OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA335612
PHF16 (JADE3) Rabbit Polyclonal Antibody Product data:
Product Type: Primary Antibodies Applications: IHC, WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-PHF16 Antibody: synthetic peptide directed towards the middle region of human PHF16. Synthetic peptide located within the following region: KSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFY Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 94 kDa Gene Name: jade family PHD finger 3 Database Link: NP_055550 Entrez Gene 9767 Human Q92613 Background: This gene is part of a gene cluster on chromosome Xp11.23. PHF16 contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known.This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein. Synonyms: JADE-3; PHF16
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 PHF16 (JADE3) Rabbit Polyclonal Antibody – TA335612
Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Dog: 85%; Horse: 85%; Mouse: 85%; Guinea pig: 85%
Protein Families: Druggable Genome, Transcription Factors
Product images:
WB Suggested Anti-PHF16 Antibody Titration: 0.2- 1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta
Rabbit Anti-PHF16 Antibody; Paraffin Embedded Tissue: Human bronchiole epithelium; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2