PHF16 (JADE3) Rabbit Polyclonal Antibody – TA335612 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

PHF16 (JADE3) Rabbit Polyclonal Antibody – TA335612 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA335612 PHF16 (JADE3) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: IHC, WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-PHF16 Antibody: synthetic peptide directed towards the middle region of human PHF16. Synthetic peptide located within the following region: KSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFY Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 94 kDa Gene Name: jade family PHD finger 3 Database Link: NP_055550 Entrez Gene 9767 Human Q92613 Background: This gene is part of a gene cluster on chromosome Xp11.23. PHF16 contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known.This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein. Synonyms: JADE-3; PHF16 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 PHF16 (JADE3) Rabbit Polyclonal Antibody – TA335612 Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Dog: 85%; Horse: 85%; Mouse: 85%; Guinea pig: 85% Protein Families: Druggable Genome, Transcription Factors Product images: WB Suggested Anti-PHF16 Antibody Titration: 0.2- 1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta Rabbit Anti-PHF16 Antibody; Paraffin Embedded Tissue: Human bronchiole epithelium; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

` Probing the Epigenome Andrea Huston1, Cheryl H Arrowsmith1,2
` Probing the Epigenome Andrea Huston1, Cheryl H Arrowsmith1,2, Stefan Knapp3,4,*, Matthieu Schapira1,5,* 1. Structural Genomics Consortium, University of Toronto, Toronto, ON M5G 1L7, Canada 2. Princess Margaret Cancer Centre and Department of Medical Biophysics, University of Toronto , Toronto, ON M5G 1L7, Canada 3. Nuffield Department of Clinical Medicine, Target Discovery Institute, and Structural Genomic Consortium, University of Oxford, Headington, Oxford OX3 7DQ, United Kingdom 4. Institute for Pharmaceutical Chemistry, Johann Wolfgang Goethe University, D-60438 Frankfurt am Main, Germany 5. Department of Pharmacology and Toxicology, University of Toronto, Toronto, ON M5S 1A8, Canada * Correspondence: [email protected], [email protected] Epigenetic chemical probes are having a strong impact on biological discovery and target validation. Systematic coverage of emerging epigenetic target classes with these potent, selective, cell-active chemical tools will profoundly influence our understanding of the human biology and pathology of chromatin-templated mechanisms. ` Chemical probes are research-enablers Advances in genomics and proteomics methodologies in recent years have made it possible to associate thousands of genes and proteins with specific diseases, biological processes, molecular networks and pathways. However, data from these large scale initiatives alone has not translated widely into new studies on these disease-associated proteins, and the biomedical research community still tends to focus on proteins that were already known before the sequencing of the human genome1. The human kinome for instance, a target class of direct relevance to cancer and other disease areas, is a telling example: based on the number of research articles indexed in pubmed in 2011, 75% of the research activity focused on only 10% of the 518 human kinases – largely the same kinases that were the focus of research before sequencing of the human genome - while 60% of the kinome, some 300 enzymes, was virtually ignored by the community2.
[Show full text]
PHF16 Antibody (C-Term) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # Ap17166b
10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 PHF16 Antibody (C-term) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP17166b Specification PHF16 Antibody (C-term) - Product Information Application WB, IHC-P,E Primary Accession Q92613 Other Accession NP_001070913.1, NP_055550.1 Reactivity Human Host Rabbit Clonality Polyclonal Isotype Rabbit Ig Calculated MW 93808 Antigen Region 779-806 PHF16 Antibody (C-term) - Additional Information PHF16 Antibody (C-term) (Cat. #AP17166b) Gene ID 9767 western blot analysis in 293 cell line lysates (35ug/lane).This demonstrates the PHF16 Other Names antibody detected the PHF16 protein (arrow). Protein Jade-3, Jade family PHD finger protein 3, PHD finger protein 16, JADE3, KIAA0215, PHF16 Target/Specificity This PHF16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 779-806 amino acids from the C-terminal region of human PHF16. Dilution WB~~1:1000 IHC-P~~1:10~50 Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity PHF16 Antibody (C-term) purification. (AP17166b)immunohistochemistry analysis in formalin fixed and paraffin embedded human Storage uterus tissue followed by peroxidase Maintain refrigerated at 2-8°C for up to 2 conjugation of the secondary antibody and weeks. For long term storage store at -20°C DAB staining.This data demonstrates the use in small aliquots to prevent freeze-thaw of PHF16 Antibody (C-term) for cycles. immunohistochemistry. Clinical relevance has not been evaluated. Precautions Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 PHF16 Antibody (C-term) is for research use PHF16 Antibody (C-term) - Background only and not for use in diagnostic or therapeutic procedures.
[Show full text]
PHF16 (JADE3) Rabbit Polyclonal Antibody – TA590529 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA590529 PHF16 (JADE3) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: ELISA, WB Recommended Dilution: WB 1:5000~20000,ELISA 1:100-1:2000 Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: DNA immunization. This antibody is specific for the C Terminus Region of the target protein. Formulation: 20 mM Potassium Phosphate, 150 mM Sodium Chloride, pH 7.0 Concentration: 1.27007 mg/ml Purification: Purified from mouse ascites fluids or tissue culture supernatant by affinity chromatography (protein A/G) Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Gene Name: jade family PHD finger 3 Database Link: NP_055550 Entrez Gene 9767 Human Q92613 Background: This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein. Synonyms: JADE-3; PHF16 Note: This antibody was generated by SDIX's Genomic Antibody Technology ® (GAT). Learn about GAT Protein Families: Druggable Genome, Transcription Factors This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 PHF16 (JADE3) Rabbit Polyclonal Antibody – TA590529 Product images: HEK293T cells were transfected with the pCMV6- ENTRY control (Cat# [PS100001], Left lane) or pCMV6-ENTRY PHF16 (Cat# [RC219274], Right lane) cDNA for 48 hrs and lysed.
[Show full text]
Supplementary Information Histone Deacetylase 1 and 2 Restrain CD4+
1 Supplementary Information Histone deacetylase 1 and 2 restrain CD4+ cytotoxic T lymphocyte differentiation Authors: Teresa Preglej1, Patricia Hamminger1, Maik Luu2, Tanja Bulat3, Liisa Andersen1, Lisa Göschl1,4, Valentina Stolz1, Ramona Rica1, Lisa Sandner 1, Darina Waltenberger1, Roland Tschismarov5, Thomas Faux6, Thorina Boenke7, Asta Laiho6, Laura L. Elo6, Shinya Sakaguchi1, Günter Steiner4,8, Thomas Decker5, Barbara Bohle9, Alexander Visekruna2, Christoph Bock7,10, Birgit Strobl4, Christian Seiser11, Nicole Boucheron1 and Wilfried Ellmeier1 1Division of Immunobiology, Institute of Immunology, Center for Pathophysiology, Infectiology and Immunology, Medical University of Vienna, Austria. 2Institute for Medical Microbiology and Hygiene, Philipps-University Marburg, Marburg, Germany. 3Institute of Animal Breeding and Genetics, Department of Biomedical Science, University of Veterinary Medicine Vienna, 1210 Vienna, Austria. 4Division of Rheumatology, Department of Internal Medicine III, Medical University of Vienna, 1090 Vienna, Austria. 5Max Perutz Labs, University of Vienna, Dr. Bohr-Gasse 9, 1030 Vienna 6Medical Bioinformatics Centre, Turku Bioscience Centre, University of Turku and Åbo Akademi University, Turku, Finland 7CeMM Research Center for Molecular Medicine of the Austrian Academy of Sciences, Vienna, Austria. 8Ludwig Boltzmann Institute for Arthritis and Rehabilitation, Vienna, Austria 9Department of Pathophysiology and Allergy Research, Center for Pathophysiology, Infectiology and Immunology, Medical University of Vienna,
[Show full text]
Lack of Rybp in Mouse Embryonic Stem Cells Impairs Cardiac Differentiation O
Page 1 of 43 1 Lack of Rybp in Mouse Embryonic Stem Cells Impairs Cardiac Differentiation O. Ujhelly1, V. Szabo2, G. Kovacs2, F. Vajda2, S. Mallok4, J. Prorok5, K. Acsai6, Z. Hegedus3, S. Krebs4, A. Dinnyes1,7 and M. K. Pirity2 * 1 BioTalentum Ltd, H-2100 Gödöllö, Hungary 2 Institute of Genetics, Biological Research Centre, Hungarian Academy of Sciences, H-6726 Szeged, Hungary 3 Institute of Biophysics, Biological Research Centre, Hungarian Academy of Sciences, H-6726 Szeged, Hungary 4 Laboratory for Functional Genome Analysis (LAFUGA), Gene Center, LMU Munich, Munich, Germany 5 Department of Pharmacology and Pharmacotherapy, University of Szeged, Szeged, Hungary 6 MTA-SZTE Research Group of Cardiovascular Pharmacology, Szeged, Hungary 7 Molecular Animal Biotechnology Laboratory, Szent Istvan University, Gödöllö, Hungary * Author for correspondence at Institute of Genetics, Biological Research Centre, Hungarian Academy of Sciences, H-6726 Szeged, Hungary Stem Cells and Development Ring1 and Yy1 Binding Protein (Rybp) has been implicated in transcriptional regulation, apoptotic signaling and as a member of the polycomb repressive complex 1 has important function in regulating pluripotency and differentiation of embryonic stem cells. Earlier, we have proven that Rybp plays essential role in mouse embryonic and central nervous system development. This work identifies Rybp, as a critical regulator of heart development. Rybp is readily detectable in the developing mouse heart from day 8.5 of embryonic development. Prominent Rybp expression persists during all embryonic stages and Rybp marks differentiated cell types of the heart. By utilizing rybp null embryonic stem cells (ESCs) in an in vitro cardiac Lack of Rybp in Mouse Embryonic Stem Cells Impairs Cardiac Differentiation (doi: 10.1089/scd.2014.0569) differentiation assay we found that rybp null ESCs do not form rhythmically beating cardiomyocytes.
[Show full text]
The Proteasomal Deubiquitinating Enzyme PSMD14 Regulates Macroautophagy by Controlling Golgi-To-ER Retrograde Transport
Supplementary Materials The proteasomal deubiquitinating enzyme PSMD14 regulates macroautophagy by controlling Golgi-to-ER retrograde transport Bustamante HA., et al. Figure S1. siRNA sequences directed against human PSMD14 used for Validation Stage. Figure S2. Primer pairs sequences used for RT-qPCR. Figure S3. The PSMD14 DUB inhibitor CZM increases the Golgi apparatus area. Immunofluorescence microscopy analysis of the Golgi area in parental H4 cells treated for 4 h either with the vehicle (DMSO; Control) or CZM. The Golgi marker GM130 was used to determine the region of interest in each condition. Statistical significance was determined by Student's t-test. Bars represent the mean ± SEM (n =43 cells). ***P <0.001. Figure S4. CZM causes the accumulation of KDELR1-GFP at the Golgi apparatus. HeLa cells expressing KDELR1-GFP were either left untreated or treated with CZM for 30, 60 or 90 min. Cells were fixed and representative confocal images were acquired. Figure S5. Effect of CZM on proteasome activity. Parental H4 cells were treated either with the vehicle (DMSO; Control), CZM or MG132, for 90 min. Protein extracts were used to measure in vitro the Chymotrypsin-like peptidase activity of the proteasome. The enzymatic activity was quantified according to the cleavage of the fluorogenic substrate Suc-LLVY-AMC to AMC, and normalized to that of control cells. The statistical significance was determined by One-Way ANOVA, followed by Tukey’s test. Bars represent the mean ± SD of biological replicates (n=3). **P <0.01; n.s., not significant. Figure S6. Effect of CZM and MG132 on basal macroautophagy. (A) Immunofluorescence microscopy analysis of the subcellular localization of LC3 in parental H4 cells treated with either with the vehicle (DMSO; Control), CZM for 4 h or MG132 for 6 h.
[Show full text]
PHF16 Antibody Cat
PHF16 Antibody Cat. No.: 25-196 PHF16 Antibody Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human Antibody produced in rabbits immunized with a synthetic peptide corresponding a region IMMUNOGEN: of human PHF16. TESTED APPLICATIONS: ELISA, WB PHF16 antibody can be used for detection of PHF16 by ELISA at 1:312500. PHF16 antibody APPLICATIONS: can be used for detection of PHF16 by western blot at 1 μg/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000. POSITIVE CONTROL: 1) Cat. No. 1309 - Human Placenta Lysate PREDICTED MOLECULAR 94 kDa WEIGHT: Properties PURIFICATION: Antibody is purified by peptide affinity chromatography method. CLONALITY: Polyclonal CONJUGATE: Unconjugated PHYSICAL STATE: Liquid September 24, 2021 1 https://www.prosci-inc.com/phf16-antibody-25-196.html Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% BUFFER: sucrose. CONCENTRATION: batch dependent For short periods of storage (days) store at 4˚C. For longer periods of storage, store STORAGE CONDITIONS: PHF16 antibody at -20˚C. As with any antibody avoid repeat freeze-thaw cycles. Additional Info OFFICIAL SYMBOL: PHF16 ALTERNATE NAMES: PHF16, JADE3, KIAA0215, MGC138748, MGC138749, PHF16, JADE-3 ACCESSION NO.: NP_055550 PROTEIN GI NO.: 7662006 GENE ID: 9767 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References This gene is part of a gene cluster on chromosome Xp11.23. PHF16 contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known.This gene is part of a gene cluster on chromosome Xp11.23.
[Show full text]
Molecular Signatures Differentiate Immune States in Type 1 Diabetes Families
Page 1 of 65 Diabetes Molecular signatures differentiate immune states in Type 1 diabetes families Yi-Guang Chen1, Susanne M. Cabrera1, Shuang Jia1, Mary L. Kaldunski1, Joanna Kramer1, Sami Cheong2, Rhonda Geoffrey1, Mark F. Roethle1, Jeffrey E. Woodliff3, Carla J. Greenbaum4, Xujing Wang5, and Martin J. Hessner1 1The Max McGee National Research Center for Juvenile Diabetes, Children's Research Institute of Children's Hospital of Wisconsin, and Department of Pediatrics at the Medical College of Wisconsin Milwaukee, WI 53226, USA. 2The Department of Mathematical Sciences, University of Wisconsin-Milwaukee, Milwaukee, WI 53211, USA. 3Flow Cytometry & Cell Separation Facility, Bindley Bioscience Center, Purdue University, West Lafayette, IN 47907, USA. 4Diabetes Research Program, Benaroya Research Institute, Seattle, WA, 98101, USA. 5Systems Biology Center, the National Heart, Lung, and Blood Institute, the National Institutes of Health, Bethesda, MD 20824, USA. Corresponding author: Martin J. Hessner, Ph.D., The Department of Pediatrics, The Medical College of Wisconsin, Milwaukee, WI 53226, USA Tel: 011-1-414-955-4496; Fax: 011-1-414-955-6663; E-mail: [email protected]. Running title: Innate Inflammation in T1D Families Word count: 3999 Number of Tables: 1 Number of Figures: 7 1 For Peer Review Only Diabetes Publish Ahead of Print, published online April 23, 2014 Diabetes Page 2 of 65 ABSTRACT Mechanisms associated with Type 1 diabetes (T1D) development remain incompletely defined. Employing a sensitive array-based bioassay where patient plasma is used to induce transcriptional responses in healthy leukocytes, we previously reported disease-specific, partially IL-1 dependent, signatures associated with pre and recent onset (RO) T1D relative to unrelated healthy controls (uHC).
[Show full text]
UC San Diego UC San Diego Electronic Theses and Dissertations
UC San Diego UC San Diego Electronic Theses and Dissertations Title Insights from reconstructing cellular networks in transcription, stress, and cancer Permalink https://escholarship.org/uc/item/6s97497m Authors Ke, Eugene Yunghung Ke, Eugene Yunghung Publication Date 2012 Peer reviewed|Thesis/dissertation eScholarship.org Powered by the California Digital Library University of California UNIVERSITY OF CALIFORNIA, SAN DIEGO Insights from Reconstructing Cellular Networks in Transcription, Stress, and Cancer A dissertation submitted in the partial satisfaction of the requirements for the degree Doctor of Philosophy in Bioinformatics and Systems Biology by Eugene Yunghung Ke Committee in charge: Professor Shankar Subramaniam, Chair Professor Inder Verma, Co-Chair Professor Web Cavenee Professor Alexander Hoffmann Professor Bing Ren 2012 The Dissertation of Eugene Yunghung Ke is approved, and it is acceptable in quality and form for the publication on microfilm and electronically ________________________________________________________________ ________________________________________________________________ ________________________________________________________________ ________________________________________________________________ Co-Chair ________________________________________________________________ Chair University of California, San Diego 2012 iii DEDICATION To my parents, Victor and Tai-Lee Ke iv EPIGRAPH [T]here are known knowns; there are things we know we know. We also know there are known unknowns; that is to say we know there
[Show full text]
Supp Data.Pdf
Supplementary Methods Verhaak sub-classification The Verhaak called tumor subtype was assigned as determined in the Verhaak et al. manuscript, for those TCGA tumors that were included at the time. TCGA data for expression (Affymetrix platform, level 1) and methylation (Infinium platform level 3) were downloaded from the TCGA portal on 09/29/2011. Affymetrix data were processed using R and Biocondutor with a RMA algorithm using quantile normalization and custom CDF. Level 3 methylation data has already been processed and converted to a beta-value. The genes that make up the signature for each of the 4 Verhaak groups (i.e. Proneural, Neural, Mesenchymal, and Classical) were downloaded. For each tumor, the averaged expression of the 4 genes signatures was calculated generating 4 ‘metagene’ scores, one for each subtype, (Colman et al.2010) for every tumor. Then each subtype metagene score was z-score corrected to allow comparison among the 4 metagenes. Finally, for each tumor the subtype with the highest metagene z-score among the four was used to assign subtype. Thus by this method, a tumor is assigned to the group to which it has the strongest expression signature. The shortcoming is that if a tumor has a ‘dual personality’ – for instance has strong expression of both classical and mesenchymal signature genes, there is some arbitrariness to the tumor’s assignment. Western Blot Analysis and cell fractionation Western blot analysis was performed using standard protocols. To determine protein expression we used the following antibodies: TAZ (Sigma and BD Biosciences), YAP (Santa Cruz Biotechnology), CD44 (Cell Signaling), FN1 (BD Biosciences), TEAD1, TEAD2, TEAD3, TEAD4 (Santa Cruz Biotechnology), MST1, p-MST1, MOB1, LATS1, LATS2, 14-3-3-, 1 ACTG2, (Cell Signaling), p-LATS1/2 (Abcam), Flag (Sigma Aldrich), Actin (Calbiochem), CAV2 (BD Biosciences), CTGF (Santa Cruz), RUNX2 (Sigma Aldrich), Cylin A, Cyclin E, Cyclin B1, p-cdk1, p-cdk4 (Cell Signaling Technologies).
[Show full text]
14 SI D. Chauss Et Al. Table S3 Detected EQ Gene-Specific
Table S3 Detected EQ gene‐specific transcripts statistically decreased in expression during EQ to FP transition. Gene Description log2(Fold Change) p‐value* CC2D2A coiled‐coil and C2 domain containing 2A ‐2.0 1.2E‐03 INSIG2 insulin induced gene 2 ‐2.0 1.2E‐03 ODZ2 teneurin transmembrane protein 2 ‐2.0 1.2E‐03 SEPHS1 selenophosphate synthetase 1 ‐2.0 1.2E‐03 B4GALT6 UDP‐Gal:betaGlcNAc beta 1,4‐ galactosyltransferase, ‐2.0 1.2E‐03 polypeptide 6 CDC42SE2 CDC42 small effector 2 ‐2.0 1.2E‐03 SLIT3 slit homolog 3 (Drosophila) ‐2.1 1.2E‐03 FKBP9 FK506 binding protein 9, 63 kDa ‐2.1 1.2E‐03 ATAD2 ATPase family, AAA domain containing 2 ‐2.1 1.2E‐03 PURH 5‐aminoimidazole‐4‐carboxamide ribonucleotide ‐2.1 1.2E‐03 formyltransferase/IMP cyclohydrolase PLXNA2 plexin A2 ‐2.1 1.2E‐03 CSRNP1 cysteine‐serine‐rich nuclear protein 1 ‐2.1 1.2E‐03 PER2 period circadian clock 2 ‐2.1 1.2E‐03 CERK ceramide kinase ‐2.1 1.2E‐03 NRSN1 neurensin 1 ‐2.1 1.2E‐03 C1H21orf33 ES1 protein homolog, mitochondrial ‐2.1 1.2E‐03 REPS2 RALBP1 associated Eps domain containing 2 ‐2.2 1.2E‐03 TPX2 TPX2, microtubule‐associated, homolog (Xenopus laevis) ‐2.2 1.2E‐03 PPIC peptidylprolyl isomerase C (cyclophilin C) ‐2.2 1.2E‐03 GNG10 guanine nucleotide binding protein (G protein), gamma 10 ‐2.2 1.2E‐03 PHF16 PHD finger protein 16 ‐2.2 1.2E‐03 TMEM108 transmembrane protein 108 ‐2.2 1.2E‐03 MCAM melanoma cell adhesion molecule ‐2.2 1.2E‐03 TLL1 tolloid‐like 1 ‐2.2 1.2E‐03 TMEM194B transmembrane protein 194B ‐2.2 1.2E‐03 PIWIL1 piwi‐like RNA‐mediated gene silencing 1 ‐2.2 1.2E‐03 SORCS1
[Show full text]
20151014.Nkh Et Al Supplemental
MATERIALS AND METHODS Mice All procedures involving mice were approved by the Fred Hutchinson Cancer Research Center Institutional Animal Care and Use Committee. C57BL/6J mice were obtained from The Jackson Laboratory. Single cell RNA sequencing (RNA-Seq) cDNA libraries were prepared from single olfactory epithelium neurons as previously described (10, 28). In brief, epithelial tissue was isolated from adult or neonatal animals (P2-P6), dissociated cells were plated on coverslips, and single cells transferred to individual tubes using a microcapillary pipet. Oligo dT-primed cDNAs were prepared from mRNAs in each cell using reverse transcriptase, a poly(A) extension was added to the 3’ end of each cDNA using deoxynucleotidyl transferase, and a universal primer then used to amplify the cDNAs. One-third of each cell cDNA mix was used for amplification. For some cells, a duplicate sample was amplified and sequenced starting with a different third of the sample. To assess the cell stages of neurons used for libraries prior to sequencing, aliquots of single cell libraries were used in PCR reactions with primers for genes expressed at different stages. Primers used were: Ascl1, 5’ primer, CCACGGTCTTTGCTTCTGTTTTC , 3’ primer, GTACGCAGAGGTAATCTCATTACATG, Neurog1, 5’ primer, 1 CCCTGAAGACGAGGTGAAAAGTC, 3’ primer, CCAGTGCCTGAATAGCTATGCTAG, Gap43, 5’ primer, CTGAACTTTAAGAAATGGCTTTCCAC , 3’ primer, GTTTAAGCCACACTGTTGGACTTG , Omp, 5’ primer GCATTTGCTGCTCGCTGGTG, 3’ primer, GTGCCACCGTTTTCCTGTCAG. cDNA libraries were prepared for sequencing using the Illumina TruSeq DNA Sample Prep Kit. Briefly, cDNAs were fragmented to ~300 bp, ligated to adaptors, and PCR amplified with adaptor primers. Samples were subjected to multiplexed sequencing using an Illumina HiSeq 2500 instrument and a paired end, 50 bp read-length sequencing strategy.
[Show full text]