A.Felis Fdxa Gene Genbank: X81826.1 FASTA Graphics Go To

Total Page：16

File Type：pdf, Size：1020Kb

A.felis fdxA gene GenBank: X81826.1 FASTA Graphics Go to: LOCUS X81826 711 bp DNA linear BCT 26-JUL-2016 DEFINITION A.felis fdxA gene. ACCESSION X81826 VERSION X81826.1 KEYWORDS fdxA gene; ferredoxin. SOURCE Afipia felis (cat scratch disease bacillus) ORGANISM Afipia felis Bacteria; Proteobacteria; Alphaproteobacteria; Hyphomicrobiales; Bradyrhizobiaceae; Afipia. REFERENCE 1 AUTHORS Bergmans,A.M., Groothedde,J.W., Schellekens,J.F., van Embden,J.D., Ossewaarde,J.M. and Schouls,L.M. TITLE Etiology of cat scratch disease: comparison of polymerase chain reaction detection of Bartonella (formerly Rochalimaea) and Afipia felis DNA with serology and skin tests JOURNAL J. Infect. Dis. 171 (4), 916-923 (1995) PUBMED 7535830 REFERENCE 2 (bases 1 to 711) AUTHORS Bergmans,A.M.C. TITLE Direct Submission JOURNAL Submitted (21-SEP-1994) A.M.C. Bergmans, Nat. Inst. of Public Health and Environmental Protection, Unit Molecular Microbiology, P.O.Box 1, 3720 BA Bilthoven, NETHERLANDSFEATURES Location/Qualifiers source 1..711 /organism="Afipia felis" /mol_type="genomic DNA" /strain="ATCC 49716" /db_xref="taxon:1035" regulatory 370..375 /regulatory_class="minus_35_signal" /note="putative" regulatory 392..398 /regulatory_class="minus_10_signal" /note="putative" regulatory 423..426 /regulatory_class="ribosome_binding_site" /note="putative" gene 433..>711 /gene="fdxA" CDS 433..>711 /gene="fdxA" /note="putative" /codon_start=1 /transl_table=11 /product="ferredoxin" /protein_id="CAA57420.1" /db_xref="GOA:Q44037" /db_xref="InterPro:IPR000813" /db_xref="InterPro:IPR001450" /db_xref="InterPro:IPR017896" /db_xref="InterPro:IPR017900" /db_xref="InterPro:IPR022569" /db_xref="UniProtKB/Swiss-Prot:Q44037" /translation="MTYVVTENCIKCKYMDCVEVCPVDCFYEGENMLVIHPDECIDCG VCEPECPAEAIKPDTEQNLEKWLGVNAEYAKTWPNITQKKDAPADAKEF"ORIGIN 1 gaattcgccg ttcgccaaac tcgctgcgct gaaagaacag ctcggaaacc gcaaggactg 61 acgcctgtca ccggaccgcc agcgtctcga caagtggcta tggcatgcgc ggatcgtgcg 121 cacccggacc gacgcggcga aactggtgtt gggcggccgt gtccgcctca atggcatgcg 181 gcagacctct cccggacatg cgctgaaatc cggtgacgtg ctgacggtgg cacttgatgc 241 gcgggttcgt gttctgaaga ttgtcgcttt cagcgagcgt cggggtgatg cgccgtcagc 301 gcagggcctc tatnatgaat tgaacgggaa anagaagtaa ctatctcnna tagcagagcc 361 ttccttctct tgcagcgngg gatatcctgc gctaggccaa caccaaaatt tggaacggtt 421 ccggagatct ggatgactta cgtcgtcacc gaaaattgca tcaagtgcaa gtacatggac 481 tgcgttgagg tgtgtcccgt cgattgcttc tacgaaggcg agaacatgct cgtgatccat 541 ccggacgagt gcatcgactg cggcgtttgc gaaccggaat gcccggctga ggcgatcaag 601 cccgacactg agcagaatct ggaaaaatgg ctcggcgtga atgccgagta cgctaagact 661 tggcccaaca tcacccagaa aaaggatgcg cctgccgacg ccaaggaatt c // .

Copy Link

Recommended publications

Bartonella: Feline Diseases and Emerging Zoonosis
BARTONELLA: FELINE DISEASES AND EMERGING ZOONOSIS WILLIAM D. HARDY, JR., V.M.D. Director National Veterinary Laboratory, Inc. P.O Box 239 Franklin Lakes, New Jersey 07417 201-891-2992 www.natvetlab.com or .net Gingivitis Proliferative Gingivitis Conjunctivitis/Blepharitis Uveitis & Conjunctivitis URI Oral Ulcers Stomatitis Lymphadenopathy TABLE OF CONTENTS Page SUMMARY……………………………………………………………………………………... i INTRODUCTION……………………………………………………………………………… 1 MICROBIOLOGY……………………………………………………………………………... 1 METHODS OF DETECTION OF BARTONELLA INFECTION.………………………….. 1 Isolation from Blood…………………………………………………………………….. 2 Serologic Tests…………………………………………………………………………… 2 SEROLOGY……………………………………………………………………………………… 3 CATS: PREVALENCE OF BARTONELLA INFECTIONS…………………………………… 4 Geographic Risk factors for Infection……………………………………………………. 5 Risk Factors for Infection………………………………………………………………… 5 FELINE BARTONELLA DISEASES………………………………………………………….… 6 Bartonella Pathogenesis………………………………………………………………… 7 Therapy of Feline Bartonella Diseases…………………………………………………… 14 Clinical Therapy Results…………………………………………………………………. 15 DOGS: PREVALENCE OF BARTONELLA INFECTIONS…………………………………. 17 CANINE BARTONELLA DISEASES…………………………………………………………... 17 HUMAN BARTONELLA DISEASES…………………………………………………………… 18 Zoonotic Case Study……………………………………………………………………... 21 FELINE BLOOD DONORS……………………………………………………………………. 21 REFERENCES………………………………………………………………………………….. 22 This work was initiated while Dr. Hardy was: Professor of Medicine, Albert Einstein College of Medicine of Yeshiva University, Bronx, New York and Director,
[Show full text]
Afipia Clevelandensis Sp
JOURNAL OF CLINICAL MICROBIOLOGY, Nov. 1991, p. 2450-2460 Vol. 29, No. 11 0095-1137/91/112450-11$02.00/0 Copyright © 1991, American Society for Microbiology Proposal of Afipia gen. nov., with Afipia felis sp. nov. (Formerly the Cat Scratch Disease Bacillus), Afipia clevelandensis sp. nov. (Formerly the Cleveland Clinic Foundation Strain), Afipia broomeae sp. nov., and Three Unnamed Genospecies DON J. BRENNER,'* DANNIE G. HOLLIS,' C. WAYNE MOSS,' CHARLES K. ENGLISH,2 GERALDINE S. HALL,3 JUDY VINCENT,4 JON RADOSEVIC,5 KRISTIN A. BIRKNESS,1 WILLIAM F. BIBB,' FREDERICK D. QUINN,' B. SWAMINATHAN,1 ROBERT E. WEAVER,' MICHAEL W. REEVES,' STEVEN P. O'CONNOR,6 PEGGY S. HAYES,' FRED C. TENOVER,7 ARNOLD G. STEIGERWALT,' BRADLEY A. PERKINS,' MARYAM I. DANESHVAR,l BERTHA C. HILL,7 JOHN A. WASHINGTON,3 TONI C. WOODS,' SUSAN B. HUNTER,' TED L. HADFIELD,2 GLORIA W. AJELLO,1 ARNOLD F. KAUFMANN,8 DOUGLAS J. WEAR,2 AND JAY D. WENGER' Meningitis and Special Pathogens Branch,' Respiratory Diseases Branch,6 and Bacterial Zoonoses Activity,8 Division of Bacterial and Mycotic Diseases, and Hospital Infections Program,7 Center for Infectious Diseases, Centers for Disease Control, Atlanta, Georgia 30333; Department ofInfectious and Parasitic Diseases Pathology, Armed Forces Institute ofPathology, Washington, DC 20306-60002; Department of Microbiology, Cleveland Clinic Foundation, Cleveland, Ohio 441953; Department ofPediatrics, Tripler Army Medical Center, Tripler AMC, Hawaii 968594; and Indiana State Board of Health, Disease Control Laboratory Division, Indianapolis, Indiana 46206-19645 Received 3 June 1991/Accepted 5 August 1991 On the basis of phenotypic characterization and DNA relatedness determinations, the genus Afipia gen.
[Show full text]
A Distinct Pathway for Tetrahymanol Synthesis in Bacteria
A distinct pathway for tetrahymanol synthesis in bacteria Amy B. Banta1, Jeremy H. Wei1, and Paula V. Welander2 Department of Earth System Science, Stanford University, Stanford, CA 94305 Edited by John M. Hayes, Woods Hole Oceanographic Institution, Berkeley, CA, and approved September 25, 2015 (received for review June 11, 2015) Tetrahymanol is a polycyclic triterpenoid lipid first discovered in the physiological role of tetrahymanol in bacteria is unknown. Recent ciliate Tetrahymena pyriformis whose potential diagenetic product, studies have highlighted increased tetrahymanol production in gammacerane, is often used as a biomarker for water column strat- R. palustris TIE-1 under certain physiological conditions (e.g., ification in ancient ecosystems. Bacteria are also a potential source photoautotrophic growth) and also when cellular hopanoid lipid of tetrahymanol, but neither the distribution of this lipid in extant profiles are altered in gene deletion mutants (22, 23), but the bacteria nor the significance of bacterial tetrahymanol synthesis for physiological significance of these changes is not known. Further, interpreting gammacerane biosignatures is known. Here we couple the biochemical mechanism of tetrahymanol synthesis in bacteria comparative genomics with genetic and lipid analyses to link a pro- is unclear. In ciliates, squalene-tetrahymanol cyclase (Stc) cata- tein of unknown function to tetrahymanol synthesis in bacteria. This tetrahymanol synthase (Ths) is found in a variety of bacterial lyzes the cyclization of squalene directly to tetrahymanol (24), but genomes, including aerobic methanotrophs, nitrite-oxidizers, and neither of the two known bacterial tetrahymanol producers harbor sulfate-reducers, and in a subset of aquatic and terrestrial metage- a copy of Stc (10, 24).
[Show full text]
Thiocyanate and Organic Carbon Inputs Drive Convergent Selection for Specific Autotrophic Afipia and Thiobacillus Strains Within Complex Microbiomes
bioRxiv preprint doi: https://doi.org/10.1101/2020.04.29.067207; this version posted April 30, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Thiocyanate and organic carbon inputs drive convergent selection for specific autotrophic Afipia and Thiobacillus strains within complex microbiomes Robert J. Huddy1,2, Rohan Sachdeva3, Fadzai Kadzinga1,2, Rose Kantor4, Susan T.L. Harrison1,2 and Jillian F. Banfield3,4,5,6* 1The Center for Bioprocess Engineering Research, University of Cape Town, South Africa 2The Future Water Institute, University of Cape Town, South Africa 3The Innovative Genomics Institute at the University of California, Berkeley, California, USA 4The Department of Earth and Planetary Science, University of California, Berkeley, California, USA 5The Department of Environmental Science, Policy and Management, University of California, Berkeley, California, USA 6The University of Melbourne, Victoria, Australia *Corresponding Author: [email protected] Abstract Thiocyanate (SCN-) contamination threatens aquatic ecosystems and pollutes vital fresh water supplies. SCN- degrading microbial consortia are commercially deployed for remediation, but the impact of organic amendments on selection within SCN- degrading microbial communities has not been investigated. Here, we tested whether specific strains capable of degrading SCN- could be reproducibly selected for based on SCN- loading and the presence or absence of added organic carbon. Complex microbial communities derived from those used to treat SCN- contaminated water were exposed to systematically increased input SCN concentrations in molasses-amended and -unamended reactors and in reactors switched to unamended conditions after establishing the active SCN- degrading consortium.
[Show full text]
Genetic and Phenetic Analyses of Bradyrhizobium Strains Nodulating Peanut (Arachis Hypogaea L.) Roots DIMAN VAN ROSSUM,1 FRANK P
APPLIED AND ENVIRONMENTAL MICROBIOLOGY, Apr. 1995, p. 1599–1609 Vol. 61, No. 4 0099-2240/95/$04.0010 Copyright q 1995, American Society for Microbiology Genetic and Phenetic Analyses of Bradyrhizobium Strains Nodulating Peanut (Arachis hypogaea L.) Roots DIMAN VAN ROSSUM,1 FRANK P. SCHUURMANS,1 MONIQUE GILLIS,2 ARTHUR MUYOTCHA,3 1 1 1 HENK W. VAN VERSEVELD, ADRIAAN H. STOUTHAMER, AND FRED C. BOOGERD * Department of Microbiology, Institute for Molecular Biological Sciences, Vrije Universiteit, BioCentrum Amsterdam, 1081 HV Amsterdam, The Netherlands1; Laboratorium voor Microbiologie, Universiteit Gent, B-9000 Ghent, Belgium2; and Soil Productivity Research Laboratory, Marondera, Zimbabwe3 Received 15 August 1994/Accepted 10 January 1995 Seventeen Bradyrhizobium sp. strains and one Azorhizobium strain were compared on the basis of five genetic and phenetic features: (i) partial sequence analyses of the 16S rRNA gene (rDNA), (ii) randomly amplified DNA polymorphisms (RAPD) using three oligonucleotide primers, (iii) total cellular protein profiles, (iv) utilization of 21 aliphatic and 22 aromatic substrates, and (v) intrinsic resistances to seven antibiotics. Partial 16S rDNA analysis revealed the presence of only two rDNA homology (i.e., identity) groups among the 17 Bradyrhizobium strains. The partial 16S rDNA sequences of Bradyrhizobium sp. strains form a tight similarity (>95%) cluster with Rhodopseudomonas palustris, Nitrobacter species, Afipia species, and Blastobacter denitrifi- cans but were less similar to other members of the a-Proteobacteria, including other members of the Rhizobi- aceae family. Clustering the Bradyrhizobium sp. strains for their RAPD profiles, protein profiles, and substrate utilization data revealed more diversity than rDNA analysis. Intrinsic antibiotic resistance yielded strain- specific patterns that could not be clustered.
[Show full text]
Genome Sequencing and Annotation of Afipia Septicemium Strain OHSU II
ÔØ ÅÒÙ×Ö ÔØ Genome sequencing and annotation of Afipia septicemium strain OHSU II Philip Yang, Guo-Chiuan Hung, Haiyan Lei, Tianwei Li, Bingjie Li, Shien Tsai, Shyh-Ching Lo PII: S2213-5960(14)00033-6 DOI: doi: 10.1016/j.gdata.2014.06.001 Reference: GDATA 43 To appear in: Genomics Data Received date: 13 May 2014 Revised date: 2 June 2014 Accepted date: 2 June 2014 Please cite this article as: Philip Yang, Guo-Chiuan Hung, Haiyan Lei, Tianwei Li, Bingjie Li, Shien Tsai, Shyh-Ching Lo, Genome sequencing and annotation of Afipia septicemium strain OHSU II, Genomics Data (2014), doi: 10.1016/j.gdata.2014.06.001 This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain. ACCEPTED MANUSCRIPT Data in Brief Title: Genome sequencing and annotation of Afipia septicemium strain OHSU_II Authors: Philip Yang1, Guo-Chiuan Hung1, Haiyan Lei, Tianwei Li, Bingjie Li, Shien Tsai and Shyh-Ching Lo* 1 Both are first authors, equally contributed * Corresponding author Tel/Fax +1-301-827-3170/+1-301-827-0449 Email address: [email protected] Affiliations: Tissue Microbiology Laboratory, Division of Cellular and Gene Therapies, Office of Cellular, Tissue and Gene Therapies, Center for Biologics Evaluation and Research, Food and Drug Administration, Bethesda, Maryland, USA Abstract We report the 5.1 Mb noncontiguous draft genome of Afipia septicemium strain OHSU_II, isolated from blood of a female patient.
[Show full text]
Recombinase in Trio (RIT) Elements in Bacterial Genomes: Assessing the Distribution and Mobility of a Novel Yet Widespread Set of Mobile Genes
Recombinase in Trio (RIT) Elements in Bacterial Genomes: Assessing the Distribution and Mobility of a Novel yet Widespread Set of Mobile Genes. by Nicole Dorothy Ricker A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Department of Physical and Environmental Sciences University of Toronto Scarborough © Copyright by Nicole Ricker 2016 Recombinase in Trio (RIT) Elements in Bacterial Genomes: Assessing the Distribution and Mobility of a Novel yet Widespread Set of Mobile Genes. Nicole Dorothy Ricker Doctor of Philosophy Department of Physical and Environmental Sciences University of Toronto Scarborough 2016 Abstract The research performed over the course of my doctorate training outlines the environmental distribution, mobility, expression and potential role of a newly described family of mobile elements as well as providing valuable information on the challenges and potential benefits of environmental metagenomics. Sequencing technologies have evolved considerably over the course of this work, and evaluating the limitations and opportunities provided by these evolving technologies has formed a significant portion of my thesis work. The remainder of the work has been dedicated to understanding the distribution and mechanisms of Recombinase in Trio (RIT) elements, a previously underappreciated mobile element found in a large diversity of strains, but predominantly in non- pathogenic bacteria. Recombinase in Trio (RIT) elements contain three tyrosine-based site-specific recombinases and display a characteristic gene order and repeat architecture that is conserved across 7 bacterial phyla (Van Houdt et al. 2006; Van Houdt et al. 2012; Ricker et al. 2013). RIT elements have been postulated to be mobile due to the occurrence of multiple identical copies within individual genomes, and are commonly found on plasmids and in genomic islands, including plant symbiosis and catabolic islands.
[Show full text]
Genome-Informed Bradyrhizobium Taxonomy: Where to from Here?
Systematic and Applied Microbiology 42 (2019) 427–439 Contents lists available at ScienceDirect Systematic and Applied Microbiology jou rnal homepage: http://www.elsevier.com/locate/syapm Genome-informed Bradyrhizobium taxonomy: where to from here? a a a a,b Juanita R. Avontuur , Marike Palmer , Chrizelle W. Beukes , Wai Y. Chan , a c d e Martin P.A. Coetzee , Jochen Blom , Tomasz Stepkowski˛ , Nikos C. Kyrpides , e e f a Tanja Woyke , Nicole Shapiro , William B. Whitman , Stephanus N. Venter , a,∗ Emma T. Steenkamp a Department of Biochemistry, Genetics and Microbiology, Forestry and Agricultural Biotechnology Institute (FABI), University of Pretoria, Pretoria, South Africa b Biotechnology Platform, Agricultural Research Council Onderstepoort Veterinary Institute (ARC-OVI), Onderstepoort 0110, South Africa c Bioinformatics and Systems Biology, Justus-Liebig-University Giessen, Giessen, Germany d Autonomous Department of Microbial Biology, Faculty of Agriculture and Biology, Warsaw University of Life Sciences (SGGW), Poland e DOE Joint Genome Institute, Walnut Creek, CA, United States f Department of Microbiology, University of Georgia, Athens, GA, United States a r t i c l e i n f o a b s t r a c t Article history: Bradyrhizobium is thought to be the largest and most diverse rhizobial genus, but this is not reﬂected in Received 1 February 2019 the number of described species. Although it was one of the ﬁrst rhizobial genera recognised, its taxon- Received in revised form 26 March 2019 omy remains complex. Various contemporary studies are showing that genome sequence information Accepted 26 March 2019 may simplify taxonomic decisions. Therefore, the growing availability of genomes for Bradyrhizobium will likely aid in the delineation and characterization of new species.
[Show full text]
Development of a System for Genetic Manipulation of Bartonella Bacilliformis
University of Montana ScholarWorks at University of Montana Graduate Student Theses, Dissertations, & Professional Papers Graduate School 1998 Development of a system for genetic manipulation of Bartonella bacilliformis James M. Battisti The University of Montana Follow this and additional works at: https://scholarworks.umt.edu/etd Let us know how access to this document benefits ou.y Recommended Citation Battisti, James M., "Development of a system for genetic manipulation of Bartonella bacilliformis" (1998). Graduate Student Theses, Dissertations, & Professional Papers. 10534. https://scholarworks.umt.edu/etd/10534 This Dissertation is brought to you for free and open access by the Graduate School at ScholarWorks at University of Montana. It has been accepted for inclusion in Graduate Student Theses, Dissertations, & Professional Papers by an authorized administrator of ScholarWorks at University of Montana. For more information, please contact [email protected]. INFORMATION TO USERS This manuscript has been reproduced from the microfilm master. UMI films the text directly from the original or copy submitted. Thus, some thesis and dissertation copies are in typewriter face, while others may be from any type of computer printer. The quality of this reproduction is dependent upon the quality of the copy submitted. Broken or indistinct print, colored or poor quality illustrations and photographs, print bleedthrough, substandard margins, and improper alignment can adversely afreet reproduction. In the unlikely event that the author did not send UMI a complete manuscript and there are missing pages, these will be noted. Also, if unauthorized copyright material had to be removed, a note will indicate the deletion. Oversize materials (e.g., maps, drawings, charts) are reproduced by sectioning the original, beginning at the upper left-hand comer and continuing from left to right in equal sections with small overlaps.
[Show full text]
Efficient Ammonium Removal by Bacteria Rhodopseudomonas
water Article Efficient Ammonium Removal by Bacteria Rhodopseudomonas Isolated from Natural Landscape Water: China Case Study Xuejiao Huang, Jiupai Ni, Chong Yang, Mi Feng, Zhenlun Li * and Deti Xie * College of Resources and Environment, Key Laboratory of Soil Multiscale Interface Process and Control, Southwest University, Chongqing 400715, China; [email protected] (X.H.); [email protected] (J.N.); [email protected] (C.Y.); [email protected] (M.F.) * Correspondence: [email protected] (Z.L.); [email protected] (D.X.); Tel.: +86-138-8337-2713 (Z.L.); +86-139-0839-4691 (D.X.) Received: 26 July 2018; Accepted: 14 August 2018; Published: 20 August 2018 Abstract: In this study, we isolated a strain of photosynthetic bacteria from landscape water located in Southwest University, Chongqing, China, and named it Smobiisys501. Smobiisys501 was Rhodopseudomonas sp. according to its cell morphological properties and absorption spectrum analysis of living cells. The analysis of the 16S rDNA amplification sequence with specific primers of photosynthetic bacteria showed that the homology between Smobiisys501 and Rhodopseudomonas sp. was 100%, and the alignment results of protein sequences of the bacterial chlorophyll Y subunit showed that Smobiisys501 and Rhodopseudomonas palustris were the most similar, with a similarity of more than 92%. However, Smobiisys501 could not utilize glucose and mannitol as a carbon source and had a low fatty acid content, which were different from the related strains of the genus Rhodopseudomonas. Moreover, the DNA-DNA relatedness was only 42.2 ± 3.3% between Smobiisys501 and the closest strain Rhodopseudomonas palustris. Smobiisys501 grew optimally at 30 ◦C and pH 7.0 in the presence of yeast extract, and it could efficiently remove ammonium (99.67% removal efficiency) from synthetic ammonium wastewater.
[Show full text]
Isolation of Novel Afipia Septicemium and Identification of Previously Unknown Bacteria Bradyrhizobium Sp
Isolation of Novel Afipia septicemium and Identification of Previously Unknown Bacteria Bradyrhizobium sp. OHSU_III from Blood of Patients with Poorly Defined Illnesses Shyh-Ching Lo1*, Guo-Chiuan Hung1, Bingjie Li1, Haiyan Lei1, Tianwei Li1, Kenjiro Nagamine1¤, Jing Zhang1, Shien Tsai1, Richard Bryant2 1 Tissue Microbiology Laboratory, Division of Cellular and Gene Therapies, Office of Cellular, Tissue and Gene Therapies, Center for Biologics Evaluation and Research, Food and Drug Administration, Bethesda, Maryland, United States of America, 2 Department of Infectious Diseases, Oregon Health and Science University, Portland, Oregon, United States of America Abstract Cultures previously set up for isolation of mycoplasmal agents from blood of patients with poorly-defined illnesses, although not yielding positive results, were cryopreserved because of suspicion of having low numbers of unknown microbes living in an inactive state in the broth. We re-initiated a set of 3 cultures for analysis of the "uncultivable" or poorly- grown microbes using NGS technology. Broth of cultures from 3 blood samples, submitted from OHSU between 2000 and 2004, were inoculated into culture flasks containing fresh modified SP4 medium and kept at room temperature (RT), 30uC and 35uC. The cultures showing evidence of microbial growth were expanded and subjected to DNA analysis by genomic sequencing using Illumina MiSeq. Two of the 3 re-initiated blood cultures kept at RT after 7–8 weeks showed evidence of microbial growth that gradually reached into a cell density with detectable turbidity. The microbes in the broth when streaked on SP4 agar plates produced microscopic colonies in , 2 weeks. Genomic studies revealed that the microbes isolated from the 2 blood cultures were a novel Afipia species, tentatively named Afipia septicemium.
[Show full text]
Probing for the Diversity of Nitrobacter Species Rdna in a Wastewater Treatment Bioreactor Using Molecular Analysis
Journal of Experimental Microbiology and Immunology (JEMI) Vol. 4:27-32 Copyright © December 2003, M&I UBC Probing for the Diversity of Nitrobacter Species rDNA in a Wastewater Treatment Bioreactor Using Molecular Analysis SOPHIA LIN Department of Microbiology and Immunology, UBC In many studies, Nitrobacter was thought to be the dominant nitrite oxidizer because it was commonly isolated from sludges and wastewater treatment systems. In this study, we used molecular biological methods to assess the diversity of Nitrobacter species rDNA. Neither PCR amplification nor hybridization using Nitrobacter specific probes yielded results indicating the presence of Nitrobacter in the R5 bioreactor. This corresponds with many recent studies indicating that Nitrobacter is low in numbers in many natural and engineered nitrifying environments. It appears that Nitrobacter species are not the major bacteria responsible for nitrification in the R5 bioreactor since we were not able to detect its presence in the bioreactor mixed culture. Nitrification, an initial step in the removal of nitrogenous component of modern wastewater treatment, involves two steps - the conversion of ammonia to nitrite and nitrite to nitrate (1). Two distinct groups of bacteria are involved in the nitrification process. Ammonia-oxidizing bacteria (AOB) are responsible for the first step of nitrification, oxidizing ammonia to nitrite; whereas, nitrite-oxidizing bacteria (NOB) are involved in the second step of nitrification oxidizing nitrite to nitrate (2). Most of the characterized freshwater ammonia oxidizers are the members of the β subclass of the class Proteobacteria including the genera Nitrosomonas and Nitrosospira (10). In - - the second step the genus Nitrobacter is said to be responsible for the majority formation of NO3 from NO2 (6).
[Show full text]