASHI NETSUKE 302 | A WOOD NETSUKE OF A GROUP OF COINS OF A DRIED SALMON (WITH IVORY) Unsigned Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Five piles of five coins each on top of each other with a square The large dried fish carved from lightly colored wood and hole in the center, except for one group with a circular hole. accentuated with black lacquer. A fish market scene carved with Different line patterns are neatly incised, and the wood is an incredibly sense of realism. The scaly body is desiccating with colored. Natural himotoshi. different levels of elevation on the surface. With a large inlaid ivory tablet reading Ǖᶀ, relating to the origin of the salmon. LENGTH 6.1 cm LENGTH 15.5 cm Condition: Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQROGLQYHQWRU\QXPEHU Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 298 | A FINE IVORY NETSUKE OF A Estimate EUR 400,- BAMBOO STALK VESSEL Starting price EUR 200,- Estimate EUR 400,- Starting price EUR 200,- Unsigned Japan, 19th century, Edo period (1615-1868) A finely polished, elegant netsuke of a vessel made from a EDPERRVWDONWKHLQVLGHKROORZHGRXWYHU\ZHOO%DPERR WDNH is a symbol of loyalty and longevity, as it is flexible and tough but of a poetic appearance. The bamboo leaves in high relief on the front evoke this idea particularly well. Singular himotoshi on the reverse. HEIGHT 3.6 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 57. Estimate EUR 600,- Starting price EUR 300,- 303 | TWO WOOD NETSUKE OF A FRUIT 299 | A RARE HAKO PEACH PIT NETSUKE 300 | AN UNUSUAL AND LARGE STAG ANTLER AND A GOURD OF A CRAB, FISH AND LOBSTER AND WOOD HAKO NETSUKE WITH LOTUS AND CRAB PEONY Unsigned Japan, 19th century Unsigned Japan, 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) The first a fine netsuke of a group of fruits, the largest partly peeled and attached to a stalk and leaf, the inside showing an The netsuke consists of two parts, the top section shows the inlaid fruit. The second a rustic depiction of a gourd. crab shell (carapace). The base shows the underside and pincers A rare and functional hako netsuke. The bowl in the form of a and at the bottom a fish and a lobster. The cord attachment is lotus leaf, the veiny structure visible on the underside, and the LENGTH 3.5 – 4.5 cm provided through a loop on the inside of the top section. top section decorated with many clouds. The inside is hollowed out, with the natural bony structure of the inside of the material Condition: The first in very good condition, the second with a LENGTH 3.5 cm visible, and was used to store something, most likely medicine or 301 | RYUSAI: A LARGE ASAKUSA SCHOOL restoration and few chips. herbs. The lid is carved from kokutan (ebony) and incised with a OBIHASAMI STAG ANTLER NETSUKE 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: Minor wear and a thin crack, otherwise good crab peony on the top. The lid is hinged with metal fittings and WITH REISHI condition. screws and opens and closes perfectly. The himotoshi through a Estimate EUR 400,- Provenance: European private collection. carved looped handle on the underside. %\5\XVDLVLJQHG5\XVDLZLWKVHDONRNX Starting price EUR 200,- Japan, Tokyo, Asakusa School, second half of 19th century Estimate EUR 800,- DIAMETER 6 cm Starting price EUR 400,- Condition: Excellent condition. A large obi-hasami (inserted into the belt) stag antler netsuke in Provenance: The 40-Year Collection of a London Gentleman. the form of a long growth of eight reishi mushrooms, attached to one thick stem, beautifully and elegantly intertwining with each Estimate EUR 300,- other. Reishi fungus are a symbol for longevity, and the number Starting price EUR 150,- eight is considered lucky – making this an emblem of long life and luck. Signed RYUSAI with seal koku. School of Ozaki Kokusai. HEIGHT 22.8 cm Condition: A section (roughly 2.5 cm) of a stem of one reishi has been restored. Otherwise excellent condition. 3URYHQDQFH%ULWLVKFROOHFWLRQSUHYLRXVO\RIIHUHGDW%RQKDPV Fine Japanese Art, 10 November 2016, lot 327. Two views Estimate EUR 1.200,- Starting price EUR 600,- 94 95 297 | A LARGE WOOD SASHI NETSUKE 302 | A WOOD NETSUKE OF A GROUP OF COINS OF A DRIED SALMON (WITH IVORY) Unsigned Unsigned Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) Five piles of five coins each on top of each other with a square The large dried fish carved from lightly colored wood and hole in the center, except for one group with a circular hole. accentuated with black lacquer. A fish market scene carved with Different line patterns are neatly incised, and the wood is an incredibly sense of realism. The scaly body is desiccating with colored. Natural himotoshi. different levels of elevation on the surface. With a large inlaid ivory tablet reading Ǖᶀ, relating to the origin of the salmon. LENGTH 6.1 cm LENGTH 15.5 cm Condition: Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQROGLQYHQWRU\QXPEHU Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 298 | A FINE IVORY NETSUKE OF A Estimate EUR 400,- BAMBOO STALK VESSEL Starting price EUR 200,- Estimate EUR 400,- Starting price EUR 200,- Unsigned Japan, 19th century, Edo period (1615-1868) A finely polished, elegant netsuke of a vessel made from a EDPERRVWDONWKHLQVLGHKROORZHGRXWYHU\ZHOO%DPERR WDNH is a symbol of loyalty and longevity, as it is flexible and tough but of a poetic appearance. The bamboo leaves in high relief on the front evoke this idea particularly well. Singular himotoshi on the reverse. HEIGHT 3.6 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 57. Estimate EUR 600,- Starting price EUR 300,- 303 | TWO WOOD NETSUKE OF A FRUIT 299 | A RARE HAKO PEACH PIT NETSUKE 300 | AN UNUSUAL AND LARGE STAG ANTLER AND A GOURD OF A CRAB, FISH AND LOBSTER AND WOOD HAKO NETSUKE WITH LOTUS AND CRAB PEONY Unsigned Japan, 19th century Unsigned Japan, 19th century, Edo period (1615-1868) Unsigned Japan, 19th century, Edo period (1615-1868) The first a fine netsuke of a group of fruits, the largest partly peeled and attached to a stalk and leaf, the inside showing an The netsuke consists of two parts, the top section shows the inlaid fruit. The second a rustic depiction of a gourd. crab shell (carapace). The base shows the underside and pincers A rare and functional hako netsuke. The bowl in the form of a and at the bottom a fish and a lobster. The cord attachment is lotus leaf, the veiny structure visible on the underside, and the LENGTH 3.5 – 4.5 cm provided through a loop on the inside of the top section. top section decorated with many clouds. The inside is hollowed out, with the natural bony structure of the inside of the material Condition: The first in very good condition, the second with a LENGTH 3.5 cm visible, and was used to store something, most likely medicine or 301 | RYUSAI: A LARGE ASAKUSA SCHOOL restoration and few chips. herbs. The lid is carved from kokutan (ebony) and incised with a OBIHASAMI STAG ANTLER NETSUKE 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: Minor wear and a thin crack, otherwise good crab peony on the top. The lid is hinged with metal fittings and WITH REISHI condition. screws and opens and closes perfectly. The himotoshi through a Estimate EUR 400,- Provenance: European private collection. carved looped handle on the underside. %\5\XVDLVLJQHG5\XVDLZLWKVHDONRNX Starting price EUR 200,- Japan, Tokyo, Asakusa School, second half of 19th century Estimate EUR 800,- DIAMETER 6 cm Starting price EUR 400,- Condition: Excellent condition. A large obi-hasami (inserted into the belt) stag antler netsuke in Provenance: The 40-Year Collection of a London Gentleman. the form of a long growth of eight reishi mushrooms, attached to one thick stem, beautifully and elegantly intertwining with each Estimate EUR 300,- other. Reishi fungus are a symbol for longevity, and the number Starting price EUR 150,- eight is considered lucky – making this an emblem of long life and luck. Signed RYUSAI with seal koku. School of Ozaki Kokusai. HEIGHT 22.8 cm Condition: A section (roughly 2.5 cm) of a stem of one reishi has been restored. Otherwise excellent condition. 3URYHQDQFH%ULWLVKFROOHFWLRQSUHYLRXVO\RIIHUHGDW%RQKDPV Fine Japanese Art, 10 November 2016, lot 327. Two views Estimate EUR 1.200,- Starting price EUR 600,- 94 95 305 | AN IVORY MANJU NETSUKE AND AN IVORY BELT BUCKLE Unsigned Japan, 19th century to Meiji period (1868-1912) The lot consists of an ivory manju netsuke and an ivory belt Two views buckle. The manju depicts a crab-fishing boy surprised by the appearance of a female crab with many eggs on top. The belt buckle showing a courtesan with a man behind her. 304 | A RARE, UNUSUAL AND LARGE IVORY MANJU 308 | KOJU: IVORY MANJU NETSUKE NETSUKE WITH CALLIGRAPHY LISTING 62 OF DIAMETER manju c. 5.3 cm, SIZE belt buckle 3.2 x 3 x 0.7 cm WITH FISHING KARAKO 69 STATIONS OF THE KISO KAIDO ROAD (H x L x W) %\.RMXVLJQHG.RMXZLWKNDNLKDQ Unsigned Condition: The manju and belt buckle with age cracks and minor Japan, Edo/Tokyo, mid-19th century Japan, 19th century, Edo period (1615-1868) surface scratches. Complete condition. Provenance: Old Zagreb private collection. An ivory two-part manju carved in shishiabori (sunken relief) 309 | A WOOD MANJU NETSUKE OF A WARRIOR This rare and unusually thick manju has a very good feel in the Estimate EUR 500,- depicting two karako fishing in a basin. One has his hands hand and is stained to great effect. Inscribed meticulously in Starting price EUR 250,- entirely submerged inside the basin while the other, visibly Unsigned 62 rectangular reserves are 62 of 69 stations of the Kiso Kaido delighted, is pulling out a small fish. One of the boys is wearing Japan, 19th century, Edo period (1615-1868) road, which originates from a series of woodblock prints titled a peculiar cape with engraved turtle shell patterns. The reverse ‘the sixty-nine stations of the Kiso Kaido’ created by Utagawa finely incised with a scarecrow, votive tablet (ema) and crane Hiroshige and Keisai Eisen. 62 of these 69 stations are inscribed inside a bonseki (miniature landscape). Central hole for himotoshi A two-part wood manju netsuke showing a warrior against on both sides of this manju next to a serene drawing of a bird and signed KOJU with characteristic red kao. an asanoha-ground. The backside shows a finely carved and flower. On the reverse the inscription “sixty-nine stations” chrysanthemum. This manju was likely supposed to be lacquered and “Tsugi”. Himotoshi through the center with a peg to tie the DIAMETER 4.7 cm in tsuishu red. cord. Condition: Very good condition, minor discoloration around the DIAMETER c. 5 cm DIAMETER 4.8 cm, HEIGHT 1.6 cm himotoshi. Provenance: Ex Herbert Mew Collection, Dorset UK (1881-1946). Condition: Good condition, remnants of black lacquer. Condition: An approximately 2.5 cm wide crack is faintly visible on Provenance: Austrian private collection. both sides; otherwise in very good condition. Estimate EUR 600,- Provenance: Collection of Sam Felton with CITES permit no. Starting price EUR 300,- Estimate EUR 500,- 18US59513C/9. Purchased from Norman L. Sanfield on 18th Starting price EUR 250,- August 1979 (old invoice available). Estimate EUR 400,- Starting price EUR 200,- 311 | KAZUMASA: A WOOD TWO-PART MANJU NETSUKE Signed Kazumasa Japan, 19th century, Edo period (1615-1868) 307 | SHUNGYOKU: AN UNUSUAL INLAID EBONY WOOD INLAID NETSUKE WITH TEA MERCHANT Carved in high relief with an image of a fierce warrior holding a staff. The backside with finely engraved tumbling waves and Signed Shungyoku signature KAZUMASA. Japan, 19th century, Edo period (1615-1868) DIAMETER c. 4.7 cm An ebony wood two-part manju, carved in the front with a Condition: Minor associated wear. smoking tea merchant carrying his wares suspended from his Provenance: French private collection. neck and with an ivory-inlaid parasol next to him. The pipe’s smoke is amusingly depicted with bubbles inlaid in ivory and 310 | AN INLAID WALRUS TUSK IVORY Estimate EUR 500,- mother of pearl. The backside shows a carved crawling infant, the RYUSA MANJU DEPICTING RIHAKU Starting price EUR 250,- signature SHUNGYOKU and central floral himotoshi. Unsigned DIAMETER 4 cm Japan, Asakusa, mid to late 19th century Condition: Minor nicks, surface wear, discoloration. Good worn condition. A beautiful choice piece of walrus tusk ivory carved into a luscious 306 | TWO CIRCULAR FINE PRESSED Provenance: European private collection. ryusa manju depicting leafy stalks of bamboo, a thatched hut and HORN MANJU NETSUKE many clouds. The center is inlaid with a silver-gilt figure depicting Estimate EUR 600,- WKHSRHW5LKDNX LQ&KLQD/L%DL QH[WWRDKXJHGRXEOHJRXUG The second signed Starting price EUR 300,- filled with sake (the drink of the immortals). Central himotoshi in Japan, 19th century the back. DIAMETER 4.1 cm, WIDTH 2.3 cm DIAMETER 4.3 and 4 cm Condition: Very good condition, the facial features on the inlay &RQGLWLRQ%RWKULPVZLWKFKLSVDQGH[SHFWHGFUDFNOLQJ slightly worn. 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Austrian private collection. Estimate EUR 400,- Estimate EUR 800,- Starting price EUR 200,- Starting price EUR 400,- 96 97 305 | AN IVORY MANJU NETSUKE AND AN IVORY BELT BUCKLE Unsigned Japan, 19th century to Meiji period (1868-1912) The lot consists of an ivory manju netsuke and an ivory belt Two views buckle. The manju depicts a crab-fishing boy surprised by the appearance of a female crab with many eggs on top. The belt buckle showing a courtesan with a man behind her. 304 | A RARE, UNUSUAL AND LARGE IVORY MANJU 308 | KOJU: IVORY MANJU NETSUKE NETSUKE WITH CALLIGRAPHY LISTING 62 OF DIAMETER manju c. 5.3 cm, SIZE belt buckle 3.2 x 3 x 0.7 cm WITH FISHING KARAKO 69 STATIONS OF THE KISO KAIDO ROAD (H x L x W) %\.RMXVLJQHG.RMXZLWKNDNLKDQ Unsigned Condition: The manju and belt buckle with age cracks and minor Japan, Edo/Tokyo, mid-19th century Japan, 19th century, Edo period (1615-1868) surface scratches. Complete condition. Provenance: Old Zagreb private collection. An ivory two-part manju carved in shishiabori (sunken relief) 309 | A WOOD MANJU NETSUKE OF A WARRIOR This rare and unusually thick manju has a very good feel in the Estimate EUR 500,- depicting two karako fishing in a basin. One has his hands hand and is stained to great effect. Inscribed meticulously in Starting price EUR 250,- entirely submerged inside the basin while the other, visibly Unsigned 62 rectangular reserves are 62 of 69 stations of the Kiso Kaido delighted, is pulling out a small fish. One of the boys is wearing Japan, 19th century, Edo period (1615-1868) road, which originates from a series of woodblock prints titled a peculiar cape with engraved turtle shell patterns. The reverse ‘the sixty-nine stations of the Kiso Kaido’ created by Utagawa finely incised with a scarecrow, votive tablet (ema) and crane Hiroshige and Keisai Eisen. 62 of these 69 stations are inscribed inside a bonseki (miniature landscape). Central hole for himotoshi A two-part wood manju netsuke showing a warrior against on both sides of this manju next to a serene drawing of a bird and signed KOJU with characteristic red kao. an asanoha-ground. The backside shows a finely carved and flower. On the reverse the inscription “sixty-nine stations” chrysanthemum. This manju was likely supposed to be lacquered and “Tsugi”. Himotoshi through the center with a peg to tie the DIAMETER 4.7 cm in tsuishu red. cord. Condition: Very good condition, minor discoloration around the DIAMETER c. 5 cm DIAMETER 4.8 cm, HEIGHT 1.6 cm himotoshi. Provenance: Ex Herbert Mew Collection, Dorset UK (1881-1946). Condition: Good condition, remnants of black lacquer. Condition: An approximately 2.5 cm wide crack is faintly visible on Provenance: Austrian private collection. both sides; otherwise in very good condition. Estimate EUR 600,- Provenance: Collection of Sam Felton with CITES permit no. Starting price EUR 300,- Estimate EUR 500,- 18US59513C/9. Purchased from Norman L. Sanfield on 18th Starting price EUR 250,- August 1979 (old invoice available). Estimate EUR 400,- Starting price EUR 200,- 311 | KAZUMASA: A WOOD TWO-PART MANJU NETSUKE Signed Kazumasa Japan, 19th century, Edo period (1615-1868) 307 | SHUNGYOKU: AN UNUSUAL INLAID EBONY WOOD INLAID NETSUKE WITH TEA MERCHANT Carved in high relief with an image of a fierce warrior holding a staff. The backside with finely engraved tumbling waves and Signed Shungyoku signature KAZUMASA. Japan, 19th century, Edo period (1615-1868) DIAMETER c. 4.7 cm An ebony wood two-part manju, carved in the front with a Condition: Minor associated wear. smoking tea merchant carrying his wares suspended from his Provenance: French private collection. neck and with an ivory-inlaid parasol next to him. The pipe’s smoke is amusingly depicted with bubbles inlaid in ivory and 310 | AN INLAID WALRUS TUSK IVORY Estimate EUR 500,- mother of pearl. The backside shows a carved crawling infant, the RYUSA MANJU DEPICTING RIHAKU Starting price EUR 250,- signature SHUNGYOKU and central floral himotoshi. Unsigned DIAMETER 4 cm Japan, Asakusa, mid to late 19th century Condition: Minor nicks, surface wear, discoloration. Good worn condition. A beautiful choice piece of walrus tusk ivory carved into a luscious 306 | TWO CIRCULAR FINE PRESSED Provenance: European private collection. ryusa manju depicting leafy stalks of bamboo, a thatched hut and HORN MANJU NETSUKE many clouds. The center is inlaid with a silver-gilt figure depicting Estimate EUR 600,- WKHSRHW5LKDNX LQ&KLQD/L%DL QH[WWRDKXJHGRXEOHJRXUG The second signed Starting price EUR 300,- filled with sake (the drink of the immortals). Central himotoshi in Japan, 19th century the back. DIAMETER 4.1 cm, WIDTH 2.3 cm DIAMETER 4.3 and 4 cm Condition: Very good condition, the facial features on the inlay &RQGLWLRQ%RWKULPVZLWKFKLSVDQGH[SHFWHGFUDFNOLQJ slightly worn. 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Austrian private collection. Estimate EUR 400,- Estimate EUR 800,- Starting price EUR 200,- Starting price EUR 400,- 96 97 313 | RYUMIN: AN IVORY AND SHIBUICHI 316 | HAKUUNSAI: AN IVORY RYUSA MANJU KAGAMIBUTA NETSUKE OF A MULTITUDE OF NOH MASKS %\6HUL]DZD5\XPLQVLJQHG5\XPLQZLWKNDR %\+DNXXQVDLVLJQHG+DNXXQ Japan, 19th century, Edo period (1615-1868) Japan, c. mid-19th century, Edo period (1615-1868) The shibuichi plate depicting two women harvesting rice. The This netsuke shows a multitude of different Noh masks, one next background shows finely incised mountains and ships. Set in an to the other around the entire work, all from Japanese theatre ivory bowl. Signed RYUMIN with kao. and folklore. Natural himotoshi through the openwork, signed on a flat bottle gourd HAKUUN, for Hakuunsai, a master of dense DIAMETER 4.4 cm mask compositions. Condition: The ivory bowl with a crack. Otherwise fine condition. WIDTH 3.5 cm Provenance: European collection. Condition: The ink and red paint is slightly worn, very good Estimate EUR 500,- condition. 312 | THREE KAGAMIBUTA NETSUKE Starting price EUR 250,- Provenance: The 40-Year Collection of a London Gentleman. Unsigned Estimate EUR 300,- Japan, 19th century, Edo period (1615-1868) Starting price EUR 150,- The first kagamibuta netsuke of an actor playing as Kamakura Gongoro Kagemasa in the kabuki play Shibaraku. The second showing a mandarin duck on a rock underneath a Fuji tree with hanging blossoms and a peony blossom in front of the duck. The third of Shoki, his face showing a characteristically grim 317 | A BONE NETSUKE OF A HANNYA MASK expression, and a horned oni close beside him with a gleeful expression, its head made from copper. Unsigned Japan, 19th century, Edo period (1615-1868) DIAMETER 3.5 - 4.6 cm Condition: The ivory bowl of the first with some discoloration and This bone netsuke depicts Hannya. Himotoshi through the cracks and the inside area of the bowl with some glue residue; central bridge on the back. the lid with greenish patina. Generally, in good condition. The second in excellent condition. The third ivory bowl with a crack, HEIGHT c. 5 cm and missing the central section at the back, otherwise good condition. Condition: Good, worn condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Provenance: Old Zagreb private collection. Estimate EUR 300,- 315 | A MECHANICAL KUROGAKI WOOD MASK Estimate EUR 300,- Starting price EUR 150,- NETSUKE OF A SHISHI Starting price EUR 150,- Unsigned Japan, 19th century, Edo period (1615-1868) 314 | TWO IVORY NETSUKE OF MASKS 318 | FIVE IVORY AND MIXED METAL KAGAMIBUTA NETSUKE The first signed Mitsuyuki, the second unsigned The Shishi head carved with movable floppy ears and a jaw. The Japan, 19th century, Edo period (1615-1868) tama on its head is used to control the movable parts. The first signed and by Naohiro, the second signed and by Ryumin, the third unsigned, the fourth signed Nagatsune and the HEIGHT 4.6 cm manju signed Chisei HEIGHT each 4.3 cm Japan, 19th century, Edo period (1615-1868) Condition: Good condition. The mechanical part is stiff and not &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ fully working, though the individual parts are still movable. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ The first kagamibuta netsuke of a large and flawless ivory bowl with the lid depicting Kanzan and Jittoku. Very fine work from Estimate EUR 600,- Estimate EUR 400,- an important metalwork school – signed NAOHIRO. The second Starting price EUR 300,- Starting price EUR 200,- depicting Omori Hikoichi carrying the witch after the battle of Minatogawa. Signed RYUMIN with kao. A student of Tenmin. The third depicting the wind god Futen amongst billowing clouds. The fourth kagamibuta depicting a monkey with young. The backside of the lid signed NAGATSUNE and saku with a long inscription relating to a painting. The ivory manju with a village scene carved in shishiabori. Signed CHISEI and to (made). DIAMETER 4.6 - 5.3 cm Condition: The first in excellent condition; the second with some wear to the side of the lid - the mid-section on the backside of the ivory bowl has been glued. The third with several cracks on the bowl glue residue on the inside. The fourth kagamibuta with age cracks but generally in very good condition. The manju with some soiling and missing the peg in the middle. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 500,- Starting price EUR 250,- 98 99 313 | RYUMIN: AN IVORY AND SHIBUICHI 316 | HAKUUNSAI: AN IVORY RYUSA MANJU KAGAMIBUTA NETSUKE OF A MULTITUDE OF NOH MASKS %\6HUL]DZD5\XPLQVLJQHG5\XPLQZLWKNDR %\+DNXXQVDLVLJQHG+DNXXQ Japan, 19th century, Edo period (1615-1868) Japan, c. mid-19th century, Edo period (1615-1868) The shibuichi plate depicting two women harvesting rice. The This netsuke shows a multitude of different Noh masks, one next background shows finely incised mountains and ships. Set in an to the other around the entire work, all from Japanese theatre ivory bowl. Signed RYUMIN with kao. and folklore. Natural himotoshi through the openwork, signed on a flat bottle gourd HAKUUN, for Hakuunsai, a master of dense DIAMETER 4.4 cm mask compositions. Condition: The ivory bowl with a crack. Otherwise fine condition. WIDTH 3.5 cm Provenance: European collection. Condition: The ink and red paint is slightly worn, very good Estimate EUR 500,- condition. 312 | THREE KAGAMIBUTA NETSUKE Starting price EUR 250,- Provenance: The 40-Year Collection of a London Gentleman. Unsigned Estimate EUR 300,- Japan, 19th century, Edo period (1615-1868) Starting price EUR 150,- The first kagamibuta netsuke of an actor playing as Kamakura Gongoro Kagemasa in the kabuki play Shibaraku. The second showing a mandarin duck on a rock underneath a Fuji tree with hanging blossoms and a peony blossom in front of the duck. The third of Shoki, his face showing a characteristically grim 317 | A BONE NETSUKE OF A HANNYA MASK expression, and a horned oni close beside him with a gleeful expression, its head made from copper. Unsigned Japan, 19th century, Edo period (1615-1868) DIAMETER 3.5 - 4.6 cm Condition: The ivory bowl of the first with some discoloration and This bone netsuke depicts Hannya. Himotoshi through the cracks and the inside area of the bowl with some glue residue; central bridge on the back. the lid with greenish patina. Generally, in good condition. The second in excellent condition. The third ivory bowl with a crack, HEIGHT c. 5 cm and missing the central section at the back, otherwise good condition. Condition: Good, worn condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Provenance: Old Zagreb private collection. Estimate EUR 300,- 315 | A MECHANICAL KUROGAKI WOOD MASK Estimate EUR 300,- Starting price EUR 150,- NETSUKE OF A SHISHI Starting price EUR 150,- Unsigned Japan, 19th century, Edo period (1615-1868) 314 | TWO IVORY NETSUKE OF MASKS 318 | FIVE IVORY AND MIXED METAL KAGAMIBUTA NETSUKE The first signed Mitsuyuki, the second unsigned The Shishi head carved with movable floppy ears and a jaw. The Japan, 19th century, Edo period (1615-1868) tama on its head is used to control the movable parts. The first signed and by Naohiro, the second signed and by Ryumin, the third unsigned, the fourth signed Nagatsune and the HEIGHT 4.6 cm manju signed Chisei HEIGHT each 4.3 cm Japan, 19th century, Edo period (1615-1868) Condition: Good condition. The mechanical part is stiff and not &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ fully working, though the individual parts are still movable. 3URYHQDQFH%ULWLVKFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ The first kagamibuta netsuke of a large and flawless ivory bowl with the lid depicting Kanzan and Jittoku. Very fine work from Estimate EUR 600,- Estimate EUR 400,- an important metalwork school – signed NAOHIRO. The second Starting price EUR 300,- Starting price EUR 200,- depicting Omori Hikoichi carrying the witch after the battle of Minatogawa. Signed RYUMIN with kao. A student of Tenmin. The third depicting the wind god Futen amongst billowing clouds. The fourth kagamibuta depicting a monkey with young. The backside of the lid signed NAGATSUNE and saku with a long inscription relating to a painting. The ivory manju with a village scene carved in shishiabori. Signed CHISEI and to (made). DIAMETER 4.6 - 5.3 cm Condition: The first in excellent condition; the second with some wear to the side of the lid - the mid-section on the backside of the ivory bowl has been glued. The third with several cracks on the bowl glue residue on the inside. The fourth kagamibuta with age cracks but generally in very good condition. The manju with some soiling and missing the peg in the middle. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 500,- Starting price EUR 250,- 98 99 319 | A GROUP OF FIVE MASK NETSUKE 323 | $/27:Ζ7+7:(/9(Ζ925<12+0$6.6b Two by the Deme family, one signed with a kao, one signed Tamamaru, one signed Hozan-o (Hozan Takahashi). Japan, Meiji period (1868-1912) Japan, 19th century, Edo period (1615-1868) All twelve miniature masks with accentuated staining and openwork Depicting Hannya, Okame and two grimacing faces. carving at the eyes, nostrils and mouths. Depiction of various FKDUDFWHUVVXFKDV+RWHL'DLNRNX%HQWHQ%LVKDPRQRU2NDPH HEIGHT 3.6 – 4.8 cm HEIGHT 2.5 cm each Condition: All in good condition with traces of use and wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: All twelve masks (!) are in excellent condition with hardly any wear. Estimate EUR 800,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ&ROOHFWHGSULRUWR Starting price EUR 400,- Estimate EUR 400,- Starting price EUR 200,- 320 | A GROUP OF FIVE WOOD MASK NETSUKE One signed Gyokuzan and another signed Seisen Japan, 19th century, Edo period (1615-1868) Depicting Ikkaku Sennin and Jo. HEIGHT 4.7 – 5.7 cm Condition: Expected traces of use and wear. The Gyokuzan Ikkaku Sennin with a chip to the back. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- Starting price EUR 400,- 324 | A LACQUERED BUGAKU MASK OF BATO Japan, Meiji period (1868-1912) 321 | TWO MINIATURE WOOD MASKS The mask lacquered in red and with gilded eyes, fierce expression and large nose. Signed and stamped on the back. Signed Masamichi and Masaharu Japan, 19th century, Edo period (1615-1868) SIZE ca. 27.5 x 22.5 cm Condition: Age-related condition, minor wear to pigments and a few Each finely carved as a grimacing man sticking out his tongue. The cracks. earholes were probably used for suspension. Signed in gold lacquer Provenance: Hungarian private collection. on the back. Estimate EUR 300,- HEIGHT 5.2 cm Starting price EUR 150,- Condition: Very good condition. The right mask with a tiny chip to the right side of the head. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,- Starting price EUR 200,- 322 | A GROUP OF FOUR MASK NETSUKE 325 | A LACQUERED TENGU CEREMONIAL MASK Two by the Deme family, and one signed Gyokko Japan, Meiji period (1868-1912) Depicting Ran-Ryo, Hannya and a grimacing man with gold- Carved in wood with its characteristic long nose, lacquered in red lacquered eyes. and with remnants of gilding. HEIGHT each ca. 5 cm SIZE ca. 20.5 x 15 cm Condition: Good, used condition. One Hannya mask with a lost horn Condition: Age-related condition, wear to pigments and restored and the Ran-Ryo mask with repaired crack to the bridge in the back. nose. 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Hungarian private collection. Estimate EUR 600,- Estimate EUR 300,- Starting price EUR 300,- Starting price EUR 150,- 100 101 319 | A GROUP OF FIVE MASK NETSUKE 323 | $/27:Ζ7+7:(/9(Ζ925<12+0$6.6b Two by the Deme family, one signed with a kao, one signed Tamamaru, one signed Hozan-o (Hozan Takahashi). Japan, Meiji period (1868-1912) Japan, 19th century, Edo period (1615-1868) All twelve miniature masks with accentuated staining and openwork Depicting Hannya, Okame and two grimacing faces. carving at the eyes, nostrils and mouths. Depiction of various FKDUDFWHUVVXFKDV+RWHL'DLNRNX%HQWHQ%LVKDPRQRU2NDPH HEIGHT 3.6 – 4.8 cm HEIGHT 2.5 cm each Condition: All in good condition with traces of use and wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: All twelve masks (!) are in excellent condition with hardly any wear. Estimate EUR 800,- 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ&ROOHFWHGSULRUWR Starting price EUR 400,- Estimate EUR 400,- Starting price EUR 200,- 320 | A GROUP OF FIVE WOOD MASK NETSUKE One signed Gyokuzan and another signed Seisen Japan, 19th century, Edo period (1615-1868) Depicting Ikkaku Sennin and Jo. HEIGHT 4.7 – 5.7 cm Condition: Expected traces of use and wear. The Gyokuzan Ikkaku Sennin with a chip to the back. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,- Starting price EUR 400,- 324 | A LACQUERED BUGAKU MASK OF BATO Japan, Meiji period (1868-1912) 321 | TWO MINIATURE WOOD MASKS The mask lacquered in red and with gilded eyes, fierce expression and large nose. Signed and stamped on the back. Signed Masamichi and Masaharu Japan, 19th century, Edo period (1615-1868) SIZE ca. 27.5 x 22.5 cm Condition: Age-related condition, minor wear to pigments and a few Each finely carved as a grimacing man sticking out his tongue. The cracks. earholes were probably used for suspension. Signed in gold lacquer Provenance: Hungarian private collection. on the back. Estimate EUR 300,- HEIGHT 5.2 cm Starting price EUR 150,- Condition: Very good condition. The right mask with a tiny chip to the right side of the head. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,- Starting price EUR 200,- 322 | A GROUP OF FOUR MASK NETSUKE 325 | A LACQUERED TENGU CEREMONIAL MASK Two by the Deme family, and one signed Gyokko Japan, Meiji period (1868-1912) Depicting Ran-Ryo, Hannya and a grimacing man with gold- Carved in wood with its characteristic long nose, lacquered in red lacquered eyes. and with remnants of gilding. HEIGHT each ca. 5 cm SIZE ca. 20.5 x 15 cm Condition: Good, used condition. One Hannya mask with a lost horn Condition: Age-related condition, wear to pigments and restored and the Ran-Ryo mask with repaired crack to the bridge in the back. nose. 3URYHQDQFH%ULWLVKFROOHFWLRQ Provenance: Hungarian private collection. Estimate EUR 600,- Estimate EUR 300,- Starting price EUR 300,- Starting price EUR 150,- 100 101 327 | A FOUR-CASE LACQUER 330 | A FOUR-CASE 331 | A RED INRO WITH COCKEREL LACQUER INRO LACQUER AND LACQUER MANJU CIRCULAR NETSUKE Japan, 17th/18th century, TWO-CASE Edo period (1615-1868) INRO %\7RNRVDL0DVDKLJHDQG7RVKXVDLVLJQHG Tokosai Masashige and kao, and Toshusai Japan, 19th century, Japan, early 19th century, Edo period An inlaid lacquer inro Edo period (1615-1868) (1615-1868) showing a farm scene with various tea utensils, lacquered in gold The red ground A four-case inro showing on one side takamaki-e with inlaid lacquered with numerous a cockerel in front of a bamboo stalk, mother of pearl details. chrysanthemum blossoms decorated in fine togidashi-e and 328 | A FINE LACQUERED With an inlaid cloisonné LQJROGbWDNDPDNLH hiramaki- e on matt gold fudame, FOUR-CASE INRO ojime and an ivory and with a metal ojime depicting a cockerel next to bamboo metal kagamibuta depicting and a lacquered wood on one side and a hen with a small bird Japan, 18th century, Edo period Hotei. QHWVXNHbFDUYHGDVD and more bamboo on the other. Gold (1615-1868) performer. nashiji on the interior of the cases. HEIGHT inro 6 cm, Signed TOKOSAI MASASHIGE and KAO DIAMETER netsuke 4 cm HEIGHT inro 4.5 cm, on the underside, a well-known lacquer The image on both sides is executed in LENGTH netsuke 6 cm artist. Very small characters EISHIN and gold lacquer and colored togidashi-e and Condition: Age-related (possibly) KAO, which could however depicts a phoenix in a hibiscus tree branch. condition, cracks, minor Condition: Worn age-related also mean “fame and loyalty”, next to the The inside lacquered in black with fine gold nicks – general wear. condition, the inro chipped. cockerel. flakes. Provenance: Old Zagreb Provenance: Old Zagreb private collection. private collection. With a two-part manju netsuke decorated HEIGHT 7 cm in takamaki-e with gold, depicting a hut Estimate EUR 400,- Estimate EUR 500,- under a pine tree in front of a stream, Condition: Minor wear to the edges and Starting price EUR 200,- Starting price EUR 250,- signed TOSHUSAI, another well-known surface wear – generally, in very good lacquer artist. Spherical ojime made from condition. aventurine glass. Provenance: American private collection. HEIGHT inro 8.4 cm, DIAMETER manju Estimate EUR 400,- netsuke 4.2 cm Starting price EUR 200,- Condition: The inro with many surface scratches and some wear to lacquer, the 326 | A STAG ANTLER netsuke with losses to lacquer takamaki-e. KISERUZUTSU 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ DEPICTING KAPPA 333 | A FINE Estimate EUR 600,- THREE-CASE Unsigned Starting price EUR 300,- LACQUER INRO Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) The pipecase of senryu-zutsu type carved in the form of an elongated Fine lacquer work designed ape-like kappa, holding one hand as in gold takamaki-e, if he was picking fleas, and the other 332 | A FOUR-CASE KLUDPDNLHDQGbNLULJDQHbZLWK hand near his crotch. His expression LACQUER INRO a scene of a waterway, is curious, looking downwards with a pavilions and classic piercing gaze. Perhaps a humorous Japan, 18th century, landscape designs. The and hidden meaning is that the pipe 329 | A LACQUER FOUR-CASE Edo period (1615-1868) inside covered in nashiji would go through his head, where the INRO and together with a small kappa keeps his vital fluids – though he floral metal ojime and an does not seem to mind. Animal hair is Japan, 18th/19th century, Edo period A four-case inro showing ivory netsuke depicting a used for the hair on the kappa’s head (1615-1868) a boat scene decorated boy with turtle. and the natural structure of the antler in takamaki-e with inlaid is used replicate the scaly skin on the mother of pearls details. HEIGHT inro 5.5 cm, creature’s arm. The four-case inro depicting an underwater Together with a Meiji period LENGTH netsuke 3.5 cm scene lacquered in brown, gold and green ivory netsuke of a street HEIGHT 19.4 cm takamaki-e and hiramaki-e with fine silver- drummer. Condition: Good age- inlaid clams and conch shells. The inside related condition, the inro Condition: Good condition, losses to with dense nashiji and the top case with an HEIGHT inro 6.5 cm, has a few thin cracks and animal hair. inscription/signature. LENGTH netsuke 4.5 cm related wear, only one is Provenance: European private visible from the outside, collection. HEIGHT 6.3 cm Condition: Worn age-related and discoloration along the condition, the inro with few borders. The netsuke with a Auction comparison: Compare to an Condition: Worn condition, the lacquer chips and the netsuke with chip to the edge of one foot obi-hasami of a kappa sold at Van Ham, work is damaged, cracked and unattached minor restorations. and missing one inlaid eye. Asiatische Kunst, Cologne, 14 June from the wood in some areas. Provenance: Old Zagreb Provenance: Old Zagreb 2018, lot 2297. Provenance: Austrian private collection. private collection. private collection. Estimate EUR 800,- Estimate EUR 400,- Estimate EUR 500,- Estimate EUR 600,- Starting price EUR 400,- Starting price EUR 200,- Starting price EUR 250,- Starting price EUR 300,- 102 103 327 | A FOUR-CASE LACQUER 330 | A FOUR-CASE 331 | A RED INRO WITH COCKEREL LACQUER INRO LACQUER AND LACQUER MANJU CIRCULAR NETSUKE Japan, 17th/18th century, TWO-CASE Edo period (1615-1868) INRO %\7RNRVDL0DVDKLJHDQG7RVKXVDLVLJQHG Tokosai Masashige and kao, and Toshusai Japan, 19th century, Japan, early 19th century, Edo period An inlaid lacquer inro Edo period (1615-1868) (1615-1868) showing a farm scene with various tea utensils, lacquered in gold The red ground A four-case inro showing on one side takamaki-e with inlaid lacquered with numerous a cockerel in front of a bamboo stalk, mother of pearl details. chrysanthemum blossoms decorated in fine togidashi-e and 328 | A FINE LACQUERED With an inlaid cloisonné LQJROGbWDNDPDNLH hiramaki- e on matt gold fudame, FOUR-CASE INRO ojime and an ivory and with a metal ojime depicting a cockerel next to bamboo metal kagamibuta depicting and a lacquered wood on one side and a hen with a small bird Japan, 18th century, Edo period Hotei. QHWVXNHbFDUYHGDVD and more bamboo on the other. Gold (1615-1868) performer. nashiji on the interior of the cases. HEIGHT inro 6 cm, Signed TOKOSAI MASASHIGE and KAO DIAMETER netsuke 4 cm HEIGHT inro 4.5 cm, on the underside, a well-known lacquer The image on both sides is executed in LENGTH netsuke 6 cm artist. Very small characters EISHIN and gold lacquer and colored togidashi-e and Condition: Age-related (possibly) KAO, which could however depicts a phoenix in a hibiscus tree branch. condition, cracks, minor Condition: Worn age-related also mean “fame and loyalty”, next to the The inside lacquered in black with fine gold nicks – general wear. condition, the inro chipped. cockerel. flakes. Provenance: Old Zagreb Provenance: Old Zagreb private collection. private collection. With a two-part manju netsuke decorated HEIGHT 7 cm in takamaki-e with gold, depicting a hut Estimate EUR 400,- Estimate EUR 500,- under a pine tree in front of a stream, Condition: Minor wear to the edges and Starting price EUR 200,- Starting price EUR 250,- signed TOSHUSAI, another well-known surface wear – generally, in very good lacquer artist. Spherical ojime made from condition. aventurine glass. Provenance: American private collection. HEIGHT inro 8.4 cm, DIAMETER manju Estimate EUR 400,- netsuke 4.2 cm Starting price EUR 200,- Condition: The inro with many surface scratches and some wear to lacquer, the 326 | A STAG ANTLER netsuke with losses to lacquer takamaki-e. KISERUZUTSU 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ DEPICTING KAPPA 333 | A FINE Estimate EUR 600,- THREE-CASE Unsigned Starting price EUR 300,- LACQUER INRO Japan, 19th century, Edo period (1615-1868) Japan, 19th century, Edo period (1615-1868) The pipecase of senryu-zutsu type carved in the form of an elongated Fine lacquer work designed ape-like kappa, holding one hand as in gold takamaki-e, if he was picking fleas, and the other 332 | A FOUR-CASE KLUDPDNLHDQGbNLULJDQHbZLWK hand near his crotch. His expression LACQUER INRO a scene of a waterway, is curious, looking downwards with a pavilions and classic piercing gaze. Perhaps a humorous Japan, 18th century, landscape designs. The and hidden meaning is that the pipe 329 | A LACQUER FOUR-CASE Edo period (1615-1868) inside covered in nashiji would go through his head, where the INRO and together with a small kappa keeps his vital fluids – though he floral metal ojime and an does not seem to mind. Animal hair is Japan, 18th/19th century, Edo period A four-case inro showing ivory netsuke depicting a used for the hair on the kappa’s head (1615-1868) a boat scene decorated boy with turtle. and the natural structure of the antler in takamaki-e with inlaid is used replicate the scaly skin on the mother of pearls details. HEIGHT inro 5.5 cm, creature’s arm. The four-case inro depicting an underwater Together with a Meiji period LENGTH netsuke 3.5 cm scene lacquered in brown, gold and green ivory netsuke of a street HEIGHT 19.4 cm takamaki-e and hiramaki-e with fine silver- drummer. Condition: Good age- inlaid clams and conch shells. The inside related condition, the inro Condition: Good condition, losses to with dense nashiji and the top case with an HEIGHT inro 6.5 cm, has a few thin cracks and animal hair. inscription/signature. LENGTH netsuke 4.5 cm related wear, only one is Provenance: European private visible from the outside, collection. HEIGHT 6.3 cm Condition: Worn age-related and discoloration along the condition, the inro with few borders. The netsuke with a Auction comparison: Compare to an Condition: Worn condition, the lacquer chips and the netsuke with chip to the edge of one foot obi-hasami of a kappa sold at Van Ham, work is damaged, cracked and unattached minor restorations. and missing one inlaid eye. Asiatische Kunst, Cologne, 14 June from the wood in some areas. Provenance: Old Zagreb Provenance: Old Zagreb 2018, lot 2297. Provenance: Austrian private collection. private collection. private collection. Estimate EUR 800,- Estimate EUR 400,- Estimate EUR 500,- Estimate EUR 600,- Starting price EUR 400,- Starting price EUR 200,- Starting price EUR 250,- Starting price EUR 300,- 102 103 337 | A RARE LACQUERED KOGO DEPICTING ONO NO KOMACHI Japan, Edo period (1615-1868) The Kogo (incense box) is decorated on the lid with matt gold and silver takamaki-e depicting the beautiful poet Ono no Komachi (c. 825 – 900), one of the Rokkasen (the sixth best poets of the early Heian period). She is wearing courtly robes and is writing a poem, her facial expression serene and deeply focused. The entire 334 | A LARGE LOT OF VARIOUS LACQUER DIAMETER 6.8-15.2 cm (the cups and bowls), LENGTH 10.2-17.5 surface of the kogo is covered in dark-red lacquer sprinkled with OBJECTS, LATE MEIJI TO TAISHO cm (the spoons) nashiji. Interestingly there is also a thin inlaid layer of copper under the poetess, as spots of green oxidation are visible. Old Japan, late Meiji to Taisho period, 1900-1940 Condition: Good condition and minor wear, as visible on the Japanese label on the base. 338 | A RARE JAPANESE LACQUER TABAKO-BON images online on www.zacke.at. (SMOKING SET) Provenance: Austrian private collection. HEIGHT 2 cm, LENGTH 9. 1 cm, WEIGHT 7.7 cm Comprising cups, bowls, and spoons of various sizes, with red, Japan, Edo period (1615-1868) black, and gilt lacquer painting. (24) Estimate EUR 200,- Condition: Good condition with minor wear to lacquer and spots Starting price EUR 100,- of green oxidation to the surface. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ The display stands on a flat base and has three storage drawers, one of them containing a match holder. At the top is the 336 | A LACQUERED WOOD INRO WITH NETSUKE Estimate EUR 200,- cylindrical brazier with matching lid and handle. All sides are Starting price EUR 100,- precisely decorated with carved and incised mother-of-pearl inlays. The front fits a kiseru (pipe). Japan, Edo period (1615-1868) SIZE 21 x 15.5 x 16.5 cm 339 | A MINIATURE LACQUER DINING SET The lacquered two-case inro depicting a minimalistic landscape Condition: The lacquer partially warped, chipped and with some on one side and a shishi on the other. With a wood octopus Japan, 19th century, Edo period (1615-1868) of the inlay work missing. netsuke. Provenance: Austrian private estate. HEIGHT INRO 7 cm, HEIGHT NETSUKE 5 cm The set consists of a table, a pitcher, two small trays, two lidded Estimate EUR 800,- vessels and a bowl. It is overall covered in red and brown lacquer Starting price EUR 400,- Condition: Worn condition, few chips and cracks. with finely painted golden décor. Provenance: Austrian private estate. SIZE 12 x 12 x 7 cm (the table) Estimate EUR 200,- Starting price EUR 100,- Condition: Superb condition with only microscopic losses and minor traces of use. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. 335 | A LACQUERED KOGAI AND A COMB It is rare to find such a complete and well-preserved miniature set, which most likely was made for a doll house. Japan, Meiji period (1868-1912) Estimate EUR 400,- Starting price EUR 200,- The group consisting of a set of a lacquered Kogai (hairpin) with a comb in original wood box, both covered in roiro-nuri lacquer with gold hiramaki-e and inlays of mother of pearl depicting floral motifs – both signed Ikko. 340 | A GOLD LACQUERED COMB Kogai LENGTH 13.1-13.6 cm, Comb LENGTH 10.3 cm Japan, Meiji period (1868-1912) Condition: Good condition, minor wear to the lacquer on the edges. The comb covered in gold lacquer and carved to depict a floral Provenance: Galerie Zacke archive. design. Comes with another Kogai, the mid-section lacquered in roiro- LENGTH 9 cm nuri and the end sections lacquered in gold with gold takamaki-e and hirame flakes depicting various leaves – an autumn scene. Condition: Worn condition, discoloration and with a missing inlay. Signed. Provenance: Austrian private estate. Estimate EUR 200,- Estimate EUR 200,- Starting price EUR 100,- Starting price EUR 100,- 104 105 337 | A RARE LACQUERED KOGO DEPICTING ONO NO KOMACHI Japan, Edo period (1615-1868) The Kogo (incense box) is decorated on the lid with matt gold and silver takamaki-e depicting the beautiful poet Ono no Komachi (c. 825 – 900), one of the Rokkasen (the sixth best poets of the early Heian period). She is wearing courtly robes and is writing a poem, her facial expression serene and deeply focused. The entire 334 | A LARGE LOT OF VARIOUS LACQUER DIAMETER 6.8-15.2 cm (the cups and bowls), LENGTH 10.2-17.5 surface of the kogo is covered in dark-red lacquer sprinkled with OBJECTS, LATE MEIJI TO TAISHO cm (the spoons) nashiji. Interestingly there is also a thin inlaid layer of copper under the poetess, as spots of green oxidation are visible. Old Japan, late Meiji to Taisho period, 1900-1940 Condition: Good condition and minor wear, as visible on the Japanese label on the base. 338 | A RARE JAPANESE LACQUER TABAKO-BON images online on www.zacke.at. (SMOKING SET) Provenance: Austrian private collection. HEIGHT 2 cm, LENGTH 9. 1 cm, WEIGHT 7.7 cm Comprising cups, bowls, and spoons of various sizes, with red, Japan, Edo period (1615-1868) black, and gilt lacquer painting. (24) Estimate EUR 200,- Condition: Good condition with minor wear to lacquer and spots Starting price EUR 100,- of green oxidation to the surface. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ The display stands on a flat base and has three storage drawers, one of them containing a match holder. At the top is the 336 | A LACQUERED WOOD INRO WITH NETSUKE Estimate EUR 200,- cylindrical brazier with matching lid and handle. All sides are Starting price EUR 100,- precisely decorated with carved and incised mother-of-pearl inlays. The front fits a kiseru (pipe). Japan, Edo period (1615-1868) SIZE 21 x 15.5 x 16.5 cm 339 | A MINIATURE LACQUER DINING SET The lacquered two-case inro depicting a minimalistic landscape Condition: The lacquer partially warped, chipped and with some on one side and a shishi on the other. With a wood octopus Japan, 19th century, Edo period (1615-1868) of the inlay work missing. netsuke. Provenance: Austrian private estate. HEIGHT INRO 7 cm, HEIGHT NETSUKE 5 cm The set consists of a table, a pitcher, two small trays, two lidded Estimate EUR 800,- vessels and a bowl. It is overall covered in red and brown lacquer Starting price EUR 400,- Condition: Worn condition, few chips and cracks. with finely painted golden décor. Provenance: Austrian private estate. SIZE 12 x 12 x 7 cm (the table) Estimate EUR 200,- Starting price EUR 100,- Condition: Superb condition with only microscopic losses and minor traces of use. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. 335 | A LACQUERED KOGAI AND A COMB It is rare to find such a complete and well-preserved miniature set, which most likely was made for a doll house. Japan, Meiji period (1868-1912) Estimate EUR 400,- Starting price EUR 200,- The group consisting of a set of a lacquered Kogai (hairpin) with a comb in original wood box, both covered in roiro-nuri lacquer with gold hiramaki-e and inlays of mother of pearl depicting floral motifs – both signed Ikko. 340 | A GOLD LACQUERED COMB Kogai LENGTH 13.1-13.6 cm, Comb LENGTH 10.3 cm Japan, Meiji period (1868-1912) Condition: Good condition, minor wear to the lacquer on the edges. The comb covered in gold lacquer and carved to depict a floral Provenance: Galerie Zacke archive. design. Comes with another Kogai, the mid-section lacquered in roiro- LENGTH 9 cm nuri and the end sections lacquered in gold with gold takamaki-e and hirame flakes depicting various leaves – an autumn scene. Condition: Worn condition, discoloration and with a missing inlay. Signed. Provenance: Austrian private estate. Estimate EUR 200,- Estimate EUR 200,- Starting price EUR 100,- Starting price EUR 100,- 104 105 341 | A VERY FINE 343 | A FINE PAIR OF SHIBAYAMA AND LACQUERED WOOD LACQUER FOUR-CASE AND SHIBAYAMA VASES INRO DEPICTING WITH RAKAN URASHIMA TARO Japan, Meiji period (1868-1912) Unsigned Japan, late 19th century, Meiji period (1868-1912) A pair of vases of cylindrical shape and supported on three leafy bamboo feet made from shakudo. Decorated with A finely inlaid four-case lacquer inro on a circumferential scene of a group of a gold lacquered ground, with inlays Rakan set on a gold kinji ground, the of ivory, mother of pearl, coral, stained details in takamaki-e, kirikane, nashiji horn and tortoiseshell. Urashima Taro, and with inlays of ivory and mother of depicted as an old man, is shown pearl. The Rakan are surrounded by a kneeling and looking at the opened blossoming tree and many sparrows. box from which a turtle emerges. A 2QHVKRZVWKH5DNDQ%XNDQ=HQVKL crane descends above him. The reverse next to his tiger companion viewing decorated with a leafy blossoming D%XGGKLVWUHOLTXDU\KHOGE\DQRWKHU peony branch, one budding flower Rakan. The other shows one Rakan inlaid in coral, below three flying pointing and the other reading from butterflies. The inside with dense a scroll. nashiji. HEIGHT 26.1 cm HEIGHT 8 cm, WIDTH 6.2 cm Condition: One loss to the edge of Condition: Some surface scratches, one sparrow’s wing. Generally, in good miniscule loss to the inlay of the mat condition with minimal wear around underneath the box. Good condition. the inlays and edges. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 3.000,- Estimate EUR 1.500,- Starting price EUR 1.500,- Starting price EUR 750,- 344 | AN IMPORTANT SHIBAYAMA CHARGER %\WKH*\RNXVKR)DPLO\ Japan, late 19th century, Meiji period (1868-1912) 342 | A RARE IVORY INRO BY SHIBAYAMA YASUNOBU Designed in polychrome takamaki-e, hiramaki-e and inlaid ivory, mother- %\6KLED\DPD Estimate EUR 1.000,- Estimate EUR 2.000,- Starting price EUR 500,- Starting price EUR 1.000,- 106 107 341 | A VERY FINE 343 | A FINE PAIR OF SHIBAYAMA AND LACQUERED WOOD LACQUER FOUR-CASE AND SHIBAYAMA VASES INRO DEPICTING WITH RAKAN URASHIMA TARO Japan, Meiji period (1868-1912) Unsigned Japan, late 19th century, Meiji period (1868-1912) A pair of vases of cylindrical shape and supported on three leafy bamboo feet made from shakudo. Decorated with A finely inlaid four-case lacquer inro on a circumferential scene of a group of a gold lacquered ground, with inlays Rakan set on a gold kinji ground, the of ivory, mother of pearl, coral, stained details in takamaki-e, kirikane, nashiji horn and tortoiseshell. Urashima Taro, and with inlays of ivory and mother of depicted as an old man, is shown pearl. The Rakan are surrounded by a kneeling and looking at the opened blossoming tree and many sparrows. box from which a turtle emerges. A 2QHVKRZVWKH5DNDQ%XNDQ=HQVKL crane descends above him. The reverse next to his tiger companion viewing decorated with a leafy blossoming D%XGGKLVWUHOLTXDU\KHOGE\DQRWKHU peony branch, one budding flower Rakan. The other shows one Rakan inlaid in coral, below three flying pointing and the other reading from butterflies. The inside with dense a scroll. nashiji. HEIGHT 26.1 cm HEIGHT 8 cm, WIDTH 6.2 cm Condition: One loss to the edge of Condition: Some surface scratches, one sparrow’s wing. Generally, in good miniscule loss to the inlay of the mat condition with minimal wear around underneath the box. Good condition. the inlays and edges. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 3.000,- Estimate EUR 1.500,- Starting price EUR 1.500,- Starting price EUR 750,- 344 | AN IMPORTANT SHIBAYAMA CHARGER %\WKH*\RNXVKR)DPLO\ Japan, late 19th century, Meiji period (1868-1912) 342 | A RARE IVORY INRO BY SHIBAYAMA YASUNOBU Designed in polychrome takamaki-e, hiramaki-e and inlaid ivory, mother- %\6KLED\DPD Estimate EUR 1.000,- Estimate EUR 2.000,- Starting price EUR 500,- Starting price EUR 1.000,- 106 107 349 | A GOLD LACQUER TRAY Japan, late 19th century, Meiji period (1868-1912) Finely painted with a scene depicting a Samurai and his attendant assisting a Geisha crossing a small river, the waves designed in classic Japanese style and highlighted with gold nashiji. The background with kids at play. SIZE 29 x 29 x 3.7 cm Condition: Excellent condition with only minor wear. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Remainder of old collector paper label to backside. Estimate EUR 400,- Starting price EUR 200,- 345 | A LACQUER TRAY WITH 346 | A LARGE RYOSHIBAKO SAMBASO ACCOUTREMENTS LACQUER DOCUMENT BOX 350 | SHIBATA ZESHIN: A RARE AND FINE Japan, Meiji period (1868-1912) to Taisho period (1912-1926) Japan, later Edo period, 18th - mid-19th century KORO OF A TEMPLE BELL %\6KLEDWD=HVKLQ VLJQHG=HVKLQ The large rectangular tray decorated in gold and red hiramaki-e Elaborately painted in gold lacquer to depict two playful shishi Japan, late 19th century, Edo period (1615-1868) or Meiji period and takamaki-e with accoutrements for the Sambaso Noh play, below a pine tree, enhanced with mother-of-pearl inlays, all (1868-1912) the rim decorated in gold lacquer, the underside signed – all on a above a silver nashiji ground. The sides with two more shishi lustrous roiro-nuri ground. amid peonies, the inside with further peonies on a gold nashiji ground. The lidded koro (incense burner) in the shape of a temple bell and SIZE 33.5 x 48.5 x 5.5 cm brilliantly lacquered in sabiji-nuri to imitate the patinated iron of SIZE 42 x 32 x 15 cm the old bell. This imitation is enhanced by the reddish hues shown Condition: Few chips and scratches, overall good age-related on the surface. The handle is in the shape of two confronting fishes condition. Condition: Extensive wear, fine age-related cracks, minor losses and shows pierced holes underneath for the smoke to escape. The Provenance: Hungarian private collection. and some touch-ups mostly to edges. inside is lined with metal to hold the burning incense. The sides Provenance: From an Austrian private collection. Kept in the DUHILQHO\GHFRUDWHGZLWKIO\LQJWHQQLQ %XGGKLVWDQJHOV DUUDQJHG Estimate EUR 300,- same family since the first half of the 20th century and thence by in rectangular reserves. The base and interior with fine and dense Starting price EUR 150,- descent. gold nashiji. Signed ZESHIN next to one of the reserves containing the flying tennin. Estimate EUR 700,- Starting price EUR 350,- HEIGHT 9.4 cm 347 | A JAPANESE LACQUER BOX Condition: Excellent original condition with no restoration or Japan, Meiji period (1868-1912) to Taisho period (1912-1926) polishing whatsoever! Minor wear and very few traces of use, tiny 348 | A LARGE LACQUER TRAY natural age cracks at the handle. MOUNTED AS A WALL PANEL Provenance: Acquired at Christie’s Japanese & Korean Art, 23 March A wooden box with beveled corners standing on four short legs. 2011, New York, lot 802 (Hammer price 30.000 USD). The top lid decorated in gold and orange hiramaki-e and nashiji Japan, Taisho period (1912-1926) to Showa era (1926-1989) with a plum tree branch and a fan, the corners decorated in gold Shibata Zeshin (March 15, 1807 – July 13, 1891) was a Japanese hiramaki-e to depict scrolling vines. The interior and the base b lacquer artist and painter of the late Edo period and early Meiji era. The large tray mounted as a wall panel and decorated in gold and ZLWKQDVKLMLbODFTXHUDOORQDOXVWURXVURLURQXULJURXQG He has been called “Japan’s greatest lacquerer”. He was known for red Takamaki-e with three Noh masks, a lacquer box and a fan his techniques in imitating various materials such as bronze or iron SIZE 25.5 x 27.5 x 12 cm ZLWKDGHSLFWLRQRIDPLQRJDPHRYHUDOOYHU\JRRGODFTXHUZRUNb – such as shown in the present piece. b Condition: Good condition, minimal wear to pigments and a crack SIZE 54.5 x 104 cm Estimate EUR 5.000,- to the base. b Starting price EUR 2.500,- Provenance: Hungarian private collection. Condition: Worn condition, cracks, material loss and few restorations. The tray has not been examined out of the frame. Estimate EUR 300,- Provenance: Austrian private collection. Starting price EUR 150,- Estimate EUR 1.000,- Starting price EUR 500,- 108 109 349 | A GOLD LACQUER TRAY Japan, late 19th century, Meiji period (1868-1912) Finely painted with a scene depicting a Samurai and his attendant assisting a Geisha crossing a small river, the waves designed in classic Japanese style and highlighted with gold nashiji. The background with kids at play. SIZE 29 x 29 x 3.7 cm Condition: Excellent condition with only minor wear. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Remainder of old collector paper label to backside. Estimate EUR 400,- Starting price EUR 200,- 345 | A LACQUER TRAY WITH 346 | A LARGE RYOSHIBAKO SAMBASO ACCOUTREMENTS LACQUER DOCUMENT BOX 350 | SHIBATA ZESHIN: A RARE AND FINE Japan, Meiji period (1868-1912) to Taisho period (1912-1926) Japan, later Edo period, 18th - mid-19th century KORO OF A TEMPLE BELL %\6KLEDWD=HVKLQ VLJQHG=HVKLQ The large rectangular tray decorated in gold and red hiramaki-e Elaborately painted in gold lacquer to depict two playful shishi Japan, late 19th century, Edo period (1615-1868) or Meiji period and takamaki-e with accoutrements for the Sambaso Noh play, below a pine tree, enhanced with mother-of-pearl inlays, all (1868-1912) the rim decorated in gold lacquer, the underside signed – all on a above a silver nashiji ground. The sides with two more shishi lustrous roiro-nuri ground. amid peonies, the inside with further peonies on a gold nashiji ground. The lidded koro (incense burner) in the shape of a temple bell and SIZE 33.5 x 48.5 x 5.5 cm brilliantly lacquered in sabiji-nuri to imitate the patinated iron of SIZE 42 x 32 x 15 cm the old bell. This imitation is enhanced by the reddish hues shown Condition: Few chips and scratches, overall good age-related on the surface. The handle is in the shape of two confronting fishes condition. Condition: Extensive wear, fine age-related cracks, minor losses and shows pierced holes underneath for the smoke to escape. The Provenance: Hungarian private collection. and some touch-ups mostly to edges. inside is lined with metal to hold the burning incense. The sides Provenance: From an Austrian private collection. Kept in the DUHILQHO\GHFRUDWHGZLWKIO\LQJWHQQLQ %XGGKLVWDQJHOV DUUDQJHG Estimate EUR 300,- same family since the first half of the 20th century and thence by in rectangular reserves. The base and interior with fine and dense Starting price EUR 150,- descent. gold nashiji. Signed ZESHIN next to one of the reserves containing the flying tennin. Estimate EUR 700,- Starting price EUR 350,- HEIGHT 9.4 cm 347 | A JAPANESE LACQUER BOX Condition: Excellent original condition with no restoration or Japan, Meiji period (1868-1912) to Taisho period (1912-1926) polishing whatsoever! Minor wear and very few traces of use, tiny 348 | A LARGE LACQUER TRAY natural age cracks at the handle. MOUNTED AS A WALL PANEL Provenance: Acquired at Christie’s Japanese & Korean Art, 23 March A wooden box with beveled corners standing on four short legs. 2011, New York, lot 802 (Hammer price 30.000 USD). The top lid decorated in gold and orange hiramaki-e and nashiji Japan, Taisho period (1912-1926) to Showa era (1926-1989) with a plum tree branch and a fan, the corners decorated in gold Shibata Zeshin (March 15, 1807 – July 13, 1891) was a Japanese hiramaki-e to depict scrolling vines. The interior and the base b lacquer artist and painter of the late Edo period and early Meiji era. The large tray mounted as a wall panel and decorated in gold and ZLWKQDVKLMLbODFTXHUDOORQDOXVWURXVURLURQXULJURXQG He has been called “Japan’s greatest lacquerer”. He was known for red Takamaki-e with three Noh masks, a lacquer box and a fan his techniques in imitating various materials such as bronze or iron SIZE 25.5 x 27.5 x 12 cm ZLWKDGHSLFWLRQRIDPLQRJDPHRYHUDOOYHU\JRRGODFTXHUZRUNb – such as shown in the present piece. b Condition: Good condition, minimal wear to pigments and a crack SIZE 54.5 x 104 cm Estimate EUR 5.000,- to the base. b Starting price EUR 2.500,- Provenance: Hungarian private collection. Condition: Worn condition, cracks, material loss and few restorations. The tray has not been examined out of the frame. Estimate EUR 300,- Provenance: Austrian private collection. Starting price EUR 150,- Estimate EUR 1.000,- Starting price EUR 500,- 108 109 353 | A VERY LARGE AND IMPORTANT PAINTED WOODCUT PRINT DEPICTING THE DEATH OF BUDDHA (NEHANZU) -DSDQGDWHG %XQVHLWK year), Edo period (1615-1868) A very large and elaborately crafted hand-painted woodcut print depicting Nehanzu (the GHDWKRI%XGGKD6KDN\DPXQL also known as paranirvana). The original woodcut was made by Matsubara Shogetsu in 1816 and was used as a template for this massive handcolored 351 | NANMEI: A SPECTACULAR IVORY woodcut print. The coloring was FOLDING FAN WITH FINE PAINTINGS is being collected for the impending cold season. The other side commissioned by a group of eight shows a dense composition of a bamboo forest with a large group votive donors (identified by name %\+DUXNL1DQPHL VLJQHG1DQPHLZLWKVHDO RIVSDUURZVVRPHIO\LQJDQGVRPHVWLOORQEUDQFKHV%RWKSDLQWLQJV in an inscription to the back). The Japan, early Meiji period (1868-1912) are signed and show a red seal, corresponding to Haruki Nanmei. inscription in the lower center of With string, tassles and a very fine satsuma gilt ojime. the painting states that it is based on a treasure collection at the An elaborately and very finely crafted folding fan or ogi in 30 HEIGHT 27 cm, WIDTH 50 cm when opened San’enji Temple which is better segments, each carved from ivory and some with a wavy shape. known as the Zojoji Temple, the The two exterior segments are partly painted with gold lacquer Condition: Superb condition with expected minor creases from Tokugawa shogunates’ family and show fine Shibayama style inlays with a bird, beetle, butterfly, folding the fan. WHPSOH %RGDLMLLQ-DSDQHVH (GR vines and fruit. The main side shows a large, dense landscape with Provenance: From the private collection of a Corsican seafarer. (Tokyo). The two inscriptions in a stream and very many pines, through which the snow-covered the back read: “the 16th of the Mount Fuji shines in the center. An elderly man and two young Estimate EUR 800,- Seventh month, the year of tiger, %RNXGR R[KHUGHUV DUHVKRZQHDFKSOD\LQJWKHIOXWHDQGZRRG Starting price EUR 400,- LQWKHWK\HDURIWKH%XQVHLHUD (1830). This is for the repose of the soul of the deceased (tsuizen kuyo in Japanese), Votive donors’ 352 | A FINE LACQUERED IVORY FAN together by a silver fitting with a tasseled cord attached to it and names listed: Myorin-in, Keirin-in, mounted with an ivory and Shibayama inlaid ojime. Shokenin, Keikyo-in, Shojaku-in, Japan, Meiji period (1868-1912) Kyosho-in, Seishin-in, Chigen.” MAXIMUM SPAN 46 cm The work is a masterpiece utilizing Consisting of twenty leaves and lacquered in fine gold and silver Condition: Excellent condition with miniscule associated wear. two very different techniques. A takamaki-e with an image of a pheasant, butterflies and dragonfly 3URYHQDQFH%ULWLVKFROOHFWLRQ massive (or many) woodblock(s) amongst flowers, grasses and leaves on one side. The reverse was required to craft this print. shows butterflies amongst chrysanthemum and peony flowers. Estimate EUR 2.000,- There are so many incredibly The guard is finely decorated with Shibayama inlays. The fan is held Starting price EUR 1.000,- detailed figures and inscriptions that it would be simply impossibly to do this entirely by hand. The painting, as well, is of the highest quality. The painting shows %XGGKDLQWKHFHQWHUVXUURXQGHG by beings from all dimensional SODQHVUDNDQV%RGKLVDWWYD heavenly beings, figures of the underworld and animals, all FRPLQJWRJHWKHUWRPRXUQ%XGGKD Shakyamuni’s death. Painting only SIZE 176.4 x 96.6 cm, With mounting SIZE 250.5 x 126.2 cm Condition: Very good age-related condition – minor losses, creases, fading of colors, staining (as visible in the images provided). There are some water stains to the back, which are not visible in the front as the painting is backed on paper. Provenance: Collection of Irene and Wolfgang Zacke. Estimate EUR 4.000,- Starting price EUR 2.000,- 110 111 353 | A VERY LARGE AND IMPORTANT PAINTED WOODCUT PRINT DEPICTING THE DEATH OF BUDDHA (NEHANZU) -DSDQGDWHG %XQVHLWK year), Edo period (1615-1868) A very large and elaborately crafted hand-painted woodcut print depicting Nehanzu (the GHDWKRI%XGGKD6KDN\DPXQL also known as paranirvana). The original woodcut was made by Matsubara Shogetsu in 1816 and was used as a template for this massive handcolored 351 | NANMEI: A SPECTACULAR IVORY woodcut print. The coloring was FOLDING FAN WITH FINE PAINTINGS is being collected for the impending cold season. The other side commissioned by a group of eight shows a dense composition of a bamboo forest with a large group votive donors (identified by name %\+DUXNL1DQPHL VLJQHG1DQPHLZLWKVHDO RIVSDUURZVVRPHIO\LQJDQGVRPHVWLOORQEUDQFKHV%RWKSDLQWLQJV in an inscription to the back). The Japan, early Meiji period (1868-1912) are signed and show a red seal, corresponding to Haruki Nanmei. inscription in the lower center of With string, tassles and a very fine satsuma gilt ojime. the painting states that it is based on a treasure collection at the An elaborately and very finely crafted folding fan or ogi in 30 HEIGHT 27 cm, WIDTH 50 cm when opened San’enji Temple which is better segments, each carved from ivory and some with a wavy shape. known as the Zojoji Temple, the The two exterior segments are partly painted with gold lacquer Condition: Superb condition with expected minor creases from Tokugawa shogunates’ family and show fine Shibayama style inlays with a bird, beetle, butterfly, folding the fan. WHPSOH %RGDLMLLQ-DSDQHVH (GR vines and fruit. The main side shows a large, dense landscape with Provenance: From the private collection of a Corsican seafarer. (Tokyo). The two inscriptions in a stream and very many pines, through which the snow-covered the back read: “the 16th of the Mount Fuji shines in the center. An elderly man and two young Estimate EUR 800,- Seventh month, the year of tiger, %RNXGR R[KHUGHUV DUHVKRZQHDFKSOD\LQJWKHIOXWHDQGZRRG Starting price EUR 400,- LQWKHWK\HDURIWKH%XQVHLHUD (1830). This is for the repose of the soul of the deceased (tsuizen kuyo in Japanese), Votive donors’ 352 | A FINE LACQUERED IVORY FAN together by a silver fitting with a tasseled cord attached to it and names listed: Myorin-in, Keirin-in, mounted with an ivory and Shibayama inlaid ojime. Shokenin, Keikyo-in, Shojaku-in, Japan, Meiji period (1868-1912) Kyosho-in, Seishin-in, Chigen.” MAXIMUM SPAN 46 cm The work is a masterpiece utilizing Consisting of twenty leaves and lacquered in fine gold and silver Condition: Excellent condition with miniscule associated wear. two very different techniques. A takamaki-e with an image of a pheasant, butterflies and dragonfly 3URYHQDQFH%ULWLVKFROOHFWLRQ massive (or many) woodblock(s) amongst flowers, grasses and leaves on one side. The reverse was required to craft this print. shows butterflies amongst chrysanthemum and peony flowers. Estimate EUR 2.000,- There are so many incredibly The guard is finely decorated with Shibayama inlays. The fan is held Starting price EUR 1.000,- detailed figures and inscriptions that it would be simply impossibly to do this entirely by hand. The painting, as well, is of the highest quality. The painting shows %XGGKDLQWKHFHQWHUVXUURXQGHG by beings from all dimensional SODQHVUDNDQV%RGKLVDWWYD heavenly beings, figures of the underworld and animals, all FRPLQJWRJHWKHUWRPRXUQ%XGGKD Shakyamuni’s death. Painting only SIZE 176.4 x 96.6 cm, With mounting SIZE 250.5 x 126.2 cm Condition: Very good age-related condition – minor losses, creases, fading of colors, staining (as visible in the images provided). There are some water stains to the back, which are not visible in the front as the painting is backed on paper. Provenance: Collection of Irene and Wolfgang Zacke. Estimate EUR 4.000,- Starting price EUR 2.000,- 110 111 354 | SESSON SHUKEI: A RARE PAINTING OF KINKO SENNIN Sealed Sesson and Shukei Japan, 16th century, Muromachi period (1336-1573) A large and expressively painted image of Kinko Sennin (in Chinese Qin Gao) reading from a scroll and riding on a gigantic carp, the latter 355 | A ‘BAMBOO’ 356 | JAPANESE SCROLL PAINTING with a crazed expression with large SCROLL WITH MOUNT FUJI eyes. The large dynamically painted PAINTING tail of the carp swings above the Japan, 19th century head of the Sennin, as the pair Japan, 19th century emerge from the mist around them. Note the fine and wise expression of This fine Japanese painting shows the sacred Mount Fuji with its the immortal, and the finely painted Skillfully with black ink snow-capped peak as the central image. The artist signature and fingers which hold the scroll. Framed painted on paper, signed, seal (Shunyo) is to be found at the lower left. under glass and set onto a European one seal. passe-partout. TOTAL SIZE 111 x 50 cm, IMAGE SIZE 27 x 40 cm SIZE c. 105 x 27 cm Satake Shukei (born Satake Heizo, Condition: Good condition with usual traces of wear and age 1504 – c. 1589) was a Japanese Zen Condition: Creasing, soiling, such as few moldy spots and creases to the mount. Monk painter from the Muromachi some minor losses, overall Provenance: Hungarian private collection. period, also known as the last great still fair condition, the Muromachi ink painter. His painting mountings with losses as Estimate EUR 300,- style is influenced by ink paintings well. Starting price EUR 150,- imported from China, his works Provenance: German being some of the earliest examples private collection. Acquired of ink painting in Japan, infused with during the 1980s. traditional subjects imbued with a power and originality, so unique to Estimate EUR 200,- Japanese painting. He was known to Starting price EUR 100,- have painted Sennin, and another Kinko Sennin is in the collection of the Kyoto National Museum, designated as a culturally important REMHFW -X\R%XQND]DL 357 | KANO EISHIN YASUNOBU: A SUMI-E DEPICTING GIBBONS One square seal to the lower right 358 | JAPANESE reading SHUKEI and another pot- %\.DQR(LVKLQ Estimate EUR 10.000,- Estimate EUR 300,- Starting price EUR 5.000,- Starting price EUR 150,- 112 113 354 | SESSON SHUKEI: A RARE PAINTING OF KINKO SENNIN Sealed Sesson and Shukei Japan, 16th century, Muromachi period (1336-1573) A large and expressively painted image of Kinko Sennin (in Chinese Qin Gao) reading from a scroll and riding on a gigantic carp, the latter 355 | A ‘BAMBOO’ 356 | JAPANESE SCROLL PAINTING with a crazed expression with large SCROLL WITH MOUNT FUJI eyes. The large dynamically painted PAINTING tail of the carp swings above the Japan, 19th century head of the Sennin, as the pair Japan, 19th century emerge from the mist around them. Note the fine and wise expression of This fine Japanese painting shows the sacred Mount Fuji with its the immortal, and the finely painted Skillfully with black ink snow-capped peak as the central image. The artist signature and fingers which hold the scroll. Framed painted on paper, signed, seal (Shunyo) is to be found at the lower left. under glass and set onto a European one seal. passe-partout. TOTAL SIZE 111 x 50 cm, IMAGE SIZE 27 x 40 cm SIZE c. 105 x 27 cm Satake Shukei (born Satake Heizo, Condition: Good condition with usual traces of wear and age 1504 – c. 1589) was a Japanese Zen Condition: Creasing, soiling, such as few moldy spots and creases to the mount. Monk painter from the Muromachi some minor losses, overall Provenance: Hungarian private collection. period, also known as the last great still fair condition, the Muromachi ink painter. His painting mountings with losses as Estimate EUR 300,- style is influenced by ink paintings well. Starting price EUR 150,- imported from China, his works Provenance: German being some of the earliest examples private collection. Acquired of ink painting in Japan, infused with during the 1980s. traditional subjects imbued with a power and originality, so unique to Estimate EUR 200,- Japanese painting. He was known to Starting price EUR 100,- have painted Sennin, and another Kinko Sennin is in the collection of the Kyoto National Museum, designated as a culturally important REMHFW -X\R%XQND]DL 357 | KANO EISHIN YASUNOBU: A SUMI-E DEPICTING GIBBONS One square seal to the lower right 358 | JAPANESE reading SHUKEI and another pot- %\.DQR(LVKLQ Estimate EUR 10.000,- Estimate EUR 300,- Starting price EUR 5.000,- Starting price EUR 150,- 112 113 359 | A GOOD LOT OF 5 CHINESE 360 | A SMALL JAPANESE PAINTING 363 | UTAGAWA HIROSHIGE (1797-1858): AND JAPANESE FANS A COLOR WOODBLOCK PRINT Japan, 19th century China, Japan, around 1900 Japan A small painting with some gold foil depicting a battle scene, Wood, paper and other partially organic materials, two with fine detail work. Set onto a book page with printed calligraphy. Tile Kilns and Hashiba Ferry, Sumida River (Sumidagawa Hashiba photo reprographies. Framed. no Watashi Kawaragawa), No. 37 from One Hundred Famous Views of Edo. The largest HEIGHT c. 20 cm SIZE c. 24 x 19 cm SIZE 35.5 x 25.5 cm Condition: Used, with some dents and losses here and there, Condition: Worn condition, creases and material loss. 364 | UTAGAWA HIROSHIGE (1797 – 1858): patina, wear, soiling. Provenance: From an Austrian private collection. Kept in the Condition: Very good condition. COMPLETE SET OF 21 COLOR Provenance: German private collection. Acquired in China around same family since the first half of the 20th century and thence by Provenance: From an Austrian private collection. Kept in the WOODBLOCK PRINTS 1900. Thence by descent. descent. same family since the first half of the 20th century and thence by descent. Japan Estimate EUR 200,- Estimate EUR 200,- Starting price EUR 100,- Starting price EUR 100,- Estimate EUR 400,- Starting price EUR 200,- This complete edition folder contains 21 tank size color reprints. All stamped and signed. Dimensions: SIZE of the folder 34 x 25.5 cm, SIZE of the prints 26 x 12 cm Condition: Very good condition. Provenance: Swiss Private Collection. Estimate EUR 1.500,- Starting price EUR 750,- 362 | A JAPANESE PAINTING Japan, 20th century 361 | A SMALL JAPANESE PAINTING Japan, 19th century 6PDOOSDLQWLQJGHSLFWLQJD%LMLQZLWKODUJHUREHVOHDQLQJRQDURFN underneath a willow. Signed and sealed by the artist. Framed. 365 | UTAGAWA HIROSHIGE (1797 – 1858): A small and charming square format painting depicting a court SIZE 34.5 x 28.5 cm (size of the painting) A COLOR WOODBLOCK PRINT scene. Set onto a book page with printed calligraphy. Condition: Good condition with usual traces of wear such as Japan SIZE 20 x 21 cm stains and minimal creases. Provenance: From an Austrian private collection. Kept in the Condition: Worn condition, creases and material loss. same family since the first half of the 20th century and thence by %HDXWLIXOULYHUVFHQHU\YLHZHUVRQWKHKLOOWRSHQMR\LQJWKHORYHO\ Provenance: From an Austrian private collection. Kept in the descent. view of Fuji in the distance. Framed. same family since the first half of the 20th century and thence by descent. Estimate EUR 200,- SIZE ca. 35 x 24 cm Starting price EUR 100,- Estimate EUR 200,- Condition: Age-related condition, corrugated paper, browning Starting price EUR 100,- and few creases. Provenance: Austrian private collection. Estimate EUR 600,- Starting price EUR 300,- For the remaining prints in the set see www.zacke.at 114 115 359 | A GOOD LOT OF 5 CHINESE 360 | A SMALL JAPANESE PAINTING 363 | UTAGAWA HIROSHIGE (1797-1858): AND JAPANESE FANS A COLOR WOODBLOCK PRINT Japan, 19th century China, Japan, around 1900 Japan A small painting with some gold foil depicting a battle scene, Wood, paper and other partially organic materials, two with fine detail work. Set onto a book page with printed calligraphy. Tile Kilns and Hashiba Ferry, Sumida River (Sumidagawa Hashiba photo reprographies. Framed. no Watashi Kawaragawa), No. 37 from One Hundred Famous Views of Edo. The largest HEIGHT c. 20 cm SIZE c. 24 x 19 cm SIZE 35.5 x 25.5 cm Condition: Used, with some dents and losses here and there, Condition: Worn condition, creases and material loss. 364 | UTAGAWA HIROSHIGE (1797 – 1858): patina, wear, soiling. Provenance: From an Austrian private collection. Kept in the Condition: Very good condition. COMPLETE SET OF 21 COLOR Provenance: German private collection. Acquired in China around same family since the first half of the 20th century and thence by Provenance: From an Austrian private collection. Kept in the WOODBLOCK PRINTS 1900. Thence by descent. descent. same family since the first half of the 20th century and thence by descent. Japan Estimate EUR 200,- Estimate EUR 200,- Starting price EUR 100,- Starting price EUR 100,- Estimate EUR 400,- Starting price EUR 200,- This complete edition folder contains 21 tank size color reprints. All stamped and signed. Dimensions: SIZE of the folder 34 x 25.5 cm, SIZE of the prints 26 x 12 cm Condition: Very good condition. Provenance: Swiss Private Collection. Estimate EUR 1.500,- Starting price EUR 750,- 362 | A JAPANESE PAINTING Japan, 20th century 361 | A SMALL JAPANESE PAINTING Japan, 19th century 6PDOOSDLQWLQJGHSLFWLQJD%LMLQZLWKODUJHUREHVOHDQLQJRQDURFN underneath a willow. Signed and sealed by the artist. Framed. 365 | UTAGAWA HIROSHIGE (1797 – 1858): A small and charming square format painting depicting a court SIZE 34.5 x 28.5 cm (size of the painting) A COLOR WOODBLOCK PRINT scene. Set onto a book page with printed calligraphy. Condition: Good condition with usual traces of wear such as Japan SIZE 20 x 21 cm stains and minimal creases. Provenance: From an Austrian private collection. Kept in the Condition: Worn condition, creases and material loss. same family since the first half of the 20th century and thence by %HDXWLIXOULYHUVFHQHU\YLHZHUVRQWKHKLOOWRSHQMR\LQJWKHORYHO\ Provenance: From an Austrian private collection. Kept in the descent. view of Fuji in the distance. Framed. same family since the first half of the 20th century and thence by descent. Estimate EUR 200,- SIZE ca. 35 x 24 cm Starting price EUR 100,- Estimate EUR 200,- Condition: Age-related condition, corrugated paper, browning Starting price EUR 100,- and few creases. Provenance: Austrian private collection. Estimate EUR 600,- Starting price EUR 300,- For the remaining prints in the set see www.zacke.at 114 115 370 | TOYOHARA KUNICHIKA (1835 - 1900): A COLOR WOODBLOCK PRINT Japan, 1864 367 | KATSUSHIKA HOKUSAI (1760-1849): WINTER LANDSCAPE Depicting the Actor Ichikawa Kuzo; Signature: Kunichika Japan ga and Toshidama-Seal; Publisher: Iseya, Censor: Aratame-Seal and date: 10th Winter landscape drawn showing the slope of Mount Fuji. Month 1864. Framed. 371 | TWO JAPANESE COLOR WOODBLOCK PRINTS SIZE 24.5 x 36 cm SIZE 33.5 x 22.5 cm (size of Japan the painting) Condition: Stains and browning, restorations around the edges, fading. 372 | KATSUSHIKA Condition: Very good Two Japanese woodblock prints depicting a courtesan playing the Provenance: From an Austrian private collection. Kept in the HOKUSAI condition and colors, few tiny VDPLVHQDQGDVDPXUDLUHVSHFWLYHO\%RWKIUDPHG same family since the first half of the 20th century and thence by (1760-1849): holes. descent. A SURIMONO Provenance: Austrian private SIZE c. 35.5 x 24.5 cm each (size of the painting) OF KINTARO estate, acquired in 2008 in 366 | KITAGAWA UTAMARO (1753-1806): Estimate EUR 300,- Galerie Zacke. Condition: Good condition and colors with expected age creases. 10 COLOR WOODBLOCK PRINTS Starting price EUR 150,- Japan Provenance: From an Austrian private collection. Kept in the Estimate EUR 150,- Japan, reprint from the Meiji period (1868-1912) to Taisho period same family since the first half of the 20th century and thence by Starting price EUR 75,- descent. (1912-1926) A Surimono format 369 | MIXED LOT OF 15 JAPANESE & color woodblock Estimate EUR 150,- CHINESE WOODBLOCK PRINTS print depicting Starting price EUR 75,- )URPWKHVHULHV-RVKRNXNDLNRWHZD]DNXVDb :RPHQHQJDJHG .LQWDUR *ROGHQ%R\ in the sericulture industry). The set is almost complete, only the Japan and China DbFKLOGbRIVXSHUKXPDQ print number 1 and 8 are missing, each signed Utamaro hitsu VWUHQJWKbWRJHWKHU and framed. with his mother and 373 | TWO JAPANESE COLOR WOODBLOCK PRINTS Comprising two monochrome Chinese prints and 13 Japanese playmates from Mount SIZE oban tate-e: c. 37.2 x 25 cm each color and monochrome prints. This lot offer various depictions of Ashigara. Framed. men and women, landscapes, animals and other nature motifs - Japan, 19th century Condition: Very good condition, some colors faded and few some show an artist seal and calligraphy. All framed. SIZE 20 x 18 cm silkworm holes. %RWKFRORUZRRGEORFNSULQWVGHSLFWLQJDIHPDOHILJXUHDQGZLWK Provenance: Austrian private estate. HEIGHT 15 – 23 cm, WIDTH 10 – 25 cm Condition: Very good calligraphy. condition with minor Estimate EUR 900,- Condition: Fresh colors; very few creases and stains, otherwise in browning. SIZE c. 39 x 27 cm each Starting price EUR 450,- very good condition. Provenance: Austrian Provenance: Austrian private estate. private estate. Condition: Very good condition. Provenance: Austrian private estate. Estimate EUR 1.500,- Estimate EUR 500,- 368 | FUJISHIMA TAKEJI: SNOW AT Starting price EUR 750,- Starting price EUR 250,- IWASHIMIZU-HACHIMAN SHRINE Estimate EUR 300,- Starting price EUR 150,- Japan, Showa period (1926-1989) 374 | FOUR JAPANESE WOODBLOCK PRINTS The color woodblock print is titled in the lower margin “SNOW AT IWASHIMIZU-HACHIMAN SHRINE, KYOTO”. Japan SIZE 26.6 x 40.5 cm Comprising two color woodblock prints depicting kabuki scenes, Condition: Very good condition and colors with only minor losses fine executed details and intricate robe designs; and two prints along the edges. GHSLFWLQJ%LMLQVRPHVKRZDQDUWLVWVHDODQGFDOOLJUDSK\ Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by HEIGHT 22 – 28 cm, WIDTH 12 – 21 cm descent. Condition: Good condition. Estimate EUR 200,- Provenance: Austrian private estate. Starting price EUR 100,- Estimate EUR 200,- Starting price EUR 100,- 116 117 370 | TOYOHARA KUNICHIKA (1835 - 1900): A COLOR WOODBLOCK PRINT Japan, 1864 367 | KATSUSHIKA HOKUSAI (1760-1849): WINTER LANDSCAPE Depicting the Actor Ichikawa Kuzo; Signature: Kunichika Japan ga and Toshidama-Seal; Publisher: Iseya, Censor: Aratame-Seal and date: 10th Winter landscape drawn showing the slope of Mount Fuji. Month 1864. Framed. 371 | TWO JAPANESE COLOR WOODBLOCK PRINTS SIZE 24.5 x 36 cm SIZE 33.5 x 22.5 cm (size of Japan the painting) Condition: Stains and browning, restorations around the edges, fading. 372 | KATSUSHIKA Condition: Very good Two Japanese woodblock prints depicting a courtesan playing the Provenance: From an Austrian private collection. Kept in the HOKUSAI condition and colors, few tiny VDPLVHQDQGDVDPXUDLUHVSHFWLYHO\%RWKIUDPHG same family since the first half of the 20th century and thence by (1760-1849): holes. descent. A SURIMONO Provenance: Austrian private SIZE c. 35.5 x 24.5 cm each (size of the painting) OF KINTARO estate, acquired in 2008 in 366 | KITAGAWA UTAMARO (1753-1806): Estimate EUR 300,- Galerie Zacke. Condition: Good condition and colors with expected age creases. 10 COLOR WOODBLOCK PRINTS Starting price EUR 150,- Japan Provenance: From an Austrian private collection. Kept in the Estimate EUR 150,- Japan, reprint from the Meiji period (1868-1912) to Taisho period same family since the first half of the 20th century and thence by Starting price EUR 75,- descent. (1912-1926) A Surimono format 369 | MIXED LOT OF 15 JAPANESE & color woodblock Estimate EUR 150,- CHINESE WOODBLOCK PRINTS print depicting Starting price EUR 75,- )URPWKHVHULHV-RVKRNXNDLNRWHZD]DNXVDb :RPHQHQJDJHG .LQWDUR *ROGHQ%R\ in the sericulture industry). The set is almost complete, only the Japan and China DbFKLOGbRIVXSHUKXPDQ print number 1 and 8 are missing, each signed Utamaro hitsu VWUHQJWKbWRJHWKHU and framed. with his mother and 373 | TWO JAPANESE COLOR WOODBLOCK PRINTS Comprising two monochrome Chinese prints and 13 Japanese playmates from Mount SIZE oban tate-e: c. 37.2 x 25 cm each color and monochrome prints. This lot offer various depictions of Ashigara. Framed. men and women, landscapes, animals and other nature motifs - Japan, 19th century Condition: Very good condition, some colors faded and few some show an artist seal and calligraphy. All framed. SIZE 20 x 18 cm silkworm holes. %RWKFRORUZRRGEORFNSULQWVGHSLFWLQJDIHPDOHILJXUHDQGZLWK Provenance: Austrian private estate. HEIGHT 15 – 23 cm, WIDTH 10 – 25 cm Condition: Very good calligraphy. condition with minor Estimate EUR 900,- Condition: Fresh colors; very few creases and stains, otherwise in browning. SIZE c. 39 x 27 cm each Starting price EUR 450,- very good condition. Provenance: Austrian Provenance: Austrian private estate. private estate. Condition: Very good condition. Provenance: Austrian private estate. Estimate EUR 1.500,- Estimate EUR 500,- 368 | FUJISHIMA TAKEJI: SNOW AT Starting price EUR 750,- Starting price EUR 250,- IWASHIMIZU-HACHIMAN SHRINE Estimate EUR 300,- Starting price EUR 150,- Japan, Showa period (1926-1989) 374 | FOUR JAPANESE WOODBLOCK PRINTS The color woodblock print is titled in the lower margin “SNOW AT IWASHIMIZU-HACHIMAN SHRINE, KYOTO”. Japan SIZE 26.6 x 40.5 cm Comprising two color woodblock prints depicting kabuki scenes, Condition: Very good condition and colors with only minor losses fine executed details and intricate robe designs; and two prints along the edges. GHSLFWLQJ%LMLQVRPHVKRZDQDUWLVWVHDODQGFDOOLJUDSK\ Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by HEIGHT 22 – 28 cm, WIDTH 12 – 21 cm descent. Condition: Good condition. Estimate EUR 200,- Provenance: Austrian private estate. Starting price EUR 100,- Estimate EUR 200,- Starting price EUR 100,- 116 117 375 | FUJIKAWA TAMENOBU: 376 | KUNISADA I : SIX 377 | KUNISADA I: 378 | HIROSHIGE: FIVE 379 | A MIXED GROUP OF 380 | KUNICHIKA: A GROUP FOUR ORIGINAL COLOR JAPANESE COLOR SIX JAPANESE JAPANESE COLOR FIVE JAPANESE COLOR OF JAPANESE COLOR WOODBLOCK PRINTS & WOODBLOCK PRINTS COLOR WOODBLOCK PRINTS WOODBLOCK PRINTS WOODBLOCK PRINTS TWO PRINTS BY KONO WOODBLOCK BAIREI Japan, 19th century PRINTS Japan, 19th century Japan, 18th to 19th century %\7R\RKDUD.XQLFKLND Japan, 19th century %\)XMLNDZD7DPHQREX Japan, 19th century Japan 19th century A group of six prints by Utagawa A group of five prints framed in a Each framed in a passe-partout. Kunisada I (1786-1865) each framed in passepartout; two by Hiroshige I or &RQVLVWLQJRI Ȃ%\.DWVXVKLND Each framed in a passe-partout and a passe-partout; consisting of: 1 – From A group of six prints by Ando Hiroshige (1797-1858) from the Hokusai (1760-1849), from the series consisting of: 1 – A Triptych of a Kabuki Each framed in a passe-partout. A group the series ‘Scenes of famous places Utagawa Kunisada I (1785- famous series ‘One hundred famous ‘Scenes on the banks of the Sumida scene in a teahouse by the riverbank, of four prints showing scenes from along the Tokaido Road’ 1863; 2 – 1865) each framed in a passe- views of Edo’ consisting of: 1 - Pine tree River’, Edition: Meiji period (1868-1912). 1st Month 1868. 2 – A Triptych with WKHVWRU\7ďNDLGďFKĭb+L]DNXULJHE\ Three actors in a Kabuki performance; partout and including three on the Hakka coast, 1856; Publisher: Vo- Ȃ%\8WDJDZD DIMENSIONS approx. 25 x 36.5 cm Condition: Very good condition; fresh colors and few stains. One with damaged borders and other with a restoration to the border. Provenance: German Private collection. Five prints formerly sold in Van ham and Lempertz Auctions. Estimate EUR 1.000,- For high resolution images of all lots see www.zacke.at Starting price EUR 500,- 118 119 375 | FUJIKAWA TAMENOBU: 376 | KUNISADA I : SIX 377 | KUNISADA I: 378 | HIROSHIGE: FIVE 379 | A MIXED GROUP OF 380 | KUNICHIKA: A GROUP FOUR ORIGINAL COLOR JAPANESE COLOR SIX JAPANESE JAPANESE COLOR FIVE JAPANESE COLOR OF JAPANESE COLOR WOODBLOCK PRINTS & WOODBLOCK PRINTS COLOR WOODBLOCK PRINTS WOODBLOCK PRINTS WOODBLOCK PRINTS TWO PRINTS BY KONO WOODBLOCK BAIREI Japan, 19th century PRINTS Japan, 19th century Japan, 18th to 19th century %\7R\RKDUD.XQLFKLND Japan, 19th century %\)XMLNDZD7DPHQREX Japan, 19th century Japan 19th century A group of six prints by Utagawa A group of five prints framed in a Each framed in a passe-partout. Kunisada I (1786-1865) each framed in passepartout; two by Hiroshige I or &RQVLVWLQJRI Ȃ%\.DWVXVKLND Each framed in a passe-partout and a passe-partout; consisting of: 1 – From A group of six prints by Ando Hiroshige (1797-1858) from the Hokusai (1760-1849), from the series consisting of: 1 – A Triptych of a Kabuki Each framed in a passe-partout. A group the series ‘Scenes of famous places Utagawa Kunisada I (1785- famous series ‘One hundred famous ‘Scenes on the banks of the Sumida scene in a teahouse by the riverbank, of four prints showing scenes from along the Tokaido Road’ 1863; 2 – 1865) each framed in a passe- views of Edo’ consisting of: 1 - Pine tree River’, Edition: Meiji period (1868-1912). 1st Month 1868. 2 – A Triptych with WKHVWRU\7ďNDLGďFKĭb+L]DNXULJHE\ Three actors in a Kabuki performance; partout and including three on the Hakka coast, 1856; Publisher: Vo- Ȃ%\8WDJDZD DIMENSIONS approx. 25 x 36.5 cm Condition: Very good condition; fresh colors and few stains. One with damaged borders and other with a restoration to the border. Provenance: German Private collection. Five prints formerly sold in Van ham and Lempertz Auctions. Estimate EUR 1.000,- For high resolution images of all lots see www.zacke.at Starting price EUR 500,- 118 119 381 | MIXED LOT OF 12 JAPANESE 382 | KAJITA HANKO (1870-1917): 385 | A SMALL PAINTING WOODBLOCK PRINTS 20 INK DRAWINGS ON PAPER OF TAOIST FIGURES, 19TH CENTURY Japan Japan, late 19th to early 20th century, Meiji period (1868-1912) Japan, 19th century. Painted on paper depicting three Taoist These 12 woodblock prints depict various birds among trees and A collection of 20 ink drawings on paper for book illustrations figures, gilt mat and wooden frame. flowers. Few after Ohara Shoson, some show an artist seal and (kuchi-e). The depictions vary widely, showing landscapes, flowers calligraphy. All framed. and birds, other animals, trees, houses and figures. Condition: Wear, tears, losses, HEIGHTS 20.5 – 35.5 cm, WIDTHS 12 – 29 cm SIZE 19.5 x 27.3 cm each and creasing. Provenance: Austrian private Condition: Fresh colors; very few creases Condition: Minor creases and damage around the edges; collection. and stains, very good condition. several sheets have small holes outside the images; overall good Provenance: Austrian private estate. condition. Dimensions: Size incl. frame 33.7 x Provenance: Galerie Zacke archive. 63.6 cm. Image size 26.6 x 42.1 cm. Estimate EUR 1.800,- Starting price EUR 900,- Estimate EUR 300,- Estimate EUR 200,- Starting price EUR 150,- Starting price EUR 100,- 386 | A KOREAN HARDWOOD CHEST, 19TH CENTURY Korea, 19th century. The chest with iron mountings, fittings, handles, and lock. Fine, naturally grown patina. Condition: Good condition with minor wear, age cracks, traces of use and chipping. Provenance: Austrian private collection. Acquired locally, by repute before 1980. 384 | HANABUSA ITCHO (1652-1724): Dimensions: Size 53.0 x 102.3 x A GROUP OF 45 FIGURATIVE DRAWINGS 47.6 cm. Japan, 17th to early 18th century, Edo period (1615-1868) Estimate EUR 800,- 383 | SEVEN BOOKS WITH SHUNGA PRINTS, Starting price EUR 400,- TAISHO OR LATER The 45 drawings by Hanabusa Itcho (1652-1724) each show a Japan, first half of the 20th century figural depiction. Every drawing is irregularly cut and mounted. Ink and colors on paper, mounted on paper. The books depicting various erotic scenes. (7) SIZE incl. mounting 33.5 x 29 cm, SIZE approx. 10 - 20 cm SIZE 18.3 x 12.0 cm (the five largest), 19.0 x 9.3 cm and 18.5 x Condition: Very good condition, minor stains here and there. 10.7 cm. Provenance: Galerie Zacke archive; previously in the collection of Émile Javal (1839-1907), French ophthalmologist. Condition: Wear, soiling and extensive traces of use. Provenance: Latvian private collection. Estimate EUR 300,- Starting price EUR 150,- Estimate EUR 500,- Starting price EUR 250,- 387 | A KOREAN PORTABLE ‘DOUBLE’ CABINET, LATE 19th CENTURY Korea. Solid wood with good patina and fully original brass fittings, made in the shape of butterflies and bats. Condition: Good condition with some traces of use, patina, scratches and losses Provenance: Austrian private collection. Dimensions: c. 180 x 80 x 40 cm. Estimate EUR 1.000,- Starting price EUR 500,- 120 121 381 | MIXED LOT OF 12 JAPANESE 382 | KAJITA HANKO (1870-1917): 385 | A SMALL PAINTING WOODBLOCK PRINTS 20 INK DRAWINGS ON PAPER OF TAOIST FIGURES, 19TH CENTURY Japan Japan, late 19th to early 20th century, Meiji period (1868-1912) Japan, 19th century. Painted on paper depicting three Taoist These 12 woodblock prints depict various birds among trees and A collection of 20 ink drawings on paper for book illustrations figures, gilt mat and wooden frame. flowers. Few after Ohara Shoson, some show an artist seal and (kuchi-e). The depictions vary widely, showing landscapes, flowers calligraphy. All framed. and birds, other animals, trees, houses and figures. Condition: Wear, tears, losses, HEIGHTS 20.5 – 35.5 cm, WIDTHS 12 – 29 cm SIZE 19.5 x 27.3 cm each and creasing. Provenance: Austrian private Condition: Fresh colors; very few creases Condition: Minor creases and damage around the edges; collection. and stains, very good condition. several sheets have small holes outside the images; overall good Provenance: Austrian private estate. condition. Dimensions: Size incl. frame 33.7 x Provenance: Galerie Zacke archive. 63.6 cm. Image size 26.6 x 42.1 cm. Estimate EUR 1.800,- Starting price EUR 900,- Estimate EUR 300,- Estimate EUR 200,- Starting price EUR 150,- Starting price EUR 100,- 386 | A KOREAN HARDWOOD CHEST, 19TH CENTURY Korea, 19th century. The chest with iron mountings, fittings, handles, and lock. Fine, naturally grown patina. Condition: Good condition with minor wear, age cracks, traces of use and chipping. Provenance: Austrian private collection. Acquired locally, by repute before 1980. 384 | HANABUSA ITCHO (1652-1724): Dimensions: Size 53.0 x 102.3 x A GROUP OF 45 FIGURATIVE DRAWINGS 47.6 cm. Japan, 17th to early 18th century, Edo period (1615-1868) Estimate EUR 800,- 383 | SEVEN BOOKS WITH SHUNGA PRINTS, Starting price EUR 400,- TAISHO OR LATER The 45 drawings by Hanabusa Itcho (1652-1724) each show a Japan, first half of the 20th century figural depiction. Every drawing is irregularly cut and mounted. Ink and colors on paper, mounted on paper. The books depicting various erotic scenes. (7) SIZE incl. mounting 33.5 x 29 cm, SIZE approx. 10 - 20 cm SIZE 18.3 x 12.0 cm (the five largest), 19.0 x 9.3 cm and 18.5 x Condition: Very good condition, minor stains here and there. 10.7 cm. Provenance: Galerie Zacke archive; previously in the collection of Émile Javal (1839-1907), French ophthalmologist. Condition: Wear, soiling and extensive traces of use. Provenance: Latvian private collection. Estimate EUR 300,- Starting price EUR 150,- Estimate EUR 500,- Starting price EUR 250,- 387 | A KOREAN PORTABLE ‘DOUBLE’ CABINET, LATE 19th CENTURY Korea. Solid wood with good patina and fully original brass fittings, made in the shape of butterflies and bats. Condition: Good condition with some traces of use, patina, scratches and losses Provenance: Austrian private collection. Dimensions: c. 180 x 80 x 40 cm. Estimate EUR 1.000,- Starting price EUR 500,- 120 121 IMPRINT Publisher Galerie Zacke founded 1968 © SZA Versteigerungen & Vertriebs GmbH 1070 Wien Mariahilferstraße 112, Stiege 1, 2. Stock Austria, Europe Tel (0043-1) 532 04 52 Email: [email protected] Editors Lukas Zacke Marion Schor Experts Lukas Zacke Alexander Zacke Max Zacke Assistance with production Susanne Zacke Norbu Thondup Julia Pastor Photography Georg Bodenstein Design Hermann Kienesberger Printing Gröbner Druck, Oberwart Website www.zacke.at © GALERIE ZACKE Reproduction forbidden IMPRINT Publisher Galerie Zacke founded 1968 © SZA Versteigerungen & Vertriebs GmbH 1070 Wien Mariahilferstraße 112, Stiege 1, 2. Stock Austria, Europe Tel (0043-1) 532 04 52 Email: [email protected] Editors Lukas Zacke Marion Schor Experts Lukas Zacke Alexander Zacke Max Zacke Assistance with production Susanne Zacke Norbu Thondup Julia Pastor Photography Georg Bodenstein Design Hermann Kienesberger Printing Gröbner Druck, Oberwart Website www.zacke.at © GALERIE ZACKE Reproduction forbidden 1070 VIENNA AUSTRIA MARIAHILFERSTRASSE 112 Tel +43 1 532 04 52 . Fax +20 (PDLORɝFH#]DFNHDW www.zacke.at