A.Felis Fdxa Gene Genbank: X81826.1 FASTA Graphics Go To

A.Felis Fdxa Gene Genbank: X81826.1 FASTA Graphics Go To

A.felis fdxA gene GenBank: X81826.1 FASTA Graphics Go to: LOCUS X81826 711 bp DNA linear BCT 26-JUL-2016 DEFINITION A.felis fdxA gene. ACCESSION X81826 VERSION X81826.1 KEYWORDS fdxA gene; ferredoxin. SOURCE Afipia felis (cat scratch disease bacillus) ORGANISM Afipia felis Bacteria; Proteobacteria; Alphaproteobacteria; Hyphomicrobiales; Bradyrhizobiaceae; Afipia. REFERENCE 1 AUTHORS Bergmans,A.M., Groothedde,J.W., Schellekens,J.F., van Embden,J.D., Ossewaarde,J.M. and Schouls,L.M. TITLE Etiology of cat scratch disease: comparison of polymerase chain reaction detection of Bartonella (formerly Rochalimaea) and Afipia felis DNA with serology and skin tests JOURNAL J. Infect. Dis. 171 (4), 916-923 (1995) PUBMED 7535830 REFERENCE 2 (bases 1 to 711) AUTHORS Bergmans,A.M.C. TITLE Direct Submission JOURNAL Submitted (21-SEP-1994) A.M.C. Bergmans, Nat. Inst. of Public Health and Environmental Protection, Unit Molecular Microbiology, P.O.Box 1, 3720 BA Bilthoven, NETHERLANDSFEATURES Location/Qualifiers source 1..711 /organism="Afipia felis" /mol_type="genomic DNA" /strain="ATCC 49716" /db_xref="taxon:1035" regulatory 370..375 /regulatory_class="minus_35_signal" /note="putative" regulatory 392..398 /regulatory_class="minus_10_signal" /note="putative" regulatory 423..426 /regulatory_class="ribosome_binding_site" /note="putative" gene 433..>711 /gene="fdxA" CDS 433..>711 /gene="fdxA" /note="putative" /codon_start=1 /transl_table=11 /product="ferredoxin" /protein_id="CAA57420.1" /db_xref="GOA:Q44037" /db_xref="InterPro:IPR000813" /db_xref="InterPro:IPR001450" /db_xref="InterPro:IPR017896" /db_xref="InterPro:IPR017900" /db_xref="InterPro:IPR022569" /db_xref="UniProtKB/Swiss-Prot:Q44037" /translation="MTYVVTENCIKCKYMDCVEVCPVDCFYEGENMLVIHPDECIDCG VCEPECPAEAIKPDTEQNLEKWLGVNAEYAKTWPNITQKKDAPADAKEF"ORIGIN 1 gaattcgccg ttcgccaaac tcgctgcgct gaaagaacag ctcggaaacc gcaaggactg 61 acgcctgtca ccggaccgcc agcgtctcga caagtggcta tggcatgcgc ggatcgtgcg 121 cacccggacc gacgcggcga aactggtgtt gggcggccgt gtccgcctca atggcatgcg 181 gcagacctct cccggacatg cgctgaaatc cggtgacgtg ctgacggtgg cacttgatgc 241 gcgggttcgt gttctgaaga ttgtcgcttt cagcgagcgt cggggtgatg cgccgtcagc 301 gcagggcctc tatnatgaat tgaacgggaa anagaagtaa ctatctcnna tagcagagcc 361 ttccttctct tgcagcgngg gatatcctgc gctaggccaa caccaaaatt tggaacggtt 421 ccggagatct ggatgactta cgtcgtcacc gaaaattgca tcaagtgcaa gtacatggac 481 tgcgttgagg tgtgtcccgt cgattgcttc tacgaaggcg agaacatgct cgtgatccat 541 ccggacgagt gcatcgactg cggcgtttgc gaaccggaat gcccggctga ggcgatcaag 601 cccgacactg agcagaatct ggaaaaatgg ctcggcgtga atgccgagta cgctaagact 661 tggcccaaca tcacccagaa aaaggatgcg cctgccgacg ccaaggaatt c // .

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us