Annual Subscription: `3500/- (Downloadable PDF)
www.ProjectReporter.co.in Vol. 14 No. 3 l August 1, 2018 India’s Project Database 185 Projects & Tenders
GAINING TRACTION
® SUBSCRIBE NOW ! INDIA’S TRUSTED MAGAZINE ON PROJECT OPPORTUNITIES
Annual Subscription: `3500/- (Downloadable PDF) Annual Subscription: `3500/- (Downloadable PDF) Annual Subscription: `3500/- (Downloadable PDF)
www.ProjectReporter.co.in Vol. 12 No. 14 l January 15, 2017 India’s Project Database www.ProjectReporter.co.in Vol. 12 No. 13 l January 1, 2017 India’s Project Database www.ProjectReporter.co.in Vol. 13 No. 1 l July 1, 2017 India’s Project Database 174 Projects & Tenders 160 Projects & Tenders 159 Projects & Tenders
® ® ®
PROJECT REPORTER B2B Multisector digital magazine providing more than 100 projects which are arranged stage wise & presented in a tabular format along with the contact details.
PROJECT REPORTER - ELECTRONIC EDITION (DOWNLOADABLE PDF) Tenure Cover Price You Save You Pay 1 Year (24 Issues) 3,500 - 3,500 3 Years (72 Issues) 10,500 3,150 7,350 5 Years (120 Issues) 17,500 7,000 10,500
To Subscribe Call: 022 2419 3000 | Email: [email protected] Subscribe Online: www.ProjectReporter.co.in
ASAPP Info Global Services Pvt Ltd. A-303, Nav Bharat Estate, Zakaria Bunder Road, Sewri [West], Mumbai- 400015. Tel: +91 22-2419 3000 | Email: [email protected] CONTENTS
Sections Page No
India’s Project Database
www.ProjectReporter.co.in India Opportunities 4 Published by: ASAPP Info Global Services Pvt Ltd, A-303, Navbharat Estates, Zakaria Bunder Road, Sewri (West), Mumbai-400 015. Projects 7 Tel: 022-24193000. Fax: 022-2417 5734. Editor-in-Chief Pratap Vijay Padode E-mail: [email protected] Focus: Railways 32 [email protected] Executive Editor
REALTY Sandeep Sharma* PROJECTS [email protected] Realty Projects 21 [email protected] Tel.: 022-2419 3000 / 6526 7838
%UDQFK2I¿FHV 'HOKL7HO INFRA Opportunities 25 %DQJDORUH7HO 3XQH7HO &KHQQDL Equipment Tenders 44 5HSUHVHQWDWLYH2I¿FHV Austria, Switzerland & Germany Gunter Schneider - LQIR#JVPLQWHUQDWLRQDOHX
*Responsible for selection of news under the INDUSTRIAL OPPORTUNITIES Industrial Projects 47
35%$FW$OOULJKWVUHVHUYHG:KLOHDOOHIIRUWVDUHPDGH Project Reporter 34 August 1, 2017 to ensure that the information published is correct, 352-(&75(3257(5KROGVQRUHVSRQVLELOLW\IRUDQ\ XQOLNHO\HUURUVWKDWPLJKWKDYHRFFXUUHG Industrial Tenders 46 Printed and Published by Tarun Pal on behalf of
ASAPP Info Global Services Pvt Ltd. And Published from A-303, Navbharat Estates, Zakaria Bunder Road, Sewri (West), Mumbai-400 015. Editor : Pratap Vijay Padode. Smart Cities Tender 50 The information on products and projects on offer is EHLQJSURYLGHGIRUWKHUHIHUHQFHRIUHDGHUV+RZHYHU readers are cautioned to make inquiries and take their GHFLVLRQVRQSXUFKDVHRULQYHVWPHQWDIWHUFRQVXOWLQJ Economic Insights 54 H[SHUWVRQWKHVXEMHFW352-(&75(3257(5KROGV no responsibility for any decision taken by readers on the basis of information provided herein. Subject to Mumbai Jurisdiction only. Power Statistics 52
Database | Consultants, Certifying And Rating Agencies 57
Project Reporter 3 August 1, 2018 Project Highlights
SECTOR SR NO. SECTOR SR NO. Agro Products Gas-insulated substation in Patto 27 Starch manufacturing unit at Nawarangpur 1 MH plants for two thermal power projects in U.P. 64 Airport/Aviation Northern Region Strengthening Scheme (NRSS)-29 79 Bhogapuram airport project 70 Railways Aluminium Tirupati Railway Station redevelopment plan 28 Aluminium Conductors unit at Angul 2 Roadbed and bridges between Bobbili and Gotlam 29 Bio-mass Energy Signalling works for 3rd line of track between Jimidipeta - 30 160 bio mass processing plant in Punjab 3 Bobbili Bio-mass plant at Mehma Sarja 73 Railway line from Thalassery via Mananthawadi to Mysuru 31 Breweries/Distilleries 125.5 km RRTS from Thiruvananthapuram to Chengannur 32 2.50 lakh hl/annum capacity brewing Industry at Dhenkanal 4 Ettumanoor-Pala linking Sabari line 33 Canal/Dam/Irrigation CSMT-Panvel elevated fast corridor project 34 New barrage on river Krishna 5 Manoharabad to Gajwel railway line 35 Mohanpura Major Project 56 Rail connectivity to Vizhinjam Port 72 Modernisation of Nagarjuna canals 74 Dallirajhara - Rowghat New Line project 80 Cement Haridaspur - Paradeep New Line project 81 Expansion of cement production capacity in next 2-3 years 6 Angul - Sukinda New Line project 82 Operation of lime sludge drying system at TNPL 7 Obulavaripalle - Krishnapattnam New Line project 83 Construction Mau-Ghazipur-Tarighat New Line project 84 Redevelopment of GPRA colony at Netaji Nagar 8 Roads/Highways/Bridges Parking for Shopping complex in Tajbagh dargah 9 Six laning of Narasannapeta - Ranasthalam section 36 Town hall in Nagaur 10 Special repair of road from Bachhod to Kunjpura 37 Plant building at Kharagpur 11 Flyover from East Fort to Manacaud 38 Civil Works for its new corporate office of Zydus 57 High level bridge on the Ban Ganga river in Balaghat district 39 Steel structure building at Gurugram 58 Two laning roads with paved shoulders in Nanded 40 Drugs/Pharma Railway under bridge between Avadi - Pattabiram 41 Civil Works for Brahmsthan Development 59 Road Over Bridge (ROB) between Karwandia - Sasaram 42 IV fluids unit at Ramdaspur 12 Road construction project on the southern coast of Mumbai 65 Edible Oil Development of Purvanchal Expressway from Chand Sarai to 66 Vegetable oil unit at Paradeep 13 Sansara Electricals/Electronics Development of Purvanchal Expressway from Sansara to 67 Jaraikala Consumer electronics plant at JNPT Sez 14 Sewage Treatment Energy Efficiency Sewage water treatment plant at Shivamogga 43 LED lights for Jaipur 75 Smart Cities Food and Beverages Smart roads for Karimnagar 44 Expansion of non-alcoholic beverage plant at I.E., Khurdha 15 Food Park Smart Meters Food Park along the Yamuna expressway 16 Smart meters installation in Haryana 45 Food Products Solar Power Biscuit manufacturing unit at Khordha 76 Floating solar PV project on the Ujjani Dam 46 Healthcare Sports Infrastructure Upgradation Of Infrastructure at Victoria Hospital 17 Sports infrastructure development at Alwar 47 Additional bldg for govt hospital at Tiruttani 18 Supply Chain Hand transplant operation theatre construction in Chennai 19 Cash and carry stores in Uttar Pradesh 48 Medical college in Kalahandi 77 Tourism Housing Heliport at Dhalli 85 2500 houses to come up in Jaipur and Bhiwadi 20 Tyres Hydro Power Civil works for factory building for the proposed LMC Plant 68 Jangi-Thopan-Powari hydro power project 21 Waste-to-Energy Iron & Steel Waste-to-energy plant in Nagpur 49 7MTPA Iron Ore Beneficiation Plant at Guali 22 Water Sector IT Park Installation of RO plants for schools in Vizag 50 STPI centre in Odisha 71 7.77 MLD capacity Conventional Water Treatment Plant in 51 Metro Rail Jharkhand Kochi Metro extension project 23 Elevated Water Storage Reservoir at Motha 52 Pune metro project extension proposal 78 Water Transport Oil & Gas River Barak National Waterways (NW-16) project 86 PTA unit at Paradip 24 River Gandak National Waterways (NW-37) project 87 Hydrogen generation unit for HPCL’s Visakh refinery 60 National Waterways-68 project – Mandovi– Usgaon Bridge 88 Supply of critical Reactors & heavy equipment 61 Alappuzha – Kottayam – Athirampuzha Canal (NW-9) project 89 Seven Cracker Furnaces at Bathinda Refinery 62 River Rupnarayan National Waterways (NW-86) project 90 Dross refining project 63 Water Treatment Paper 5 MLD water treatment plant at Tirupati 53 1.50 MLD Water Treatment Plant at Rudraprayag 54 Paper board manufacturing plant at Sonepur 25 WTP for Kharagpur settlement 55 Power Wind Energy Two new units at Lower Sileru 26 100 MW wind power project in Maharashtra 69
Project Reporter 4 August 1, 2018 INDIA OPPORTUNITIES looking forward to meet the rising demand for Tabular Alumina AEROSPACE from its India based plant. The growing demand for refractory products which use premium alumina for longer refractory life has AEROSPACE UNIT AT SANAND fuelled the growth plants for Almatis. Jaivel Aerospace has decided to set up a manufacturing facility at Sanand near Ahmedabad to manufacture smart tooling DQGSUHFLVLRQÀ\LQJFRPSRQHQWV/DQGLVDFTXLUHGIURP*,'& AUTOMOBILE 7KH¿UVWSKDVHRIWKHSURMHFWZLOOFRVW5VFURUHDQGVWDUWVRRQ The completion is targeted by December 2018. SMIPL TO SET UP SECOND TWO-WHEELER UNIT IN GURUGRAM AGRO PRODUCTS Two-wheeler manufacturer Suzuki Motorcycle India Pvt Ltd (SMIPL) to set up a second plant in Gurugram over the next two years at a cost of Rs 600 crore. The current plant in Gurugram MK AGROTECH TO SET UP RE-PACKING UNIT has the capacity to churn out 10 lakh units per annum. Satoshi AT HYDERABAD Uchida, Managing Director, SMIPL has briefed the media about MK Agrotech is into edible oil, branded sugar and wheat atta the new plant. According to him the installed capacity of the Unit segment. The Karnataka based company currently has re- LQ¿UVWSKDVHZLOOEHODNKXQLWVSHUDQQXP7KLVZRXOGEH packing units in Srirangapatnam and Bengaluru. To meet the scaled upto one million. growing demand, the company is setting up re-packing unit in +\GHUDEDGLQVL[PRQWKVDWDFRVWRI5VFURUH2Q completion, the company may come up with re-packing unit in 4 DEFENCE 0DKDUDVKWUDHLWKHUQHDU%KLZDQGLRU1DYL0XPEDL
GOVERNMENT SIGNS 106 DEFENCE CONTRACTS WITH AIRPORT/AVIATION LOCAL VENDORS Minister of State for Defence Subhash Bhamre has informed the Lok Sabha in a written reply that around 106 contracts were SINDHUDURG AIRPORT GETS READY FOR LAUNCH signed in the last three and half years with local vendors for Sindhudurg airport construction work is nearing completion. procurement of defence equipment. The contracts have been So far around 80 per signed for the purchase of helicopters, radars, ballistic helmets, cent work is artillery guns, simulators, missiles, bullet proof jackets, electronic completed comprising fuses and ammunition. passenger terminal building construction, $7&WRZHUDQG EDUCATION4 / SKILL DEVELOPMENT technical building. The remaining work will take a month to ODIA UNIVERSITY TO COME UP IN PURI DISTRICT complete. The The Government of Odisha has given approval for the setting JUHHQ¿HOGDLUSRUWLVFRPLQJXSDW3DUXOH&KLSLLQ6LQGKXGXUJ up of the Odia University at Satyabadi in Puri district of Odisha. Maharashtra. The work on the taxi way, apron and isolation bay 7KHSURSRVDOZDVDSSURYHGE\WKH¿UVW+HULWDJH&DELQHWPHHWLQJ KDVEHHQFRPSOHWHG7KHDLU¿HOGJURXQGOLJKWLQJZRUNLVRQ7KH FKDLUHGE\&KLHI0LQLVWHU1DYHHQ3DWQDLNRI¿FLDOVRXUFHV7KH DLUSRUWLVEHLQJEXLOWDWDFRVWRI5VFURUH VWDWHJRYHUQPHQWZLOODOORWDFUHIRUVHWWLQJXSWKH8QLYHUVLW\
ALUMINA IRON AND STEEL ALMATIS GETS READY WITH A NEW TABULAR ALUMINA PLANT IN FALTA Almatis, world leader in production and supply of premium PRAKASH INDUSTRIES GETS STAGE-I APPROVAL FOR alumina and alumina-based products, is coming up with a new SIRKAGUTTU IRON ORE MINE Tabular Alumina plant in Falta, West Bengal. The company is With regard to the mining lease of the Sirkaguttu iron ore
Project Reporter 5 August 1, 2018 India Opportunities
mine, the environment ministry has given Stage-I approval for Services for preparation of Feasibility Study/Detailed Project diversion of revenue forest land to Prakash Industries. The mining 5HSRUWRIVHOHFWHGURDGVWUHWFKHVIRUXSJUDGDWLRQODQH1+ lease was executed by Government of Odisha in January, 2017. connectivity under Sagarmala Scheme/Bharatmala 3UDNDVK,QGXVWULHVLVLQWRPDQXIDFWXULQJRIVWHHOSURGXFWV39& Pariyojana Phase-I. pipes and power generation. The company is having plans to LQFUHDVHVWHHOFDSDFLW\WR073$RYHUWKHQH[W\HDUV FOUR LANING OF DELHI-SAHARANPUR )RXUODQLQJRI'HOKL6DKDUDQSXU1+%IURPNP QHDU6KDPOL WRNP QHDU6DKDUDQSXU MANUFACTURING GHVLJQNPWRNP OHQJWKNP LQWKHVWDWH RI8WWDU3UDGHVK 3DFNDJH,, RQ(3&PRGHXQGHU Bharatmala Pariyojana. ODISHA CM INVITES TATA GROUP TO SET UP MANUFACTURING CLUSTER IN THE STATE REHABILITATION OF DAMAGED BRIDGE AT KM. 400.900 2GLVKD&KLHI0LQLVWHU1DYHHQ3DWQDLNKDVLQYLWHG7DWD*URXS NEAR JENAPUR to set up defence manufacturing cluster spread on 871 acre at Urgent Repair and Rehabilitation of Damaged Bridge at Km. 1DUDMLQWKHVWDWHRI2GLVKD2GLVKD&0KDVSURSRVHGWKH7DWD QHDU-HQDSXUDFURVV5LYHU%UDKPDQLLQ&KDQGLNKRO Group to setup an e-vehicle project, manufacturing unit at Paradip 'XEXUL7DOFKHUVHFWLRQRI1+ 1HZ1+ LQWKH6WDWHRI2GLVKD 3&3,5DQGDGGLWLRQDOLQYHVWPHQWVLQPDQXIDFWXULQJVHFWRUDW Tata SEZ. SOLAR ENERGY METRO RAIL TENDER FOR 1000 MW OF SOLAR PROJECT IN DHOLERA TO COME OUT SOON BMRCL TO IMPLEMENT METRO OUTER RING ROAD The Gujarat Government has approved the establishment of a (ORR) LINE 0:VRODUSDUNLQWKH'KROHUD6SHFLDO,QYHVWPHQW5HJLRQ '6,5 FRYHULQJPRUHWKDQDFUH'KROHUD,QGXVWULDO&LW\ 'HYHORSPHQW&RUSRUDWLRQ ',&'& LVOLNHO\WRLVVXHWKH¿UVW0: tender in the next month. According to Mercom’s India Solar Project Tracker, the state of Gujarat has ~1.4 GW of large-scale VRODUSURMHFWVLQRSHUDWLRQDQGRYHU0:XQGHUGHYHORSPHQW
TELECOM
WISTRON TO INVEST FURTHER IN KARNATAKA FOR MAKING SMARTPHONES Apple’s Taiwanese contract manufacturer in India, Wistron is %DQJDORUH0HWUR5DLO&RUSRUDWLRQ/WG %05&/ SODQVWR VHWWLQJXSDPDQXIDFWXULQJIDFLOLW\DW1DUDVDSXUDLQGXVWULDODUHDRI implement Metro Outer Ring Road (ORR) line. The project is Kolar district in Karnataka. The new unit is likely to churn out HVWLPDWHGWRFRVW5VFURUHDQGWKH¿UVWRI1DPPD0HWUR smartphones, IoT products and biotech devices. The company is OLQHVWKDWZLOOEHEXLOWZLWKVXSSRUWIURPFRUSRUDWHV$URXQG OLNHO\WRUDLVHLWVLQYHVWPHQWIURP5VFURUHWR5VFURUH sqmt of land, including 48 properties will be acquired in this regard. Intel will support in the development of Bellandur Metro TOYS station, Embassy Group is already on board for developing Kadubeesanahalli Metro station. The completion of the ORR line along with the rest of Phase-II is targeted by 2021. FUNSKOOL TO COME WITH TOY MANUFACTURING UNIT IN TN Funskool India plans to set up new toy manufacturing plant in ROADS/HIGHWAYS/BRIDGES WKHVWDWHRI7DPLO1DGX7KHSURGXFWVPDQXIDFWXUHGE\WKLVXQLW ZLOOEHIRUH[SRUWV7KHSODQWLVFRPLQJXSDWDFRVWRI5V crore. The work is progressing well and the unit will be ready by FEASIBILITY STUDIES FOR SELECTED STRETCHES UNDER WKH\HDUHQG)XQVNRRO,QGLD&(2.-RKQ%DE\KDVWROG37,WKDW SAGARMALA SCHEME the company is looking at exploring new markets such as the Gulf 1DWLRQDO+LJKZD\V$XWKRULW\RI,QGLDKDVLQYLWHG&RQVXOWDQF\ region, covering whole of the US and Africa.
Project Reporter 6 August 1, 2018 **Images used are for illustration purpose only. PROJECTS Conceptual/Planning Stage
Sno Organisation Project Title / Details Location Budget* Contacts Sector
1 Vijaynagar Plans to set up Maize Starch manu- Nawarang- NA K Srinivasu, AGM (Marketing), Agro Bio-Tech facturing unit at Nawarangpur, Dist- pur Odisha Vijaynagar Biotech, 9-29-15/7, 4th Products (P) Ltd 1DZDUDQJSXU6LWHLGHQWL¿HGVRIDU Floor, Padmavathi Towers, VIP Road, Balaji Nagar, Siripuram, Visakhapatnam-530003, Andhra Pradesh. T: 0891-2731634, [email protected], sales@vblbiotech. com, (Datla Vivekanda Raju, MD) 2 Hind Plans to set up 40,000 TPA Aluminium Angul 563.00 Shailesh Daga, Managing Director, Aluminium Aluminium Conductors manufacturing facility at Odisha B-1, Tulsi Vihar, Dr. A.B Road, Worli Industries Angul Aluminium Park. Naka, Mumbai – 400 018, Ltd Maharashtra. T: 022-40457100, [email protected], [email protected], (Lalit Kumar Daga, Chairman) 3 Punjab The state government plans to set Punjab NA M.P. Singh, DGM (Project), Bio-mass Energy up160 biomass processing plants Solar Passive Complex, Plot.No: Energy Develop- involving private sector players. 1&2, Sector-33D, ment Chandigarh-160020, Agency T: 0172-2663382,28, (PEDA) F: 2662865, (Navjot Pal Singh Randhawa, Chief Executive) 4 P & A Plans to set up 2.50 lakh hl/annum Dhenkanal NA Aparna Jhunjhunwala, Additional Breweries/ Bottlers capacity brewing Industry at Dhenka- Odisha Director, 16 A, Brabourne Road, 9th Distilleries Pvt Ltd nal. The work has not yet started. Floor, Kolkata-700001, West Bengal. [email protected] 5 Irrigation & Plans to assign construction of new Guntur 8018.80 K Siva Bhaskar Rao, Deputy Canal/ CAD barrage on river Krishna, 23 kms district Superintending Engineer, Dam/ Depart- upstream of existing Prakasam Andhra Irrigationcircle, Governer Pet, Irrigation ment, barrage at Vykuntapuram, Amaravati, Pradesh Vijayawada-520002, Andhra Govt. of Guntur district. Pradesh. T: 0866-2575276, Andhra M: 7901093032, Pradesh [email protected], [email protected] 6 Birla The cement major plans to expand its NA NA B. Matilal, Head (Corporate Cement Corpora- overall cement production capacity to Communications), 1, Shakespeare tion Ltd 20 million tonne per annum (mtpa), in Sarani (2nd Floor), the next two-three years. Kolkata - 700071, West Bengal. T: 033-66033300 - 3302, [email protected], [email protected], (Harsh V Lodha, Chairman) 7 Tamil Nadu Plans to assign the contract for Karur 5.30 1) V. Ramanathan, Executive Cement Newsprint Operation of lime sludge drying District Tamil Director (Finance and CFO), 67, and Papers system at TNPL Cement Plant. Nadu Mount Road, Guindy, Chennai 600 Ltd 032, Tamil Nadu. T: 044-22354415, 2) AGM (TOS), Kagithapuram (PO), Karur (DT) - 639136. T: 04324-277001, F: 277285, [email protected] 8 NBCC The company is implementing New Delhi NA B. Bhattacharya, Addl General Construc- (India) Ltd redevelopment of GPRA colony at Delhi Manager (PR), NBCC Bhawan, tion Netaji Nagar, New Delhi. The project Lodhi Road, New Delhi-110003, FRPSULVHVFRQVWUXFWLRQRIRI¿FH Delhi. T: 011-24367314, towers and other allied works on M: 8527556046, [email protected] design, engineering, procurement and construction basis.
*Figures are approximate ( `. Million) Project Reporter 8 August 1, 2018 Conceptual/Planning Stage
Sno Organisation Project Title / Details Location Budget* Contacts Sector
9 Nagpur Plans to assign the construction of Nagpur 13.00 Pankaj Patil, Assistant Engineer-1, Construc- Metropoli- parking for Shopping complex with Maharashtra Second Floor, NIT, Complex, tion tan Region Admin block in Tajbagh Dargah Gokulpeth, Nagpur-10, Maharashtra. Develop- premises under Govt.Grant (Tajbagh). T: 0712-2527563, 9923192524, ment The completion is targeted in 6 (R K. Pimple, Superintending Authority months. Engineer (Project), M: 9823042291) (NMRDA) 10 Municipal Plans to assign construction of Town Nagaur 8459.90 Dr. Sahadev Dan Charan, Executive Construc- Board Hall at Dashera Medan, Didwana in district 2I¿FHU(R'LGZDQD%DFN6LGH2I tion Deedwana Nagaur district. Rajasthan Nagarpalika, Nagpur District-341303, Rajasthan. T: 01580-220086, [email protected], M: 9887898313, (Gyarsi Devi, Chairman) 11 Indian Oil Plans to assign the construction of Kharagpur NA 1) M Kalikrishna, Executive Director Construc- Corpora- plant and non plant buildings and West Bengal (CC), 3079/3, JB Tito Marg, tion tion Ltd allied facilities including roads, drains, New Delhi-110005, Delhi. culverts and gates at LPG bottling T: 011-26260142, M: 8447000201, plant at Kharagpur. [email protected], kalikrishna@ indianoil.in, www.iocl.com, (Sanjiv Singh, Chairman), 2) Subodh Kumar, ED, AE & SD, New Delhi 110003, Delhi. T: 011-24362170, [email protected] 12 Infunex Plans to undertake production of Cuttack 872.00 Rakesh Mehta, Director, 13, Lala Drugs/ Healthcare intravenous Fluids of 9.36 crore District Lajpat Rai 3A, 3rd Floor, Pharma Pvt. Ltd bottles per annum capacity at: Odisha Kolkata-700020,West Bengal. Ramdaspur, Dist- Cuttack. The project [email protected] is not yet approved. 13 Gokul Agro The company has decided to set up Paradeep NA Hitesh Thakkar, CEO, B-402, Edible Oil Resources 750,000 ton per annum Vegetable oil Odisha Shapath Hexa, Nr. Ganesh Meridian, Ltd manufacturing unit at Paradeep. Opp. Gujarat High Court, Ahmedabad-380060, Gujarat. M: 9099908537, [email protected], (K. J. Thakkar, Managing Director) 14 Foxconn The world’s biggest contract manufac- Navi NA Yang Shu Hui, Director, No 2 A 1 Electricals/ India Pvt turer of consumer electronics plans to Mumbai Phase II, Chennai to Bangalore Electronics Ltd set up in the special economic zone of Maharashtra Road, Sunguvarchatram, Sipcot the Jawaharlal Nehru Port Trust. Industrial Estate, Around 200 acre of land is required Kanchipuram - 602106, Tamil Nadu. for the plant. T: 044-67113500, 47118889, [email protected] 15 Hindustan The company plans to undertake Khurdha NA Kamlesh Kumar Sharma, Chief Food and Coca Cola expansion of non-alcoholic beverage Odisha &RPPXQLFDWLRQV2I¿FHUWK Beverages Beverages plant at I.E., Khurdha. Land not yet Floor, One Horizon Centre, Golf allotted. Course Road, Sector 43, Gurgaon - 122002, Haryana. T: 0124-4785001, 4785000, 4705600, 18002082653, (Christina Ruggiero, CEO) 16 Patanjali Plans to come up with a mega food Greater NA Acharya Balakrishna, CEO, Patanjali Food Park Ayurved park spread over 425 acre of land Noida Uttar Yogpeeth, Maharshi Dayanand Ltd along the Yamuna Expressway. Pradesh Gram, Delhi-Haridwar National Highway, Haridwar-249405, Uttarakhand. T: 01334-240008, 324792, 265370, [email protected], (Raju Shrestha, Managing Director)
*Figures are approximate ( `. Million) Project Reporter 9 August 1, 2018 Conceptual/Planning Stage
Sno Organisation Project Title / Details Location Budget* Contacts Sector
17 APMSIDC Plans to assign the upgradation of Visakhapat- 23.00 D. Ravindra , Chief Engineer, 2nd Healthcare Infrastructure of Nabh Accreditation at nam Andhra Floor, Plot No.09, Survey No.49, It Government Victoria Hospital, Pradesh Park, Mangalagiri, Guntur - 522503, Visakhapatnam. Andhra Pradesh. T: 8978622966, [email protected] (R. Lakshmipati Garu, Chairman) 18 Tamil Nadu Plans to assign the construction of Thiruvallur 49.10 M. Man Madhan, SE, Building Healthcare Public additional building for Government District Tamil Construction and Maintenance Works Hospital at Tiruttani in Thiruvallur Nadu Circle, Medical Works, Chepauk, Depart- District. Chennai - 600005. T: 044-25383583, ment 28545501, 28550446, [email protected] 19 Tamil Nadu Plans to assign the construction of Chennai 46.70 M. Man Madhan, SE, Building Healthcare Public Hand Transplant Operation Theatre Tamil Nadu Construction and Maintenance Works and Ward over the existing Institute of Circle, Medical Works, Chepauk, Depart- Research and Rehabilitation of Hand Chennai - 600005. T: 044-25383583, ment and department of Plastic Surgery in 28545501, 28550446, Government Stanley Medical College [email protected] and Hospital, Chennai. 20 Rajasthan Plans to develop more than 2500 Jaipur NA R.C. Jain, Deputy Housing Housing Housing houses on Public Private and Rajasthan Commissioner, Awas Bhawan, Board Partnership (PPP) model. The project Janpath Jyoti Nagar, (RHB) comprises construction of three Jaipur - 302005, Rajasthan. multi-storeyed projects at Mansarovar T: 0141-2791320, M:9828127727, in Jaipur and one in Bhiwadi. Tenders [email protected] are currently invited. 21 Depart- Jangi-Thopan-Powari hydro power Kinnaur NA Anshual Sharma, Additional SE, Hydro ment of project with 960 MW capacity is district Directorate of Energy, Government of Power Power, proposed on Satluj river in Kinnaur Himachal Himachal Pradesh, Sector - 6, Phase Govern- district. The project is hanging for Pradesh 3, New Shimla-1710009, Himchal ment of years together. The state government Pradesh. T: 0177-2673112, M: Himachal approval is expected soon. The work 9816024643, [email protected] Pradesh is likely to start in 2-3 months. 22 GV Mines Plans to set up 7 MTPA Iron Ore Sundargarh 8500.00 Gaurav Atha, Director, Avani Iron & Minerals & %HQH¿FLDWLRQ3ODQWDW*XDOL Odisha Signature, 6th Floor, 91 A/1, Steel Metals Pvt Koira,Dist: Sundargarh; laying of Park Street, Kolkata, West Bengal. Ltd 200KM Slurry Pipe Line and a 4MTPA [email protected] Iron Ore Slurry & dry stockpile at Gunduchipada Industrial Estate, Dhenkanal. 23 Kochi The State Cabinet has recently Kochi Kerala 23100.00 Thiruman Archunan, Director Metro Rail Metro Rail approved the second phase of Kochi (Projects), 8th Floor, Revenue Tower, Ltd (KMRL) Metro project. The project comprises Park Avenue, Kochi - 682011, 11.2 km-long extension from JLN Kerala. T: 0484-2380980, 2350355 , Stadium to Kakkanad covering 11 2350455, F: 2380686, M: stations enroute. The construction 8129257777, [email protected], work on the extension is likely to (Mohammed Hanish, Managing begin once the Centre's approval is Director) received. 24 Indian Oil Plans to undertake production of Paradeep 91360.00 1) M Kalikrishna, Executive Director Oil & Gas Corpora- 3XUL¿HG7HUHSWKDOLF$FLG 37$ RI Odisha (CC), 3079/3, JB Tito Marg, New tion Ltd MMTPA capacity in its existing Delhi-110005, Delhi. T: 011- UH¿QHU\XQLWDW3DUDGLSLQWKHGLVWULFW 26260142, M: 8447000201, iocl. of Jagatsinghpur. The project is not [email protected], kalikrishna@ yet approved. indianoil.in, www.iocl.com, (Sanjiv Singh, Chairman), 2) Subodh Kumar, ED, AE & SD, New Delhi 110003, Delhi. T: 011-24362170, ksubodh@ indianoil.in *Figures are approximate ( `. Million) Project Reporter 10 August 1, 2018
*Figures are approximate ( `. Million) Conceptual/Planning Stage
Sno Organisation Project Title / Details Location Budget* Contacts Sector
25 West The company is looking forward to set Sonepur NA V V Aravind Akshan, Vice President Paper Coast up Multi Layer Double Coated Paper Odisha (Projects), Bangur Nagar Dandeli Paper Mills Board manufacturing plant and 12 – 581325, Dist – Uttar Kannada – Ltd MW captive power plant at Sonepur. Karnataka. T: 08284-231391 – 395, Land not yet allotted. 231393, vvaravind@westcoastpaper. com, [email protected] 26 APGenco Plans to set up two new units at Visakhapat- NA Edukondulu, Additional Div Engineer, Power Lower Sileru and a pump storage nam district Vidyut Sudha, Vijayawada, Andhra plant at Upper Sileru. Andhra Pradesh. T: 0866-2526514, Pradesh F: 2526598, M: 8331898705, [email protected], www. apgenco.gov.in, (K Vijayanad, IAS, MD), (B. A. Mohana Rao, Director (HR & IR), M: 8331898705) 27 Goa State Plans to set up a gas-insulated Goa NA Amay Pednekar, Executive CRM, 1st Power Infrastruc- substation in Patto. 21 11KV electricity Floor, Spaces Building, Patto Plaza, ture panels and 21 33KV electricity panels Panaji, Goa.T: 0832-2493550-59, Develop- ZLOOEHVHWXSLQWKH¿UVWSKDVH7KLV F: 2438261, M: 9422560869, ment would take 15 months to complete. [email protected], Corpora- (Sidharth Kuncalienker, Vice-Chairman) tion (GSIDC) 28 Indian Plans to undertake redevelopment Tirupati 4000.00 S.K Lohia, CEO, 4th Floor, Palika Railways Railways plan of Tirupati Railway Station on Andhra Bhawan, Sector XIII, R. K. Puram, Station PPP mode. Bids were recently invited Pradesh New Delhi - 110066, Delhi. Develop- in this regard. T: 011-24672718, 24672723, ment F: 24672720, [email protected], info@ Corpora- irsdc.co.in, (Mohan Tiwari, CMD) tion (IRSDC) 29 Rail Vikas Plans to assign construction of Andhra 3648.70 B S K Rajkumar, Chief Project Railways Nigam Ltd roadbed, bridges, supply of ballast, Pradesh Manager-II, North Block, 2Nd Floor, installation of track (excluding supply New LIC Building, Thikkana Road, of rails & PSC sleepers), electrical Vishakhapatnam-530004, 5DLOZD\(OHFWUL¿FDWLRQDQGJHQHUDO Andhra Pradesh. T: 0891-2520029, HOHFWUL¿FDWLRQ RXWGRRUVLJQDOOLQJDQG 2550029, [email protected] telecommunication works for 3rd line of track between Bobbili (excl) (KM413.708)-Gotlam (inl) KM461.252) in Waltair Division of East Coast Railway Andhra Pradesh under Package- 6B. 30 Rail Vikas Plans to assign construction of Jimidipeta 4291.40 B S K Rajkumar, Chief Project Railways Nigam Ltd roadbed, bridges, supply of ballast, Andhra Manager-II, North Block, 2Nd Floor, Installation of track, electrical, outdoor Pradesh New LIC Building, Thikkana Road, signalling and telecommunication Vishakhapatnam-530004, works for 3rd line of track between Andhra Pradesh. T: 0891-2520029, Jimidipeta (incl) (KM 356.518) - 2550029, [email protected] Bobbili (inl) (KM 413.708) in Waltair Division of East Coast Railway Odisha & Andhra Pradesh under Package- 6A.
31 Kerala KRDCL, a joint venture of the State Thalassery 50000.00 P.T. Benny IRSE, Director (Project & Railways Railway government and the Ministry of Kerala Planning), Trans Tower, 5th Floor, Develop- Railways, plans to implement 181 km Vazhuthacaud, Thycaud PO, ment railway line project from Thalassery Thiruvananthapuram-695014, Corpora- via Mananthawadi to Mysuru. Kerala. T: 0471-2324330, 2305053, tion Ltd 2305054, M: 9061094455, (KRDCL) [email protected], (Paul Antony IAS, Chairman) *Figures are approximate ( `. Million) Project Reporter 11 August 1, 2018 Conceptual/Planning Stage
Sno Organisation Project Title / Details Location Budget* Contacts Sector
32 Kerala KRDCL, a joint venture of the State Thiruvanan- NA P.T. Benny IRSE, Director (Project & Railways Railway government and the Ministry of thapuram Planning), Trans Tower, 5th Floor, Develop- Railways, plans to set up 125.5 km Kerala Vazhuthacaud, Thycaud PO, ment Rapid Rail Transit System from Thiruvananthapuram-695014, Corpora- Thiruvananthapuram to Chengannur. Kerala. T: 0471-2324330, 2305053, tion Ltd 2305054, M: 9061094455, krd- (KRDCL) [email protected], (Paul Antony IAS, Chairman) 33 Kerala KRDCL plans to implement Ettumanoor NA P.T. Benny IRSE, Director (Project & Railways Railway 15 km Ettumanoor-Pala linking Kerala Planning), Trans Tower, 5th Floor, Develop- Sabari line with Thiruvananthapuram- Vazhuthacaud, Thycaud PO, ment Ernakulam line in collaboration with Thiruvananthapuram-695014, Kerala. Corpora- Indian Railways. T: 0471-2324330, 2305053, 2305054, tion Ltd M: 9061094455, krdclgok@gmail. (KRDCL) com, (Paul Antony IAS, Chairman) 34 Mumbai Chhatrapati Shivaji Maharaj Terminus Thane NA K L Meena, Dy. CPM, Churchgate Railways Railway (CSMT)- Panvel Elevated fast corridor Maharashtra 6WDWLRQ%OGJQGÀRRU0XPEDL Vikas SURMHFWLVLQWKHRI¿QJ$VSDUWRIWKH Maharashtra. T: 022-22091656, Corpora- project, a four-kilometre distance will 22195151, [email protected], tion be constructed over the Thane creek, (R. S. Khurana, CMD) (MRVC) the elevated rail corridor will be for CSMT, Wadala, Kurla, Tilaknagar, Chembur, Mankhurd, Nerul, Belapur while Vashi Kharghar and Panvel will run parallel to the existing lines. 35 South The railways is laying Manoharabad Medak NA Vijay Agarwal, Chief Administrative Railways Central to Gajwel railway line covering 31 km. District 2I¿FHU &RQVWUXFWLRQ WK)ORRU5DLO Railway Land is acquired by the state Telangana Nilayam, Secunderabad, government and handed over to the Hyderabad - 500003, Telangana. railways. So far around 17-km of line T: 040-27822874, 27830278, is laid and the remaining 14-km is 27005249 likely to get over by January, 2019. 36 National The authority is seeking appointment Srikakulam NA Anil Dixit, General Manager, Ro - Vi- Roads/ Highways of safety consultants for six laning of district jayawada, Plot No.21, Teachers Highways/ Authority of Narasannapeta - Ranasthalam Andhra Colony, Gurunanak Nagar Road, Bridges India section of NH-16 from design km Pradesh Vijayawada - 520008, Andhra (NHAI) 580.671 to design km 632.861 in the Pradesh. T: 0866-2483910, state of Andhra Pradesh under NHDP M: 7381083000, Phase-V on hybrid annuity mode. [email protected] 37 Public Special repair of road from Bachhod Bachhod 17.80 Sajjan Singh, Executive Engineer, Roads/ Works to Kunjpura Shyampura road (Road Haryana Provl. Divn., P.W.D (B&R) Branch, Highways/ Depart- ID 2555) in Mohindergarh District. The Narnaul, Haryana. Bridges ment completion is targeted in 6 months. T: 01282-251267 38 Roads and The Kerala Government plans to Thiruvanan- 300.00 Maya M S, Sr Manager, 2nd Floor, Roads/ Bridges undertake the construction of a new thapuram Preethi Building, Mahakavi Vailoppilli Highways/ Develop- À\RYHUIURP(DVW)RUWWR0DQDFDXG Kerala Road,, Kochi-682025, Kerala. Bridges ment Kerala Infrastructure Investment Fund T: 0484-2338206, M: 9447134960, Corpora- Board (KIIFB) is funding the project. [email protected], (Midhun tion of Joseph, Project Manager, Kerala Ltd Dr. Asha Thomas, IAS, MD) (RBDCK) 39 Ministry of The Centre has given in-principle Balaghat 228.90 Sudip Chaudhary, Chief Engineer Roads/ Road approval for the Madhya Pradesh district (Planning), Transport Bhawan, Highways/ Transport Government's proposal for the Madhya 1, Parliament Street, Bridges and construction of inter-state high level Pradesh New Delhi-110001, Delhi. Highways bridge on the Ban Ganga river on the T: 011-23739027, [email protected] Sakdi-Dangorali route in Balaghat district. The detailed project report is submitted by the state government.
*Figures are approximate ( `. Million) Project Reporter 12 August 1, 2018 Conceptual/Planning Stage
Sno Organisation Project Title / Details Location Budget* Contacts Sector
40 Public Plans to assign construction of two Hingoli 14313.60 V. T. Bade, Executive Engineer, (Au) Roads/ Works laning roads with paved shoulders in Districts PWD, Nanded-431602, Maharashtra. Highways/ Depart- Nanded, Parbhani, and Hingoli Maharashtra T: 02462-253711, F: 250116 Bridges ment districts on Hybrid Annuity Mode. 41 Govern- Plans to assign the construction of Thiruvallur 123.60 P Thamizharasi, Superintending Roads/ ment of RUB (Limited use subway) in lieu of District Tamil Engineer (H), Nabard, Rural Roads Highways/ Tamil existing L.C.No.9 at Railway Km Nadu Circle, B-48, Alagesan Nagar, Bridges Nadu, 23/12-14 in between Avadi - Pattabi- Chengalpattu - 603001, Tamil Nadu. Highways ram Railways stations (Near Hindu T: 044-27431795, Depart- College Railway Station). ment 42 Dedicated Construction of two-lane road over Sasaram NA Rajesh Khare, DGM (Corp. Comm), Roads/ Freight bridge (ROB) in lieu of two level Uttar 5th Floor, Pragati Maidan, Metro Highways/ Corridor crossings No. 42/C/T at IR Chainage Pradesh Station Building Complex, Bridges Corpora- 571/25-27 between Karwandia - New Delhi-110001, Delhi. tion of Sasaram and No. 45/C/E at IR T: 011-23454890, M: 9717636888, India Chainage 578/9-11 between Sasaram [email protected], (DFCCIL) -Kumahu including obligatory spans, (Anshuman Sharma, MD) viaduct spans, approach roads, etc. 43 Karnataka Plans to undertake the construction of Shivamogga NA $MLW.XPDU3URMHFW2I¿FHU*URXQG Sewage State sewage water treatment plant at Hotel Karnataka Floor, BMTC Yeshwanthpur, TTMC Treatment Tourism Mayura Gerusoppa, Jogfalls, Bus Stand, Yeshwanthpur Circle, Develop- Shivamogga. Bengaluru - 560022. Karnataka. ment T: 080-43344334, M: 8970650116, Corpora- www.kstdc.co tion Ltd (KSTDC) 44 Karimna- Plans to undertake development of Karimnagar NA K Shashanka, Managing Director, Smart gar Smart smart roads in Karimnagar package-III Telangana Municipal Corporation Karimnagar, Cities City under smart city mission. Bids are Near Bus stand, Karimnagar (D), Corpora- invited upto 7th August, 2018. The Telangana - 505001. T: 9985523848, tion Ltd completion is targeted in 12 months. [email protected] 45 Energy EESL has signed two pacts with Uttar Gurugram NA Neha Bhatnagar, Manager (PR), 4th Smart (I¿FLHQF\ Haryana Bijli Vitran Nigam (UHBVN) Haryana & 5th Floor,IWAI Building, A-13, Meters Services and Dakshin Haryana Bijli Vitran Sector-1, Noida - 201301, Ltd (EESL) Nigam (DHBVN) to install 1 million Uttar Pradesh. T: 0120-4908034, smart electricity meters in Gurugram, 4908000, F: 4908099, Faridabad, Hisar, Karnal, Panipat and [email protected], Panchkula. The installation will be (Saurabh Kumar, MD) done within 3 years in a phased manner. 46 Maharash- 3ODQVWRVHWXSD*:ÀRDWLQJVRODU Solapur NA P.S. Patil, Chief Public Relations Solar tra State PV project on the Ujjani Dam District 2I¿FHU3UDNDVKJDG3ORW1R* Power Electricity Reservoir in the Solapur district of Ma- Maharashtra Anant Kanekar Marg Bandra (E), Distribution harashtra. Expression of interest were Mumbai – 400051. Co. Ltd invited in April 2018. T: 022-26474211/26472131, M: 9833190106, (Sanjeev Kumar, IAS, CMD) 47 Military Development of sports infrastructure Alwar 4.00 K Agrawal, IDSE, EE, Garrison Sports Engineer athletics track and skating ground and Rajasthan Engineer, Itarana, Alwar -301023, Infrastruc- Services other work in Kendriya Vidhyalaya Rajasthan. [email protected] www. ture Itarana Alwar. The completion is mes.gov.in, [email protected] targeted in 180 days. 48 Walmart The company had signed a memoran- Uttar NA Sunita Patnaik, Deputy GM, (Corp Supply India dum of understanding (MoU) with the Pradesh Comm), 4th Floor, Orchid Center, Chain state government to open 15 whole- Golf Course Road, Sector 53, sale Cash and Carry stores. Gurugram-122002 Haryana. T: 0124-4568500, 4568501, Sunita. [email protected], (Krish Iyer, President & CEO)
*Figures are approximate ( `. Million) Project Reporter 13 August 1, 2018 Conceptual/Planning Stage
Sno Organisation Project Title / Details Location Budget* Contacts Sector
49 Essel Plans to construct Waste to Energy Nagpur 2190.00 Sahil Siraj, Head - HR & Admin, 6th Waste-to- Infrapro- (WtE) plant with a capacity of 800 Maharashtra Floor, Plot No 19, Film City,Sector 16 Energy jects Ltd tonne of waste in Nagpur. To execute – A, Noida-201301, Uttar Pradesh. (EIL) the project, Nagpur Municipal T: 0120-4849500, Corporation (NMC) will contribute Rs [email protected], 70 crore as viability gap funding to [email protected]. execute the project under the com Swwachh Bharat Mission. 50 Dredging Plans to assign the construction, Visakhapat- 6.00 K. Aswini Sreekanth, Company Water Corpora- transport, assembly and installation of nam Andhra Secretary, Dredge House, Port area, Sector tion of RO plants for schools in and around Pradesh Visakhapatnam – 530001, India Ltd Visakhapatnam, Vizianagaram and Andhra Pradesh. T: 0891-2523250, Kadapa. The work order is likely to be F: 2560581, [email protected] placed by 12th September, 2018. 51 Drinking Plans to assign the detailed survey, Ramgarh 383.60 Awdhesh Jha, Executive Engineer, Water Water and designing and drawing, Construction Jharkhand Ramgad, Rajasthan. Sector Sanitation RIÀRDWLQJ-HWW\3XPS%DUJH3RQ T: 06553-223193, F: 2480345 Depart- toons and Gangway etc., 7.77 MLD ment, Govt capacity Conventional Water Treat- of ment Plant, R.C.C Elevated Service Jharkhand Reservoir (i) 2.10 Lakh litres capacity with 12 M Staging, (ii) 1.60 Lakh litres capacity with 22 M Staging, (iii) 2.70 Lakh litres capacity with 12 M Staging (iv) 4.80 Lakh litres capacity with 12 M Staging, (v) 4.35 Lakh litres capacity with 12 M Staging,(vi) 3.80 Lakh litres capacity House connection, Supplying and installation of V.T and Centrifugal Pump Motor for Central North Part of Mandu Block (Arrah and adjoining Villages) Water Supply Scheme under DW&S Division, Ramgarh. 52 Nagpur Plans to assign the design and Nagpur 8.80 R K. Pimple, Superintending Water Metropoli- construction of elevated water storage Maharashtra Engineer (Project), Second Floor, Sector tan Region reservoir, sump well required pumping NIT, Complex, Gokulpeth, Develop- stationery at Motha Tajbagh premises Nagpur-10, Maharashtra. ment through Govt.Grant. T: 0712-2527563, M: 9823042291 Authority (NMRDA) 53 Tirupati The corporation has invited request Tirupati NA Vijay Ramaraju V, IAS, Managing Water Smart City for proposal towards the design, supply, Andhra Director, Tirupati Municipal Corpora- Treatment Corpora- construction, installation, testing, Pradesh tion, 13-29-M9-1-00, Tilak Road, tion Ltd commissioning, operation and main- East Tirupati, Chittoor District, tenance of waste water treatment plant Andhra Pradesh. T: 9849906685, of 5 mld capacity at Vinayak Sagar lake [email protected] in Tirupati based on open technology. 54 Water Plans to assign the design, supply, Rudrapray- 15.00 Sanjay Singh, Executive Engineer, Water Resources installation, testing and commission- ag Uttara- Rudrapryag, Uttarakhand. Treatment Depart- ing of 1.50 MLD Water Treatment khand T: 01364233226, M: 7895652528, ment, Plant for one full yatra season at Sri [email protected], Govern- Kedarnath. [email protected] ment of Uttara- khand 55 South Plans to set up Water treatment plant Kharagpur 47.90 Rewti Raman Roy, Sr.DEN HQ, Water Eastern for supplying water to Kharagpur West Bengal Kharagpur Division - Engg, Kharag- Treatment Railway settlement under the jurisdiction of pur, West Bengal. 03222-258770, ADEN/Water Supply/KGP. 255655, [email protected]
*Figures are approximate ( `. Million) Project Reporter 14 August 1, 2018 Contract Award
Sno Organisation Project Title / Details Location Budget* Contacts Sector
56 Jain Bagged an order from Water Resourc- Rajgarh 9750.00 Sanjay Daryapurkar, Project Canal/ Irrigation es Department Government of MP to district Manager, Jain Plastic Park, NH No. Dam/ Systems execute the Mohanpura Major Project. Madhya 6, Bambhori, Jalgaon-425 001, Irrigation Ltd The project involves survey, design, Pradesh Maharashtra. T: 0257-2258011, M: engineering, planning and execution 9422776795, daryapurkar.sanjay@ of various components like Pump jains.com, ( Anil Bhavarlal Jain, houses and Pumping Machinery VCMD) electrical sub stations, delivery chambers, civil work, up-gradation of “Rojya” Dam, MS rising mains, distribution network up to 1 Ha chak, automation, SCADA for the pumping and network system and Operation and Maintenance for three years after completion. 57 PSP Bagged an order from Zydus Cadila Gujarat 252.20 Mittali Christachary, CS & Compli- Construc- Projects Group for Landscaping, Horticulture DQFH2I¿FHU363+RXVH¶,VFRQ tion Ltd and Drip irrigation Civil Works for its Ambli Road, Ahmedabad – 380058, QHZFRUSRUDWHRI¿FH Gujarat. T: 079-26936200/6300/6400, M: 7069092574, mittali@pspprojects. com 58 Dynacon Bagged the contract to construct the Gurugram NA Ashok Sarin, Managing Director, Construc- Projects steel structure building for the sales Haryana B-2/36, Site-B, Surajpur, UPSIDC Ind tion Pvt. Ltd and marketing headquarter of Area, Greater Noida - 201306, Uttar Hyundai Motor India. The project is Pradesh. T: 0120-2561154, M: 90044 located at Sector 29, Gurugram RI¿FH# spread across 2 acre of land. The dynaconprojects.com project management consultants are Hyundai Engineering Corporation (HEC). 59 PSP Bagged an order from Torrent Gujarat 593.10 Mittali Christachary, CS & Compli- Drugs/ Projects Pharmaceuticals Ltd towards the civil DQFH2I¿FHU363+RXVH¶,VFRQ Pharma Ltd works for Brahmsthan Development Ambli Road, Ahmedabad – 380058, and other works for Torrent Oncology Gujarat. T: 079-26936200/6300/6400, Division. M: 7069092574, mittali@pspprojects. com 60 Tech- Bagged a contract to set up a Visakhapat- NA Ajay Viswakarma, Project Manager, Oil & Gas nipFMC hydrogen generation unit (HGU) for nam Andhra A-4, Sector 1, Institutional Area, +LQGXVWDQ3HWUROHXP¶V9LVDNKUH¿QHU\ Pradesh Noida-21301, Uttar Pradesh. in Andhra Pradesh. The contract T: 0120-4301000, Extn - 313, covers project management, technol- [email protected] ogy licensing, preparation of basic design and engineering package as well as detailed engineering, procure- ment, construction, commissioning, and performance guarantee test run on an licensing, engineering, procure- ment, construction and commissioning basis. 61 Larsen & Heavy Engineering arm of Larsen a Hazira 16000.00 Manish Kalghatgi, Head, Corporate Oil & Gas Toubro Ltd Toubro has bagged an order for Gujarat Brand Management and supply of critical Reactors and heavy Communications, L&T House, HTXLSPHQWWR5H¿QLQJ3HWURFKHPLFDO Ballard Estate, Narottam Morarjee DQG/LTXL¿HG1DWXUDO*DV /1* Marg, Mumbai - 400001, industries. Maharashtra. T: 022-67525656, M: 9930144144, [email protected], (Shailendra Roy, Whole-Time Director - Power, Heavy Engg. a Nuclear)
*Figures are approximate ( `. Million) Project Reporter 15 August 1, 2018 Contract Award
Sno Organisation Project Title / Details Location Budget* Contacts Sector
62 L&T Bagged an onshore EPC contract Bathinda NA Manish Kalghatgi, Head, Corporate Oil & Gas Hydrocar- from HPCL Mittal Energy for setting Punjab Brand Management and Communica- bon up 07 (Seven) Cracker Furnaces of tions, L&T House, Ballard Estate, Engineer- 1200 KTPA Dual Feed Cracker Unit Narottam Morarjee Marg, ing Ltd ')&8 DWWKHLU%DWKLQGD5H¿QHU\LQ Mumbai - 400001, Maharashtra. Punjab. The scope of work under the T: 022-67525656, M: 9930144144, contract covers Project Management, [email protected], Residual Engineering, procurement (N Hariharan, Executive VP & CS, and supply of Cracker Furnace T: 022-67525840, systems, components, auxiliaries, [email protected]) fabrication in modules, erection, construction and commissioning. 63 Artson Bagged an order from Tata Projects Telangana 289.40 Deepak Tibrewal, Company Secretary, Oil & Gas Engineer- Ltd for the design, engineering, supply Ground Floor, Mithona Towersr‘l, ing Ltd of equipments piping, instruments, 177-80 to B7, Prenderghast Road, electricals, erection, commissioning Secunderabad - 500003, VSDUHVHWFIRU'URVVUH¿QLQJSURMHFW Andhra Pradesh. T: 040-66018175, [email protected] 64 thyssenk- Bagged an order from Doosan Power Uttar 7650.00 Suhas Damle, Associate Vice Power rupp Systems India (DPSI) to supply Pradesh President (Marketing), Pimpri, Industries material handling plants for two Pune-411018, Maharashtra. India thermal power projects in Uttar T: 020-66124079, 27425461-64, Pradesh. The scope of work includes F: 27425350, engineering, delivery and installation [email protected], of two complete coal handling (Malay Das, Managing Director and systems, including associated CEO) structural and electrical works. 65 HDC India The joint venture between HDC Mumbai 3600.00 Dong Hwan Cheon, Director, Roads/ Pvt Ltd Hyundai Development Company and Maharashtra Madhava Bldg, 709, BKC, Bandra Highways/ HCC Ltd has bagged an order for 2nd East, Mumbai – 400051, Bridges section of road construction project on Maharashtra. T: 022-40049081, the southern coast of Mumbai. The [email protected] southern coastal road project in Mumbai is divided into four construc- tion sections. In this project, the second section landed by the joint venture between HDC Hyundai Development Company and HCC is a road between the Baroda region and the Worli area in Mumbai. 66 Gayatri Bagged an order from Uttar Pradesh Lucknow 14830.00 G Venkteswara Rao, Vice President Roads/ Projects Expressways Industrial Development Uttar (Projects), B-1, T.S.R. Towers, Highways/ Ltd Authority for development of Purvan- Pradesh 6-3-1090, Raj Bhavan Road, Bridges chal Expressway Project (Package-I): Somajiguda, Hyderabad–500082, from Chand Sarai (Dist. Lucknow) to Telangana. T: 040-23310330, Sansara (District Barabanki) (km (-) 0 233314284, 23314296, + 270 to 40+200) in the state of Uttar [email protected], Pradesh on EPC basis. (Sandeep Kumar Reddy, Managing Director) 67 Gayatri Bagged an order from Uttar Pradesh Barabanki 12760.00 G Venkteswara Rao, Vice President Roads/ Projects Expressways Industrial Development district Uttar (Projects), B-1, T.S.R. Towers, Highways/ Ltd Authority for the development of Pradesh 6-3-1090, Raj Bhavan Road, Bridges Purvanchal Expressway project Somajiguda, Hyderabad–500082, (Package-II): From Sansara (District Telangana. T: 040-23310330, Barabanki) to Jaraikala (Dist. Amethi) 233314284, 23314296, (km 40+200 to km 79+900) in the [email protected], state of Uttar Pradesh on EPC Basis. (Sandeep Kumar Reddy, Managing Director)
*Figures are approximate ( `. Million)
Project Reporter 16 August 1, 2018 Contract Award
Sno Organisation Project Title / Details Location Budget* Contacts Sector
68 PSP Bagged an order from MRF Ltd for Gujarat 839.00 Mittali Christachary, CS & Tyres Projects civil works for factory building for the &RPSOLDQFH2I¿FHU363+RXVH¶ Ltd proposed LMC Plant in Gujarat. Iscon-Ambli Road, Ahmedabad – 380058, Gujarat. T: 079-26936200/6300/6400, M: 7069092574, [email protected] 69 Mytrah Bagged a contract from Maharashtra Maharashtra NA Bhuvaneshwari Cheruvu, Head PR Wind Energy State Electricity Distribution Company and Communications, 8001, Energy (India) Pvt Ltd (MSEDCL) for setting up a 100 Q-City, S.No:109, Gachibowli, Ltd MW wind power project in Maharash- Hyderabad- 500032, tra. Telangana. T: 040-33760100, [email protected], (Vikram Kailas, Vice Chairman & MD) Project Update / Commissioned 70 Andhra APADC has invited request for Bhogapuram 42080.00 Virender Singh, Chief Executive Airport/ Pradesh proposals (RFPs) for development, Andhra 2I¿FHU$3$'&/VWÀRRU)'& Aviation Airport operations and maintenance of the Pradesh Complex, A.C. Guards, Develop- Bhogapuram airport. The airport Masab Tank, ment GHYHORSHUZLOOEH¿QDOLVHGE\\HDU Hyderabad - 500 028, Telangana. Corpora- end. T: 0866-2974991/ 040 - 29700282, tion Ltd (Dr. M. Venkateswarlu, IPoS, Managing Director) 71 Software STPI is coming up with a new facility Odisha NA Manas Ranjan Panda, Director, C IT Park Technology spread over three acre of land in the Ground Zero, Fortune Towers Parks of state of Odisha. The facility will have Chandrashekhar Pur, India an incubation facility for next-genera- Bhubaneswar-751023. (STPI) tion IT, IT-enabled services (ITes) and T: 0674-2300412/413/787 electronic system design & manufac- F: 2302307, [email protected] turing (ESDM) units and data centre for hosting the servers of PSUs, micro small and medium enterprises (MSMEs) and corporates. 72 Kerala KRDCL, a joint venture of the State Vizhinjam NA P.T. Benny IRSE, Director (Project & Railways Railway government and the Ministry of Kerala Planning), Trans Tower, Develop- Railways, plans to implement 12 km 5th Floor, Vazhuthacaud, ment rail connectivity from Balaramapuram Thycaud PO, Thiruvanan- Corpora- to upcoming Vizhinjam International thapuram-695014, Kerala. tion Ltd Deepwater seaport. The Konkan T: 0471-2324330, 2305053, (KRDCL) Railway will prepare the detailed 2305054, M: 9061094455, project report. [email protected], (Paul Antony IAS, Chairman) Project Under Implementation 73 Neway Setting up bio-mass plant at Mehma Bathinda NA Iyyappan Kalyanasundaram, Bio-mass Renewable Sarja. The plant aims to buy straw Punjab Managing Director, A-2, Ceebros, Energy Energy Ltd and agriculture waste from farmers to Tirumala Apartments,No 23/36, convert it into coal. The coal will be Venkatraman Street, sold to the power sector major NTPC. T Nagar, Chennai-600017, Tamil Nadu. [email protected] 74 Govern- The state government had taken up Andhra NA 5DJKDYDLDK,)62I¿FHUVW Canal/ ment of modernisation of Nagarjuna canals. Pradesh Floor, Building-IV, Velagapudi, Dam/ Andhra So far, nearly 80% of the works in Andhra Pradesh. T: 0863-2444369, Irrigation Pradesh most of the packages are completed. 2444248, 683, M: 8008341329, The state government is seeking (Shasi Bhushan Kumar, IAS, extension of deadline from World Secretary, M: 9849902591, Bank who is funding the project. [email protected])
*Figures are approximate ( `. Million)
Project Reporter 17 August 1, 2018 Project Under Implementation
Sno Organisation Project Title / Details Location Budget* Contacts Sector
75 Jaipur The civic body is making investment Jaipur 1000.00 Dr. Har Sahay Meena (RAS) Energy Municipal of more than Rs 100 crore on Rajasthan Additional Commissioner, Pandit (I¿FLHQF\ Corpora- replacing sodium tube lights with LED Dindayal Uppadhyay Bhawan, Lal tion (JMC) lights on the city streets to save up to Kothi Tonk Road, Jaipur, Rajasthan. 50% of energy. The government of T: 0141-2744273, Rajasthan has signed the MoU with [email protected]. (QHUJ\(I¿FLHQF\6HUYLFH/WG ((6/ and ESCO in this regard. The project is likely to complete in another four months. 76 Surya The company is setting up biscuit Khurdha NA Navojit Dutta, Brand Manager, D -1, Food Foods and manufacturing unit of 45,000 TPA, at Odisha Sector-2, Noida - 201301, U.P. Products Agro Ltd Khordha Food Park. Land not yet T: 0120-2558246 / 2552989 / allotted. 2522939, [email protected] 77 Vedanta The company is setting up a 500 Kalahandi 3500.00 Arun Arora, Executive Vice President Healthcare Group bedded medical college and hospital District - Corporate Communications, in Kalahandi district. Odisha Vedanta House, 75 Nehru Road, Vile Parle (East), Mumbai-400099, Maharashtra. T: 022-66461314, 66461544, 66461000, 0124- 4593000, [email protected], (Anil Agarwal, Group Chairman) 78 MahaMetro The Pune Municipal Corporation's Pune NA Gautam Birhade, Chief Project Metro Rail Rail standing committee has recently Maharashtra Manager, 101, The Orion, Opp. Don Corpora- approved a proposal to prepare the Bosco Youth Centre, Koregaon Park, tion detailed project report (DPR) for the Pune, Maharashtra. T: 020- Ramwadi - Vanaz metro route 26051072, M: 7410004079, gautam. extension up to Chandni Chowk. [email protected], [email protected], www.punemetrorail.org, (Brijesh Dixit, MD) 79 Sterlite The company is implementing the Jammu and NA Balaji Krishnaswami, Media Head, Power Power Northern Region Strengthening Kashmir 5th Floor, 5 North Avenue, Maker Scheme (NRSS)-29. It is the largest Maxity, Bandra Kurla Complex, private sector transmission project Bandra (East), Mumbai – 400051, awarded in the country till date. Maharashtra. T: 9971757474, NRSS-29 connects the northern grid [email protected], to Jammu and Kashmir. The project is (Ved Tiwari, CEO) in commissioning stage. 80 Rail Vikas RVNL is implementing the Dallirajhara Bastar 6317.00 J.C.Sahu, JGM/Civil, Maruti Railways Nigam Ltd - Rowghat New Line project covering District Business Park, Great Eastern Rd, 95.00-km. So far around 50-55% work Chhattisgarh Mukut Nagar, Raipur-492001, is completed. The rest will complete Chhattisgarh. T: 0771-4098115, by 2022. [email protected] 81 Rail Vikas RVNL is implementing the Haridaspur Paradeep 18444.70 Ladukiswar Patro, Joint General Railways Nigam Ltd - Paradeep New Line project covering Odisha Manager/F&A, Rail Vihar, 82-km for East Coast Railway. The Chandrasekharpur, project is likely to be complete by Bhubaneswar-751023, Odisha. December 2019. T: 0674-2302606, [email protected], (S. C. Agnihotri, CMD) 82 Rail Vikas RVNL is implementing the Angul - Su- Angul 12027.00 Ladukiswar Patro, Joint General Railways Nigam Ltd kinda New Line project covering Odisha Manager/F&A, Rail Vihar, 99.00-km for East Coast Railway. The Chandrasekharpur, completion is targeted by 2020. Bhubaneswar-751023, Odisha. T: 0674-2302606, [email protected], (S. C. Agnihotri, CMD)
*Figures are approximate ( `. Million) Project Reporter 18 August 1, 2018 Project Under Implementation
Sno Organisation Project Title / Details Location Budget* Contacts Sector
83 Rail Vikas RVNL is implementing the Obulavari- Krishnapat- 18250.00 C Subrahmanyam, GM Projects, Railways Nigam Ltd palle - Krishnapatnam New Line nam RVNL, Chennai, Tamil Nadu. (RVNL) covering 122-km between Nellore and Telangana T: 044 24618460, 24618437, Kadapa districts. South India's longest 24620750 railway tunnel is being constructed through Veligonda hills as part of the project.The construction would be completed by the end of the year. 84 Rail Vikas RVNL is implementing the Mau-Ghaz- Ghazipur 17659.00 Vikas Chandra, Chief Project Railways Nigam Ltd ipur-Tarighat New Line project Uttar Manager, 580, DLW Colony, Bhullanpur, (RVNL) covering 51.00-km including Pradesh Varanasi-221004, Uttar Pradesh. rail-cum-road bridge at Ghazipur, M: 9934589340, [email protected], Uttar Pradesh. [email protected] 85 Himachal Setting up heliport at Dhalli bypass Shimla 70.00 Manoj Sharma, Additional Director, Tourism Pradesh near Shimla. Himachal Tourism & Civil Aviation Department, Tourism Pradesh Block No. 28, SDA Complex, Develop- Kasumpti, Shimla-171009, ment Himachal Pradesh. T: 0177-2623959, Corpora- 2659962, 2625511, 2623959, tion [email protected], [email protected] 86 Inland IWAI is implementing River Barak Silchar NA Ravikant Jain, Chief Engineer, A-13, Water Waterways (NW-16): Under Phase -1, the stretch Assam Sector-1, Noida-201301, Transport Authority of between Silchar to Bhanga (71 km) Uttar Pradesh. T: 0120-2424536, India has been taken up for development. 2544004, M: 9810294422, (IWAI) Waterway is operational with limited [email protected], infrastructure facility. [email protected], (Pravin Pandey, Vice Chairman) 87 Inland River Gandak (NW-37): Bhaisalotan Hajipur NA Ravikant Jain, Chief Engineer, A-13, Water Waterways %DUUDJHQHDU7ULYHQL*KDWWRFRQÀXHQFH Bihar Sector-1, Noida-201301, Uttar Pradesh. Transport Authority of with Ganga river at Hajipur (296 km)in T: 0120-2424536, 2544004, India Bihar and UP. Development works M: 9810294422, [email protected], (IWAI) FRPPHQFHGIURP*DQJDFRQÀXHQFH [email protected], to Bagaha Bridge (250 km approx.) (Pravin Pandey, Vice Chairman) stretch of NW-37 under Phase-1. 88 Inland The authority is implementing NW- Mandovi NA Ravikant Jain, Chief Engineer, A-13, Water Waterways &XPEHUMXD±FRQÀXHQFHZLWK=XDUL Goa Sector-1, Noida-201301, Uttar Transport Authority of WRFRQÀXHQFHZLWK0DQGRYLULYHU Pradesh. T: 0120-2424536, 2544004, India km), NW 68 – Mandovi– Usgaon M: 9810294422, (IWAI) Bridge to Arabian Sea (41 km), NW [email protected], ravikantiwai@ 111 – Zuari– Sanvordem Bridge to rediffmail.com, (Pravin Pandey, Vice Marmugao Port (50 km). The develop- Chairman) ment works for expansion / setting up RIÀRDWLQJMHWWLHVDQGXSJUDGDWLRQ installation of navigational aids is underway. NWs of Goa are operational. *Figures are approximate ( `. Million)
Annual Subscription: `3500/- (Downloadable PDF)
www.ProjectReporter.co.in
Book this space for Rs 20,000 in Project Reporter Vol. 11 No. 23 l June 1, 2016
India’s Project Database Digital Edition and reach out to 50,000 prospects L&T Hyderabad Metro Station – Hyderabad, Telangana from all over India.
For Advertising: 195 Projects & Tenders Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected] ®
Project Reporter 19 August 1, 2018 Project Under Implementation
Sno Organisation Project Title / Details Location Budget* Contacts Sector
89 Inland The authority is implementing Kottayam NA National Waterways Road, NH 47 Water Waterways Alappuzha – Kottayam – Kerala Bypass, Kannadikkadu, Maradu, Transport Authority of Athirampuzha Canal (NW-9): Ernakulam - 682304, Kerala. T: India Boat Jetty, Alappuzha to 484-2295044, 2389804, www.iwai. (IWAI) Athirampuzha (38 km) in Kerala. nic.in The development work in the Alappuzha – Kottayam stretchhas commenced under Phase-1 for cargo movement. Waterways are already operational for ferry services.
90 Inland The authority is implementing Hooghly NA Ravikant Jain, Chief Engineer, A-13, Water Waterways River Rupnarayan (NW-86): West Bengal Sector-1, Noida-201301, Uttar Transport Authority of &RQÀXHQFHRI'ZDUNHVKZDU Pradesh. T: 0120-2424536, 2544004, India and Silai rivers (Pratappur) to M: 9810294422, [email protected] (IWAI) FRQÀXHQFHZLWK+RRJKO\ULYHU (Pravin Pandey, Vice Chairman) (Geonkhali) (72 km) in West Bengal. Approximately 34 kms between Geonkhali to Kolaghat stretch has been taken up for development under Phase-I. *Figures are approximate ( `. Million)
Annual Subscription: Book this space for `3500/- (Downloadable PDF)
www.ProjectReporter.co.in
Vol. 12 No. 13 l January 1, 2017 Rs 30,000 in India’s Project Database Project Reporter 174 Projects & Tenders Digital Edition and reach out to 50,000 prospects from all over India.
For Advertising: ® Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected]
Project Reporter 20 August 1, 2018
Realty Projects
91 | Jaivilas
Details: The project is coming up at Sikar Road in Jaipur. It is spread across 2.18 acre of land. 7KHSURMHFWRIIHUVWRZHUVVWLOWÀRRUVLWKDVXQLWVRIDQG%+.DSDUWPHQWV7KH DPHQLWLHVLQFOXGH0XOWLSXUSRVH&RXUW Location: Jaipur Rajasthan Completion: July 2020 Type:5HVLGHQWLDO$SDUWPHQWV Stage: Under Construction Apeksha Infraprojects Pvt Ltd Contacts:.DPDO-DLVDQVDULD'LUHFWRU$ODQNDU3OD]D&HQWUDO6SLQH 9LGK\DGKDU1DJDU-DLSXU5DMDVWKDQ7ZZZDSHNVKDJURXSFRP Architect: 0DOKRWUD $VVRFLDWHV&%1DQG.LVKRU3DUHHN0DUJ-/10DUJ%DSX1DJDU-DLSXU5DMDVWKDQ 7DVKRNDUPDOKRWUD#JPDLOFRP 92 | Auric Vedas Details: 7KHYLOODVLVFRPLQJXSDW$MPHU5RDGLQ-DLSXU,WLVVSUHDGRYHUDFUHRIODQG 7KHSURMHFWRIIHUVYLOODVRI*ÀRRULWKDVDQG%+.FRQ¿JXUDWLRQ7KHDPHQLWLHV LQFOXGH&OXEKRXVH:HOO(TXLSSHG*<0.LG¶V3OD\$UHD3DUW\$UHD+REE\$QG Location: Jaipur Rajasthan Completion:$XJXVW Type:*URXS+RXVLQJ Stage: Under Construction Auric Infraprojects Ltd Contacts: 6DQGHHS$JJDUZDO0'%XLOGLQJ1RQG)ORRU4XHHQV+RXVH4XHHQV5RDG1HDU9LMD\'ZDU9DLVKDOL1DJDU -DLSXU5DMDVWKDQ7VDOHV#DXULFKRPHVFRP Architect: $QNLW6KDUPD$UFKLWHFW%&9LGK\D$SDUWPHQW3DUV0DUJ%DSX1DJDU-DLSXU5DMDVWKDQ 0DUFKBDQNLWV#\DKRRFRP 93 | Chordias Atulya Details: 7KHSURMHFWLVFRPLQJXSDW$MPHU5RDGLQ-DLSXU,WLVVSUHDGRYHUDFUHRIODQG7KH SURMHFWRIIHUVWRZHUZLWK*ÀRRUVLWKDVXQLWVRIDQG%+.UHVLGHQWLDODSDUWPHQWV7KH DPHQLWLHVLQFOXGH6ZLPPLQJ3RRO6SD$HURELFV&HQWUH%LOOLDUGV/LEUDU\*DUEDJH'LVSRVDO /DQGVFDSH*DUGHQ5DLQ:DWHU+DUYHVWLQJHWF Location: Jaipur Rajasthan Completion: 'HFHPEHU Type:5HVLGHQWLDO$SDUWPHQWV Stage: Under Construction Chordias Group Contacts:9LYHN&KRUGLD'LUHFWRU1&*'HYHORSHU ,QIUDVWUXFWXUH&KRUGLD(QFODYH-DQSDWK6K\DP1DJDU -DLSXU5DMDVWKDQ7LQIR#FKRUGLDVJURXSFRP Architect: 6SDFH*ULG$UFKLWHFWV&9LG\D$SDUWPHQWV3DUDV0DUJ%DSX1DJDU-DLSXU5DMDVWKDQ 0LQIRVSDFHJULG#JPDLOFRP Project Reporter 22 August 1, 2018 Realty Projects 94 | Royal Essence Details: 7KHSURMHFWLVFRPLQJXSDW9DLVKDOL1DJDULQ-DLSXU,WLVVSUHDGRYHUDFUHRIODQG 7KHSURMHFWRIIHUVWRZHUZLWK*ÀRRULWKDV5HVLGHQWLDO &RPPHUFLDOXQLWVRIDQG %+.DSDUWPHQWV7KHDPHQLWLHVLQFOXGH%LOOLDUGV*D]HER-DFX]]L6HZDJH7UHDWPHQW5DLQ :DWHU+DUYHVWLQJ6ZLPPLQJ3RRO7DEOH7HQQLV$HURELFV&HQWUHHWF Location: Jaipur Rajasthan Completion:'HFHPEHU Type: 5HVLGHQWLDO$SDUWPHQWV Stage: Under Construction Kotecha Group Contacts: 3XVKSHQGHU+DGD6DOHV+HDG*\DQ9LKDU&RORQ\-DLSXU5DMDVWKDQ 70SXVKSHQGHUKDGD#NRWHFKDJURXSRUJ $PLW.RWHFKD'LUHFWRU Architect:6SDFH*ULG$UFKLWHFWV&9LG\D$SDUWPHQWV3DUDV0DUJ?%DSX1DJDU-DLSXU5DMDVWKDQ 0LQIRVSDFHJULG#JPDLOFRP 95 | Mahima Florenza Details: 7KHSURMHFWLVFRPLQJXSDW3DWUDNDU&RORQ\0DQVDURYDU([WLQ-DLSXU,WLVVSUHDG RYHUDFUHRIODQG7KHSURMHFWRIIHUVWRZHUVZLWK*ÀRRUVLWKDVXQLWVRIDQG %+.DSDUWPHQWV7KHDPHQLWLHVLQFOXGH/DQGVFDSH*DUGHQ6ZLPPLQJ3RRO6HZDJH 7UHDWPHQW0XOWLSXUSRVH&RXUW3URYLVLRQ)RU'7+*DV%DQN:L)L&RQQHFWLYLW\HWF Location: Jaipur Rajasthan Completion:$XJXVW Type:*URXS+RXVLQJ Stage: Under Construction Mahima Real Estate Pvt Ltd Contacts:1LNKLO0DGDQ'LUHFWRUWK)ORRU&U\VWDO3DOP*RGDP&LUFOH6DUGDU3DWHO0DUJ -DLSXU±5DMDVWKDQ7PDUNHWLQJ#PDKLPDJURXSRUJ Architect:0$$UFKLWHFWV3YW/WG3ORW1R/DO.RWKL6FKHPH2II6DKNDU0DUJ-DLSXU5DMDVWKDQ 7 96 | Purple Melodia Details: 7KHSURMHFWLVFRPLQJXSDWYDLVKDOL1DJDULQ-DLSXU,WLVVSUHDGRYHUDFUHRIODQG 7KHSURMHFWRIIHUVWRZHUZLWK*ÀRRULWKDVXQLWVRI %+.DSDUWPHQWV7KH DPHQLWLHVLQFOXGH5DLQ:DWHU+DUYHVWLQJ5HFKDUJLQJ$FXSUHVVXUH3DUN$HURELFV&HQWUH 0XOWLSXUSRVH&RXUW*ROI&RXUVH/DQGVFDSH*DUGHQ6SD6XQ'HFNHWF Location: Jaipur Rajasthan Completion:'HFHPEHU Type: Residential Towers Stage: Under Construction Purple Group Contacts:$DUWL&KXQGDZDW+5 0DQDJHU &9DVKLVWKD0DUJ+DQXPDQ1DJDU%ORFNµ&¶9DLVKDOL1DJDU-DLSXU 5DMDVWKDQ7DDUWL#SXUSOHVFRLQ 9LVKDO$JUDZDO&(2 Architect:6KHNKDZDW$QG$VVRFLDWHV$UFKLWHFWV3YW/WG+LPPDW1DJDU7RQN5RDG-DLSXU5DMDVWKDQ 7DGPLQ#LGHDVMDLSXUFRP Project Reporter 23 August 1, 2018 Realty Projects 97 | Sankalp Tatvam Details: 7KHSURMHFWLVFRPLQJXSDW$MPHU5RDGLQ-DLSXU,WLVVSUHDGRYHUDFUHRIODQG 7KHSURMHFWRIIHUVWRZHUVZLWK*ÀRRUVLWKDVXQLWVRIDQG%+.DSDUWPHQWV 7KHDPHQLWLHVLQFOXGH0XOWLSXUSRVH&RXUW6ZLPPLQJ3RRO Location: Jaipur Rajasthan Completion: $SULO Type:5HVLGHQWLDO$SDUWPHQWV Stage: Under Construction Sankalp Group Contacts:6DQGK\D*R\DO&500DQDJHU(%HKLQG,2&SHWURO3XPS 6DKDNDU0DUJ-DLSXU5DMDVWKDQ7FUP#VDQNDOSEXLOGHUVFRP Architect:9LNDV-DLQ$UFKLWHFW(%HKLQG,2&SHWURO3XPS6DKDNDU0DUJ-DLSXU5DMDVWKDQ 7YMDUFKLWHFW#JPDLOFRP 98 | Shubh Nikunj Details: 7KHSURMHFWLVFRPLQJXSDW0DQVDURYDU([WHQVLRQ-DLSXU,WLVVSUHDGRYHUDFUH RIODQG7KHSURMHFWRIIHUVWRZHUVZLWK%DVHPHQW6WLOW)ORRUVLWKDVXQLWVRI%+. UHVLGHQWLDODSDUWPHQWV7KHDPHQLWLHVLQFOXGH*\PQDVLXP&&79&DPHUD6HFXULW\(DUWKTXDNH 5HVLVWDQW0XOWLSXUSRVH+DOO/DQGVFDSH*DUGHQ6HZDJH7UHDWPHQW5DLQ:DWHU+DUYHVWLQJHWF Location: Jaipur Rajasthan Completion: March 2021 Type:5HVLGHQWLDO$SDUWPHQWV Stage: Under Construction Shubhkakshya Buildsquare LLP Contacts: $PLW-LYQDQL3DUWQHU6$6KUL*RSDO1DJDU*RSDOSXUD%\H3DVV-DLSXU5DMDVWKDQ7 Architect: 7XVKDU6RJDQL'HVLJQV3YW/WG)³6XU\RGD\´6XEKDVK0DUJ%DJDGLD%KDZDQ&6FKHPH -DLSXU5DMDVWKDQ7 99 | Prangan Details: 7KHSURMHFWLVFRPLQJXSDW0XKDQDLQ-DLSXU,WLVVSUHDGRYHUDFUHRIODQG7KH SURMHFWRIIHUVWRZHUVZLWK*ÀRRUVLWKDVXQLWVDQGVKRSVRIDQG%+. DSDUWPHQWVDSDUWPHQWV7KHDPHQLWLHVLQFOXGH*DUEDJH'LVSRVDO6\VWHP/DQGVFDSH *DUGHQ6HZDJH7UHDWPHQW5DLQ:DWHU+DUYHVWLQJ-RJJLQJ7UDFNHWF Location: Jaipur Rajasthan Completion:$XJXVW Type:5HVLGHQWLDOFXP&RPPHUFLDO$SDUWPHQWV Stage: Under Construction SSBC Group Contacts:1LNLWD3DQFKDO*0 0DUNHWLQJ 3ORWQR)LUVW)ORRU9LYHN9LKDU1HZ6DQJDQHU5RDG-DLSXU 5DMDVWKDQ7JP#VVEFJURXSFRPVDOHV#VVEFJURXSFRP Architect: $U1LWHVK$JJDUZDO$UFKLWHFWV/DQGVFDSH ,QWHULRU'HVLJQHUV3126KUL*RSDO1DJDUIW5RDG -DLSXU5DMDVWKDQ70QLWHVKIG#JPDLOFRP Project Reporter 24 August 1, 2018 CONSULTANCY BIDS 100 | Upgrading and Tender Value (Rs): 28545000 105 | Boys hostel building at B G rehabilitating roads Location: Karnataka Kere Molkalmuru taluk 51180-IND | General procurement Karnataka Residential Educational KREIS/2018-19/BD/WORK_ notice for purposes of this advance Institutions Society INDENT2280 | Tenders are invited for FRQWUDFWLQJQRWLFHDQGVSHFL¿F Contacts: AEE, #08. 6th & 7th Floor, construction of Dr. BR Ambedkar boys procurement notices will be issued later. MSB-I, KSCMF Building, hostel building sc at B G Kere (i) Construction supervision consultants Cunningham Road, Molkalmuru taluk Chitradurga for various road contract packages; (ii) Bengaluru-56052, Karnataka. district. (pwd sr north zone Works contracts for upgrading and T: 080-22283366, 22265855, 22204466, Dharwad circle 2016-17) pmc-premier rehabilitating roads; (iii) Consultants for 22207722, [email protected] technical consultant. institutional capacity in the road sector Submission Date: 18/08/2018 of the state; (iv) Works contracts related 103 | Government MM high school Tender Value (Rs): 28982000 to institutional capacity in the road at Holalkere taluk Location: Karnataka sector of the state; (v) Other KREIS/2018-19/BD/WORK_ Karnataka Residential Educational related components. INDENT2278 | Tenders are invited for Institutions Society Submission Date: 15/12/2018 construction of Government MM high Contacts: Executive Director, #08. 6th Location: Bihar school at Holalkere taluk chitradurga & 7th Floor, MSB-I, KSCMF Building, Bihar State Road Development district.(pwd sr north zone dharwad Cunningham Road, Bengaluru-56052, Corporation Ltd circle 2016-17) pmc-premier Karnataka. T: 080-22283366, 22265855, Contacts: Amrit Lal Meena, IAS, technical consultant. 22204466, 22207722, Managing Director, RCD Mechanical Submission Date: 18/08/2018 [email protected] Workshop Campus, Sheikhpura, Tender Value (Rs): 48393000 Patna-800014 Bihar, T: 0612-2226711, Location: Karnataka 106 | Implementation of common [email protected] Karnataka Residential Educational integrated Transport System Institutions Society G-08/18-19 | Tenders are invited for 101 | Four laning of Birmitpur to Contacts: Executive Director, #08. 6th appointment of project management Brahmani bypass & 7th Floor, MSB-I, KSCMF Building, consultancy for implementation of NHAI/NHDP-IV/OR/02/2010 | Cunningham Road, common integrated Transport Procurement of consultancy services for Bengaluru-56052, Karnataka. System (CITS). authroity’s engineer for supervision of T: 080-22283366, 22265855, 22204466, Submission Date: 20/08/2018 rehabilitation and upgradation of four 22207722, [email protected] Location: Karnataka laning of Birmitpur to Brahmani bypass. Karnataka State Road Transport Submission Date: 08/08/2018 104 | Govt. boys pre university Corporation (KSRTC) Location: Delhi college at Chitradurga Contacts: Store and Purchaae Dept, National Highway Authority of India KREIS/2018-19/BD/WORK_ K.H. Road, Shantinagar, Contacts: Vishnu Murti, General INDENT2277 | Tenders are invited for Bengaluru-560027, Karnataka. Manager, G-5 and 6, Sector-10, construction of Govt. boy pre university 7JPWUDI¿F#NVUWFRUJ Dwarka, New Delhi-110075, Delhi. college at Chitradurga district. (pwd sr T: 011-25074100. north zone Dharwad circle 2016-17) 107 | 6 Civil works packages relating pmc-premier technical consultant. to urban water supply and sewerage 102 | Dr. B R Ambedkar Hostel Submission Date: 18/08/2018 42267-IND | General procurement building at Srimad Chinmolabri Location: Karnataka notice for Consulting Services for (i) Bruhamata Karnataka Residential Educational recruitment of two consultancy KREIS/2018-19/BD/WORK_ Institutions Society packages for project management and INDENT2281 | Tenders are invited for Contacts: Executive Director, design supervision and community construction of Dr. B R Ambedkar #08. 6th & 7th Floor, MSB-I, KSCMF awareness and participation; and (ii) Hostel building at Srimad Chinmolabri Building, Cunningham Road, procurement of 6 civil works packages Bruhamata in Chitradurga district. (PWD Bengaluru-56052, Karnataka. relating to urban water supply Sr. North Zone Dharwad circle 2016-17) T: 080-22283366, 22265855, and sewerage. pmc-premier technical consultant. 22204466, 22207722, Submission Date: 16/10/2018 Submission Date: 18/08/2018 [email protected] Location: Rajasthan Project Reporter 26 August 1, 2018 Consultancy Bids Rajasthan Urban Infrastructure Institutional Capacity in the Road Sector construction supervision and Development Project of the State; (Iv) Works Contracts project implementation support Contacts: Dr. Preetam Yashvant, Related to Institutional Capacity in the consultants (DSC); Recruitment of Project Director, AVS Building, Road Sector of the State; (V) Other community awareness and Jawahar Lal Nehru, Related Components. participation program consultants, Marg, Jaipur-302017, Rajasthan. Submission Date: 02/01/2019 procurement of nine civil works T: 0141-2721966, Location: Tamil Nadu packages for water treatment plant, [email protected] Highways and Minor Ports reservoirs, transmission mains, and Department pumping stations works and 108 | Consultants for Various Road Contacts: Rajeev Ranjan, IAS, water distribution network and Contract Packages Additional Chief Secretary, metering works. 51337-IND | General Procurement Government of Tamil Nadu, Highways Submission Date: 28/08/2018 Notice for (I) Construction Supervision and Minor Ports Department, Location: West Bengal Consultants for Various Road Contract Fort St. George, Secretariat, Public Health & Engineering Packages; (Ii) Works Contracts for Chennai 600 009, Tamil Nadu. Department Upgrading and Rehabilitating Roads, T: 044-25670959, [email protected] Contacts: Animesh Bhattacharya, Which Are Likely to Be on an 7th Floor, New Secretariat Building1, Engineering, Procurement, and 109 | Nine civil works packages for K. S. Roy Road, Construction (Epc) Mode With Seven water treatment plant Kolkata-700001, West Bengal. Years of Maintenance After 49107-IND | Project management T: 033-2262 5115, Construction; Iii) Consultants for consultants (PMC) and design, [email protected] Annual Subscription: Book this space for `3500/- (Downloadable PDF) www.ProjectReporter.co.in Vol. 12 No. 13 l January 1, 2017 Rs 30,000 in India’s Project Database Project Reporter 174 Projects & Tenders Digital Edition and reach out to 50,000 prospects from all over India. For Advertising: ® Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected] Project Reporter 27 August 1, 2018 INFRA TENDERS Airport Location: Tirupati Andhra Pradesh 115 | 110/11kv sub-station at Ukkali Southern Power Distribution KPTCL/CEE/110KV/UKKALI/ _*UHHQ¿HOG,QWHUQDWLRQDO$LUSRUW Corporation OF AP Ltd PTK/TLSS-1025 | Establishing at Bhogapuram2/APADCL/BIA/RFQ Contacts: Executive Director/Projects/ 1x10mva,110/11kv sub-station at 1RWL¿FDWLRQ_7HQGHUVDUHLQYLWHG Apspdcl/Tpt, Apspdcl, Tirupati, Ukkali and construction of 110kv IRU*UHHQ¿HOG,QWHUQDWLRQDO$LUSRUWDW Andhra Pradesh. T: 08772-284107, lilo line from 110kv Basavana Bhogapuram, Vizianagaram District. [email protected] Bagewadi - Vijayapura SC Line to the Submission Date: 24/08/2018 proposed 110/11kv substation at Ukkali Location: Vizianagaram District 113 | Providing 11 KV Power supply for a distance of 7.165kms in Basavana Andhra Pradesh arrangement at Asarva Bagewadi taluk, Vijayapura district on Andhra Pradesh Airports EL/C/ADI/228/2018-19 | Providing partial turnkey basis including supply Development Corporation Limited 11 KV Power supply arrangement of all matching materials/equipments Contacts: Managing Director, at Asarva in connection with New (excluding 11kv switchgear) and APADCL, Block A, Anjaneya Towers, RI¿FHFXPDGPLQLVWUDWLYHEXLOGLQJIRU erection (including civil works) Ibrahimpatnam, Vijayawada-521456, construction organization near DRM of all materials/equipments, testing Andhra Pradesh. RI¿FHEXLOGLQJ$VDUYD$KPHGDEDG and commissioning. T: 0866 - 2974991/ 040 - 29700282, Submission Date: 14/08/2018 Submission Date: 14/08/2018 [email protected] Tenders Value (Rs): 16722215 Location: Karnataka Location: Gujarat Karnataka Power Transmission 111 | Access Road for Ankleshwar Western Railway Corporation Ltd Green Field Airport Contacts: H.P.Sharma, Dy.Chief, Contacts: D Thimmegowda, Bengaluru, Tenders are invited for Construction of Electrical Engineer (Construction), Karnataka. T: 080-22238154 Access Road Alongwith Compound Wall Western Railway, on Road Side for Ankleshwar Green Kalupur, Ahmedabad-380002, Gujarat. 116 | Electrical power supply and Field Airport at Dist: Bharuch. T: 079-22147264 associated works for BARCS Submission Date: 14/11/2018 BARC/TSD/46/2018-19 | Tenders are Tenders Value (Rs): 46245000 114 | Erection of 220 Kv D/C invited for electrical power supply and Location: Gujarat Transmission Line associated works for BARCS 5 Mld Sea Gujarat State Aviation Infrastructure 30- TL / ADB / HPPTCL / 220 Water Desalination plant at Oscom (Irel) Company LTD kV D/C TRANSMISSION LINE/ Chatrapur, Odisha Contacts: &KLHI([HFXWLYHRI¿FHU MAZRAKARIAN | Tenders are invited Submission Date: 07/09/2018 GUJSAIL Complex, Near Torrent Sub for design, engineering, manufacture, Tenders Value (Rs): 132500000 Station, SVIP Airport, fabrication, testing at manufacturers Location: Odisha Ahmedabad - 380004, works, transportation to site, Bhabha Atomic Research Gujarat. T: 079-22882000, insurance, storage, erection, testing Contacts: Chief Engineer, Technical [email protected] and commissioning of 220 Kv D/C Service Division, Trombay, Transmission Line With Single Zebra Mumbai-400085, Maharashtra. Power Conductor From Proposed 132/220 T: 022-25505050, Kv Sub- Station Mazra To 33/220 [email protected] 112 | Providing ug cable works in Substation at Karian In Tirupati cityTenders are invited for Chamba District of Himachal Pradesh 117 | Construction of 1 no twin steel providing ug cable works in Tirupati on turnkey basis. ÀXHUFFFKLPQH\ city replacement of existing 33/11kv Submission Date: 21/08/2018 BHEL PSSR SCT 1736ID:2018_ overhead power distribution network of Location: Himachal Pradesh BHEL_326063_1 | Tenders are invited 8 nos 33/11kv substations of operation H.P. Power Transmission IRUFRQVWUXFWLRQRIQRWZLQVWHHOÀXH division of Tirupati city with underground Corporation Ltd rcc chimney of 275 mtrs height including power cable network using HDD Contacts: Deputy General Manager all civil, electrical and elevator works method on semi turnkey basis under (Contracts), Himfed Bhawan, Panjari, for units 1 and 2 of 2x660mw Udangudi smart city project. Shimla-171005, Himachal Pradesh. thermal power project at Kallamoli Submission Date: 14/08/2018 T: 0177- 2633784, village of Tiruchendur taluk, Tuticorin Tenders Value (Rs): 304700000 [email protected] distt., Tamil nadu Project Reporter 28 August 1, 2018 Infra Tenders Submission Date: 02/08/2018 organization (DRDO) premises, Location: Uttarakhand Location: Tamil Nadu Kolar, Karnataka. Department of Defence production Bharat Heavy Electricals Ltd Submission Date: 09/08/2018 Contacts: General Manager, Contacts: R.Siva, Sr. Engineer, House, Tenders Value (Rs): 4761000 Ordnance Factory, Siri Fort, New Delhi-110049, Delhi. Location: Kolar Karnataka Dehradun–248008, T: 011-66337000 Solar Energy Corporation Uttarakhand. T: 0135-2787371, of India Ltd [email protected] Railways Contacts: Director, D - 3, 1st Floor, Wing - A, Prius Platinum Building, Roads/Highways/Bridges 118 | SWD from railway track to District Centre, Saket, Rahamatullanagar Raj New Delhi-110017, Delhi. 124 | Construction of submersible KaluveDMA/2017-18/OW/WORK_ T: 011-71989200, bridge A/C River Godawari11 of INDENT72557/CALL-2 | Tenders are [email protected] 2018-2019 | Tenders are invited for invited for construction of SWD from construction of submersible bridge A/C railway track to Rahamatullanagar Raj 121 | Canal top Solar Power Station River Godawari on Parbhani Tadkalas Kaluve in Kolar CMC Limits under of PPP Model Dhanora Kale Palam Road (SH-235) in Amrut Scheme. 3UHTXDOL¿FDWLRQDUHLQYLWHGIRUFDQDOWRS km 126/200 near village Dhanora Kale Submission Date: 16/08/2018 solar power station of PPP model. under the Submergence of Tenders Value (Rs): 37400000 Submission Date: 16/08/2018 Digrass High Level Barrage Location: Uttar Pradesh Tq. Purna Dist Parbhani Location: Karnataka Irrigation & Water Resources Submission Date: 11/08/2018 Kolar CIty Municipal Council Department Tenders Value (Rs): 195000000 Contacts: Chief Municipal Contacts: P.K. Verma, Chief Engineer, Location: Parbhani Maharashtra CommissionerKolar District , Sinchai Bhawan, Cantt Road, Public Works Department, Kolar-563101, Karnataka. Udaiganj, Lucknow-226001, Govt. of Maharashtra T: 08152-220346, Uttar Pradesh. T: 0522-2626804, Contacts: Executive Engineer, PWD, [email protected] [email protected] Parbhani, Maharashtra. T: 02452-222708, 119 | Construction of SWD Keelukote 122 | Installation 100mw capacity [email protected] OHT to railway track in Kolar solar power plant DMA/2017-18/OW/WORK_ Expression of interest are invited 125 | Improvements to Mathkudal INDENT72557/CALL-2 | Tenders are for installation, commissioning, Grid Shivdav Kadgaon Gargoti Road invited for construction of swd keelukote Synchronization, operation and 23 FOR 2018-19 | Tenders are invited oht to railway track in kolar cmc limits maintenance of solar power plant of for improvements to Mathkudal under amrut scheme. 100mw capacity of canal tops, which Shivdav Kadgaon Gargoti Road SH. Submission Date: 16/08/2018 shall be given for a period of 25 years 179, Km. 55/00 to 94/00. Tenders Value (Rs): 11400000 for right to use, on PPP model at Tal. Bhudargad in Location: Karnataka following places: 1. Narainpur Pump Kolhapur District. lenath 35.21 km. Kolar CIty Municipal Council Canal, District Mirzapur-50 MW, etc. Submission Date: 06/08/2018 Contacts: Chief Municipal Submission Date: 16/08/2018 Tenders Value (Rs): 1058200000 CommissionerKolar District , Location: Uttar Pradesh Location: Kolhapur District Kolar-563101, Karnataka. Irrigation & Water Resources Maharashtra T: 08152-220346, Department Public Works Department, Govt. of [email protected] Contacts: P.K. Verma, Chief Engineer, Maharashtra Sinchai Bhawan, Cantt Road, Contacts: Executive Engineer, Renewable Energy Udaiganj, Lucknow-226001, Public Works (South) Division, Uttar Pradesh. Kolhapur, Maharashtra. 120 | Construction of 10 mw (ac) T: 0522-2626804, T: 0231-2650042, solar pv power plantSECI/C&P/ [email protected] [email protected] NIT/DRDO10MW/042018 | Design, engineering, supply, construction, 123 | Set up Solar power plant Sewage Treatment erection, testing and OFD/NC/65/2016-2017 ID:2018_ commissioning of 10 mw (ac) DoDP_335924_1 | Tenders are invited 126 | 25 MLD sewage treatment solar pv power plant including for Solar power plant, qty. 1 no. plant at Dafanala Ahmedabad 10 years plant o and m at defence Submission Date: 31/08/2018 Tenders are invited for design, research and development Tenders Value (Rs): 18360000 dupply, construction, installation, Project Reporter 29 August 1, 2018 Infra Tenders testing and commissioning of piping and instrumentation works with Tenders Value (Rs): 21500000 25 MLD sewage treatment plant three months trial run and Location: Allahabad Uttar Pradesh based on open technology with post completion operation & Military Engineer Services 2.5 MLD TTP at Dafanala maintenance of entire system for 10 Contacts: CE CC and CE, Ahmedabad. years including Lucknow-226002, UP. T: 0522-2481926 Submission Date: 14/08/2018 one year defect liability period at Tenders Value (Rs): 423500000 Dafnala Ahmedabad. Waste Management Location: Gujarat Submission Date: 14/08/2018 Ahmedabad Municipal Corporation Tenders Value (Rs): 423522500 129 | Electricity generation through Contacts: Additional City Engineer, Location: Gujarat municipal solid waste Ahmedabad-380001, T: 079-25391811, Ahmedabad Municipal Corporation Tenders are invited for electricity Contacts: Asst. Manager (Project), generation through municipal 127 | 25.00 MLD Ahmedabad-380001, T: 079-25391811 solid waste. sewage treatment plant Submission Date: 27/07/2018 Design, supply, construction, Sewage Treatment Location: West Bengal installation, testing and commissioning Kolkata Municipal Corporation of sewage treatment plant 128 | Sewage treatment plant at New Contacts: Director General (SWM), (25.00 MLD) based on open technology Cantt Allahabad Solid Waste Management Department, with inlet Pumping station, Tertiary Tenders are invited for provision of Kolkata Municipal Corporation, WUHDWPHQWZLWK8OWUD¿OWUDWLRQIRU sewage treatment plant at New Cantt 48, Market Street, 2nd Floor, 2.5 MLD, MCC panel room and all Allahabad (Phase ii of ii phase). Kolkata–700087, West Bengal. contingent civil, electrical, mechanical, Submission Date: 16/08/2018 T: 033-22861212, [email protected] Annual Subscription: Book this space for `3500/- (Downloadable PDF) www.ProjectReporter.co.in Vol. 12 No. 13 l January 1, 2017 Rs 30,000 in India’s Project Database Project Reporter 174 Projects & Tenders Digital Edition and reach out to 50,000 prospects from all over India. For Advertising: ® Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected] Project Reporter 30 August 1, 2018 Focus | Railways GAINING TRACTION Indian Railways manages the world’s largest rail network. The railways are the lifeline of the nation, transporting men and material across the country at the most economical rates. According to IBEF, the Indian Railways route length network is spread over 115,000 km, with 12,617 passenger trains and 7,421 freight trains each day from 7,349 stations plying 23 million travellers and 3 million tonne (MT) of freight daily. The revenues from the passenger segment in the last 10 years expanded at a CAGR of 10.42 per cent, with the total revenue earnings in FY17 totalling to around US$ 7.2 billion. Passenger earnings stood at US$ 6.8 billion during April-February 2017-18. Indian Railways has recorded 5 per cent jump in freight, passenger traffic in the last 8 months. The going is getting tougher and challenging with every passing day due to growth of population and demand from the industry at large. The policy makers and the people on the ground are collaborating like never before making full use of the technology to ensure smooth transportation of men and material. Still lot needs to be achieved by the railways. Sandeep Sharma takes a look at the railways sector in India. PROGRESS CARD \HDUSURMHFWHGWREH5V/DNK&ULQ Ɣ 5DLOZD\V DFKLHYHG WKH KLJKHVW HYHU IUHLJKW ORDGLQJ RI Ɣ 6WDWLRQUHGHYHORSPHQWDQGXSJUDGDWLRQLVJDLQLQJWUDFWLRQ 07LQDQG07LQ$FFRUGLQJ DQGVWDWLRQVDUHOLNHO\WREHUHYDPSHGZLWKDPRGHUQ WR 0LQLVWU\ RI 5DLOZD\V WKH IUHLJKW HDUQLQJV KDYH DOVR ORRNE\0DUFK VKRWXSZLWKDLQFUHDVHH[SHFWHGRYHUWKHSUHYLRXV Ɣ 'HGLFDWHG)UHLJKW&RUULGRUVFRPPLVVLRQLQJLQSKDVHVE\ Project Reporter 32 August 1, 2018 Focus | Railways LV OLNHO\ WR ERRVW WKH HFRQRPLF JURZWK DQG ')& WKURXJK 6WDWHV RI 3XQMDE +DU\DQD 8WWDU 3UDGHVK SUR¿WDELOLW\RIUDLOZD\V$WHOL3KXOHUDVHFWLRQRI'HGLFDWHG %LKDU-KDUNKDQGDQG:HVW%HQJDORIODQGUHTXLUHG IUHLJKWFRUULGRUFRQWDLQVQXPEHURIYLDGXFWVDQGPDMRU IRUERWKWKHFRUULGRUVKDVEHHQDFTXLUHG2YHUDOORI EULGJHVQXPEHURIPLQRUEULGJHVRQHUDLOÀ\RYHUDQG WRWDOFRQWUDFWVKDYHEHHQDZDUGHG7KH¿QDQFLDODQGSK\VLFDO URDGXQGHUEULGJHV7KHUHDUH')&VWDWLRQVLQWKLV SURJUHVVRQERWKFRUULGRUVLVDQGUHVSHFWLYHO\ VHFWLRQ DQG WZR MXQFWLRQV LH $WHOL DQG 3KXOHUD 7KH %RWK(')&DQG:')&VDUHWDUJHWHGIRUFRPPLVVLRQLQJLQ VHFWLRQZLOOEHFRPHRSHUDWLRQDORQWK$XJXVW SKDVHVE\\HDU Ɣ ,QFUHDVHGIRFXVRQFOHDQOLQHVVKDVOHGWRLQWURGXFWLRQRI 7KHFRVWRI(')&LVHVWLPDWHGDW5VFURUHZKLOH ,QWHJUDWHG 0HFKDQL]HG FOHDQLQJ ELRWRLOHWV $XWRPDWLF IRU :')& LW LV 5V FURUH 7KH DFWXDO H[SHQGLWXUH 5DLOPRXQWHGPDFKLQHWRFOHDUPXFNHWF LQFXUUHGWLOO0D\IRU(')&LV5VFURUHZKLOH Ɣ $YHUDJHDQQXDOFDSLWDOH[SHQGLWXUHLQODVW\HDUVPRUH IRU:')&LWLV5VFURUH WKDQGRXEOHRIDYHUDJHGXULQJ ')&&,/ ZLOO UXQ IUHLJKW WUDLQ DW WKH PD[LPXP VSHHG RI Ɣ LQFUHDVH LQ WKH DYHUDJH SDFH RI FRPPLVVLRQLQJ NPSHUKRXUDVDJDLQVWWKHFXUUHQWPD[LPXPVSHHGRI QHZ OLQHV IURP NP WR .PV SHU GD\ NPV SHU KRXU RQ ,QGLDQ 5DLOZD\ WUDFNV ZKHUHDV WKH DYHUDJH VSHHG RIIUHLJKWWUDLQV ZLOO DOVR EH LQFUHDVHG IURP Ɣ 5DVKWUL\D 5DLO 6DQUDNVKD .RVK 556. IXQG RI H[LVWLQJVSHHGRINPSKRQ,QGLDQ5DLOZD\VOLQHVWRNP 5V/DNK&UKDVEHHQDOORFDWHGIRUVDIHW\H[SHQGLWXUH SKRQ'HGLFDWHG)UHLJKW&RUULGRUV ')& RYHU\HDUV 7KH :HVWHUQ &RUULGRUV LV EHLQJ IXQGHG E\ -DSDQ Ɣ 7KH VXEXUEDQ VHFWLRQ RI WKH %HQJDOXUX DQG 0XPEDL ,QWHUQDWLRQDO &RUSRUDWLRQ $JHQF\ -,&$ ZKLOH WKH(DVWHUQ UHJLRQUHFHLYHGD¿OOLSLQWKH%XGJHW7KHPDMRU &RUULGRUIURP0XJKDOVDUDLWR/XGKLDQDLVEHLQJIXQGHGE\WKH LQYHVWPHQWVHDUPDUNHGIRU%HQJDOXUXVXEXUEDQV\VWHP :RUOG%DQN ZDV5V&URUHDQG0XPEDLVXEXUEDQV\VWHPLV 5VFURUHLQ%XGJHWIRUXSJUDGDWLRQDQG PUBLIC-PRIVATE PARTNERSHIP (PPP) EHWWHULQIUDVWUXFWXUH 7KHUDLOZD\VDUHNHHQWRXQGHUWDNHSURMHFWVXQGHU3XEOLF Ɣ 0XPEDL$KPHGDEDG+LJKVSHHG5DLOLVPRYLQJIRUZDUG 3ULYDWH 3DUWQHUVKLS 333 PRGH DQG KDYH LGHQWL¿HG WKH DQGSURPLVHVWRUHYROXWLRQLVH,QGLDQWUDQVSRUWVHFWRUZLWK DUHDVSURMHFWV VXFK DV %XLOGLQJVWUHQJWKHQLQJ RI UDLO KLJKHVWVWDQGDUGVRIVSHHGVDIHW\DQGVHUYLFH FRQQHFWLYLW\ 3ULYDWH FRQWDLQHU WUDLQ RSHUDWLRQV %XLOGLQJ Ɣ ,QGLD¶V)LUVW1DWLRQDO5DLO 7UDQVSRUWDWLRQ8QLYHUVLW\LQ SULYDWHIUHLJKWWHUPLQDOV:DJRQLQYHVWPHQWOHDVLQJVFKHPHV 9DGRGDUDLVOLNHO\WRRSHQLQ$XJXVW DQG5HGHYHORSPHQWRIVWDWLRQV Ɣ 'LJLWDOLQLWLDWLYHVSURPRWLQJWUDQVSDUHQF\DQGDFFRXQWDELOLW\ DUH HQKDQFHG ,QWURGXFWLRQ RI ( UHYHUVH DXFWLRQ FRXOG REDEVELOPMENT OF STATIONS KHOS VDYH DSSUR[LPDWHO\ 5V FURUH &DVKOHVV 7KHUDLOZD\VDUHJRLQJDKHDGZLWKVWDWLRQUHGHYHORSPHQW 7LFNHWLQJWKURXJKµ8WVRQPRELOH¶DSSLQWURGXFHG SURJUDPPHRQDJUDQGVFDOH&XUUHQWO\WKHIROORZLQJVWDWLRQV KDYHEHHQLGHQWL¿HGIRUUHGHYHORSPHQWWKURXJK333PRGH DEDICATED FREIGHT CORRIDORS (DFC) &KDUEDJK /XFNQRZ 8WWDU 3UDGHVK (UQDNXODP -XQFWLRQ 'HGLFDWHG)UHLJKW&RUULGRU&RUSRUDWLRQRI,QGLD ')&&,/ .HUDOD *RPWLQDJDU /XFNQRZ 8WWDU 3UDGHVK +DELEJDQM LV D 6SHFLDO 3XUSRVH 9HKLFOH VSY HVWDEOLVKHG XQGHU WKH %KRSDO 0DGK\D 3UDGHVK 'HOKL 6DUDL 5RKLOOD 'HOKL 0LQLVWU\ RI 5DLOZD\V WR XQGHUWDNH SODQQLQJ GHYHORSPHQW -DPPX 7DZL -DPPX .DVKPLU .RWD 5DMDVWKDQ PRELOL]DWLRQ RI ¿QDQFLDO UHVRXUFHV DQG FRQVWUXFWLRQ .R]KLNRGH .HUDOD 0DGJDRQ *RD 1HOORUH $QGKUD PDLQWHQDQFH DQG RSHUDWLRQ RI WKH 'HGLFDWHG )UHLJKW 3UDGHVK 3XGXFKHUU\ 87RI3XGXFKHUU\ 6XUDW *XMDUDW &RUULGRUV ')& LV D PDVVLYH SURJUDPPH XQGHUWDNHQ E\ DQG7LUXSDWL $QGKUD3UDGHVK UDLOZD\VWDWLRQV%KXEDQHVZDU UDLOZD\V WR FUHDWH UDLO LQIUDVWUXFWXUH DW DQ XQSUHFHGHQWHG VWDWLRQ LQ 2GLVKD KDV EHHQ WDNHQ XS IRU UHGHYHORSPHQW OHYHOWKDWZLOOHQKDQFHWKH,QGLDQ5DLOZD\VFDSDFLW\WRPHHW WKURXJK3DUWQHUVKLSZLWKWKH6WDWH*RYHUQPHQW WKHHYHUJURZLQJIUHLJKWUHTXLUHPHQW$OVRWKLVZRXOGOHDGWR FUHDWLRQ RI LQGXVWULDO FRUULGRUV DQG ORJLVWLF SDUNV DORQJ LWV MOU WITH MRVC DOLJQPHQWWKHUHE\OHDGLQJWRVSXUWLQHFRQRPLFDFWLYLW\ ,QWKHPRQWKRI0D\WKH0LQLVWU\RI5DLOZD\VKDG 6RPHRIWKHVDOLHQWIHDWXUHVRI'HGLFDWHG)UHLJKW&RUULGRU VLJQHGD0HPRUDQGXPRI8QGHUVWDQGLQJ 0R8 ZLWK0XPEDL ')& 3URMHFWDUHDV(DVWHUQ'HGLFDWHG)UHLJKW&RUULGRU 5DLOZD\ 9LNDV &RUSRUDWLRQ /WG 059& D -RLQW YHQWXUH RI (')& LVIURP/XGKLDQDWR'DQNXQL .PV/XGKLDQDWR 0LQLVWU\ RI 5DLOZD\V DQG WKH *RYHUQPHQW RI 0DKDUDVKWUD 6RQQDJDUDQG.PV6RQQDJDUWR'DQNXQL DQG:HVWHUQ XQGHUWKHDGPLQLVWUDWLYHFRQWURORIWKH0LQLVWU\RI5DLOZD\V 'HGLFDWHG)UHLJKW&RUULGRU :')& LVIURP-DZDKDUODO1HKUX 059& LV LPSOHPHQWLQJ 5DLO SURMHFWV RQ 0XPEDL VXEXUEDQ 3RUW7HUPLQDO -137 WR'DGUL .PV 'HVLJQHGIRUD V\VWHP XQGHU 0XPEDL 8UEDQ 7UDQVSRUW 3URMHFWV 0873V PD[LPXPVSHHGRI.PSK6XEVWUXFWXUHGHVLJQHGIRUDQ 7KH028ODLGGRZQWKHWDUJHWVIRUIRUYDULRXVLPSRUWDQW D[OHORDGRIWRQVDQGVXSHUVWUXFWXUHZLWKD[OHORDGRI DFWLYLWLHV RI VXEXUEDQ SURMHFWV $V SHU WDUJHWV XQGHU 0R8 WRQVDQG&DSDFLW\WRUXQORQJKDXOWUDLQRIPHWHUOHQJWK 059& VKDOO VSHQG 5V FURUH WRZDUGV FRPSOHWLRQ RI :HVWHUQ ')& SDVVHV WKURXJK 6WDWHV RI 8WWDU 3UDGHVK YDULRXVVXEXUEDQSURMHFWVRIFDSDFLW\HQKDQFHPHQWVDIHW\ +DU\DQD5DMDVWKDQ*XMDUDWDQG0DKDUDVKWUDDQG(DVWHUQ XSJUDGDWLRQDQGSDVVHQJHUDPHQLWLHV Project Reporter 33 August 1, 2018 Focus | Railways GOING SOLAR FOREIGN INVESTMENT AND PARTICIPATION ,QGLDQ 5DLOZD\V ,5 LV JRLQJ DKHDG ZLWK LWV SODQ WR )RUHLJQ'LUHFW,QYHVWPHQW )', HTXLW\LQÀRZIURP$SULO KDUQHVVVRODUHQHUJ\LQDELJZD\7KHUDLOZD\VKDVSODQQHG WR 'HFHPEHU LQ 5DLOZD\ VHFWRU LV 86 PLOOLRQ WRVHWXS0:RIVRODUSRZHUSODQWVFRPSULVLQJ0: 7KH )', LQYHVWPHQW KDV EHHQ XWLOLVHG IRU URRIWRS DQG 0: ODQG EDVHG VRODU SODQWV 7KH URRIWRS PDQXIDFWXULQJ RI 5ROOLQJ 6WRFN &RDFKHV DQG :DJRQV VRODUSODQWVZLOOEHSURYLGHGDW5DLOZD\VWDWLRQVDQGYDULRXV LQFOXGLQJ LWV SDUWV 6LJQDOOLQJ (TXLSPHQW DQG /RFRPRWLYHV VHUYLFHEXLOGLQJV 'LHVHODQG(OHFWULF SDUWVRIORFRPRWLYHV)',LQ5DLOZD\ ,QIUDVWUXFWXUH VHFWRU RQ DXWRPDWLF URXWH LQ WKH DUHDV INSTALLATION OF CCTV CAMERAS QDPHO\ L 6XEXUEDQFRUULGRUSURMHFWVWKURXJK333 LL +LJK &&79FDPHUDVDUHSURSRVHGWREHLQVWDOOHGSURJUHVVLYHO\ VSHHG WUDLQ SURMHFW LLL 'HGLFDWHG IUHLJKW OLQHV LY 5ROOLQJ DW DOO VWDWLRQV H[FHSW KDOW VWDWLRQV DQG SDVVHQJHU FDUU\LQJ VWRFN LQFOXGLQJ WUDLQ VHWV DQG ORFRPRWLYHFRDFKHV FRDFKHV H[FHSW *HQHUDO &RDFKHV VXEMHFW WR DYDLODELOLW\ PDQXIDFWXULQJ DQG PDLQWHQDQFH IDFLOLWLHV Y 5DLOZD\ RIIXQGV (OHFWUL¿FDWLRQ YL 6LJQDOOLQJ V\VWHPV YLL 3DVVHQJHU Zone/Year Number of CCTV camera installed 2018 2015 2016 2017 (Up to June) &HQWUDO5DLOZD\ 1LO (DVWHUQ5DLOZD\ 1LO 1LO 261 (DVW&HQWUDO5DLOZD\ 1LO 1LO 1LO (DVW&RDVW5DLOZD\ 1LO 1RUWK&HQWUDO5DLOZD\ 1RUWK(DVWHUQ5DLOZD\V 1LO 1RUWKHDVW)URQWLHU5DLOZD\ 1LO 1LO 1RUWK:HVWHUQ5DLOZD\ 1LO 1LO 22 1RUWKHUQ5DLOZD\ 6RXWK&HQWUDO5DLOZD\ 1LO 211LO 6RXWK(DVWHUQ5DLOZD\ 1LO 1LO 6RXWK(DVW&HQWUDO5DLOZD\ 6RXWKHUQ5DLOZD\ 1LO 116 1LO 6RXWK:HVWHUQ5DLOZD\ 1LO 1LO 1LO :HVW&HQWUDO5DLOZD\ 1LO 1LO 1LO :HVWHUQ5DLOZD\ 1LO Total Cameras 2022 2880 1223 1041 Source: PIB SAFETY INITIATIVES AND ENHANCEMENT WHUPLQDOV YLLL ,QIUDVWUXFWXUH LQ LQGXVWULDO SDUW SHUWDLQLQJ WR Ɣ ,&) &RDFKHV ZLOO EH QR PRUH PDQXIDFWXUHG DQG LW KDV UDLOZD\ OLQHVLGLQJV LQFOXGLQJ HOHFWUL¿HG UDLOZD\ OLQHV DQG EHHQ GHFLGHG WR VKLIW WR /LQNH +RIPDQQ %XVFK /+% FRQQHFWLYLWLHV WR PDLQ UDLOZD\ OLQH DQG L[ 0DVV 5DSLG GHVLJQ FRDFKHV 7KHVH FRDFKHV DUH VDIHU OLJKWHU LQ 7UDQVSRUW6\VWHPV ZHLJKW KDYH KLJKHU FDUU\LQJ FDSDFLW\ DQG KLJKHU 7KH 5DLOZD\V KDYH VLJQHG DJUHHPHQWV ZLWK $/6720 VSHHG SRWHQWLDO LQFUHDVHG FRGDO OLIH DQG EHWWHU VDIHW\ )UDQFH DQG*HQHUDO(OHFWULF 86$ IRUPDQXIDFWXULQJDQG IHDWXUHV DV FRPSDUHG WR ,QWHJUDO &RDFK )DFWRU\ ,&) PDLQWHQDQFH RI HOHFWULF DQG GLHVHO ORFRPRWLYHV $V SHU GHVLJQFRDFKHV FRQWUDFWHOHFWULFORFRPRWLYHVDQGGLHVHOORFRPRWLYHV Ɣ 9LJLODQFH &RQWURO 'HYLFH 9&' LV ¿[HG LQ DOO HOHFWULF DUHWREHPDQXIDFWXUHGDQGVXSSOLHGIURPWKHIDFWRU\VHWXS ORFRPRWLYHVWRSUHYHQWKXPDQHUURU E\ WKH FRPSDQLHV DW 0DGKHSXUD %LKDU DQG 0DUKRZUD Ɣ 6LPXODWRUEDVHGWUDLQLQJLVEHLQJLPSDUWHGIRUHQKDQFLQJ %LKDU UHVSHFWLYHO\RYHUDSHULRGRI\HDUV GULYLQJVNLOOV ,Q WKH DUHD RI EXLOGLQJ +LJK 6SHHG UDLO LQIUDVWUXFWXUH W Ɣ (OHFWULFDO(OHFWURQLF ,QWHUORFNLQJ 6\VWHP LV SURYLGHG WR KH 0LQLVWU\ RI 5DLOZD\V KDV VLJQHG 0HPRUDQGXP HOLPLQDWHKXPDQHUURU RI 8QGHUVWDQGLQJ 0R8 ZLWK &KLQD )UDQFH 6SDLQ 6RXWK Ɣ $XWRPDWLF7UDLQ3URWHFWLRQ6\VWHPKDVEHHQLPSOHPHQWHG .RUHD -DSDQ 8QLWHG .LQJGRP 5XVVLD DQG *HUPDQ\ Ɣ ,QWHUORFNLQJRI/HYHO&URVVLQJ /& *DWHVWRSURWHFW/& IRU FRRSHUDWLRQ $ 0HPRUDQGXP RI &RRSHUDWLRQ KDV *DWH ZLWK VLJQDOV WR DYRLG DFFLGHQWV KDV EHHQ GRQH DW EHHQ VLJQHG ZLWK *RYHUQPHQW RI -DSDQ IRU 0XPEDL JDWHVXSWR $KPHGDEDG +LJK 6SHHG 5DLO 0$+65 SURMHFW ZKLFK Ɣ 7UDFN &LUFXLWLQJ RI VWDWLRQV WR HQKDQFH VDIHW\ IRU LQFOXGHV WUDQVIHU RI WHFKQRORJ\ DQG 0DNH LQ ,QGLD YHUL¿FDWLRQRIWUDFNRFFXSDQF\E\HOHFWULFDOPHDQVLQVWHDG )RUHLJQ *RYHUQPHQWV DQG 5DLOZD\V KDYH VKRZQ NHHQ RI KXPDQ HOHPHQW KDV EHHQ FRPSOHWHG DW DERXW LQWHUHVW LQ WKH VWDWLRQ UHGHYHORSPHQW SURJUDP ZKLFK VWDWLRQVXSWR LQFOXGHV )UHQFK 5DLOZD\ 61&) .RUHDQ 5DLOZD\ Project Reporter 34 August 1, 2018 Focus | Railways Source: Indian Railways Project Reporter 35 August 1, 2018 Focus | Railways *RYHUQPHQWV RI )HGHUDO 5HSXEOLF RI *HUPDQ\ &KLQD DQG OHYHUDJLQJ ODWHVW WHFKQRORJ\ HPSOR\HH WUDLQLQJV DQG 8QLWHG.LQJGRP LQIUDVWUXFWXUH XSJUDGHV RQ VWDWLRQV DQG WUDLQV WR LQFUHDVH FXVWRPHU VDWLVIDFWLRQ ,5 ZLOO WDNH D SURDFWLYH DSSURDFK WR GOING GREEN HQVXUHVXVWDLQDELOLW\HVSHFLDOO\HQYLURQPHQWDOLQLWVSXUVXLWV ,QGLDQ 5DLOZD\V KDG HQWHUHG LQWR SDUWQHUVKLS ZLWK WKH &RQIHGHUDWLRQRI,QGLDQ,QGXVWU\ &,, LQ-XO\$VSDUWRI MOVING FORWARD WKLVSDUWQHUVKLS&,,LVIDFLOLWDWLQJYDULRXVUDLOZD\V¶SURGXFWLRQ 7KH RSSRUWXQLWLHV DUH LPPHQVH DQG WKH LQYHVWPHQW XQLWV ZRUNVKRSV DQG RWKHU XQLWV JR WKH *UHHQ ZD\ DQG UHTXLUHPHQWIRUEXLOGLQJDQGXSJUDGLQJUDLOLQIUDVWUXFWXUHLV LQ WKH SURFHVV HTXLSSLQJ WKHP WR JUHHQ WKH RSHUDWLRQV PDVVLYH7KHUDLOZD\VDUHXQGHUWDNLQJVHYHUDOLQLWLDWLYHVWR DQGSUDFWLFHV XSJUDGLQJ LWV DJHG UDLOZD\ LQIUDVWUXFWXUH DQG HQKDQFH LWV TXDOLW\ RI VHUYLFH 7KH ¿QDQFH PLQLVWHU KDG DQQRXQFHG D VISION AND ASPIRATION FDSLWDO H[SHQGLWXUH RI 5V ODNK FURUH IRU WKH ,QGLDQ $VSHU,QGLDQ5DLOZD\V9LVLRQ 3ODQVGRFXPHQW 5DLOZD\V LQ WKH 8QLRQ %XGJHW ,5 LV ZRUNLQJ ,QGLDQ 5DLOZD\V ,5 YLVLRQ LV WR EH D NH\ GULYHU RI WRZDUGV GRXEOLQJ NP RI OLQHV NP RI WUDFN ,QGLD¶VJURZWKDQGGHYHORSPHQW,5DLPVWREHWKHHQJLQHIRU UHQHZDO HOLPLQDWLRQ RI XQPDQQHG UDLOZD\ FURVVLQJV ,QGLD¶VHFRQRPLFJURZWKDQGWKHHQJLQHIRU,QGLD¶VHFRQRPLF PDQXIDFWXULQJ RI ZRUOGFODVV WUDLQ VHWV PDVVLYH JURZWK DQG GHYHORSPHQW E\ EHLQJ VDIH ¿QDQFLDOO\ YLDEOH HOHFWUL¿FDWLRQVZRUNVPRGHUQLVDWLRQRIVWDWLRQVLQVWDOODWLRQ HQYLURQPHQW IULHQGO\ DQG FDULQJ IRU LWV FXVWRPHUV DQG RI &&79V PRGHUQLVDWLRQ RI VLJQDOOLQJ V\VWHPV DQG HPSOR\HHV,5DVSLUHVWRDGGWR,QGLD¶V*'3E\EXLOGLQJ SURYLVLRQRIEHWWHUSDVVHQJHUDPHQLWLHV/RWRILQYHVWPHQWLV LQIUDVWUXFWXUHWRVXSSRUWPRGDOIUHLJKWVKDUHRI,QGLD¶V DW VWDNH DQG HFRQRPLF DFWLYLWLHV DUH OLNHO\ WR EH PXOWLSOLHG HFRQRP\ ,5 ZLOO SURYLGH VDIH WUDYHO E\ DFKLHYLQJ D µ1HDU ZLWK WKH SDUWLDO FRPPLVVLRQLQJ RI ')& VHFWRUV 7KH =HURIDWDOLW\¶SHUIRUPDQFH,5ZLOOGHYHORSLQWHJUDWHGEXVLQHVV RSSRUWXQLWLHV IRU SULYDWH VHFWRU SDUWLFLSDWLRQ DUH LQFUHDVLQJ VROXWLRQV WR FDSWXUH QHZ WUDI¿F ,5 ZLOO SURYLGH DLU FRROHG HYHU\ SDVVLQJ GD\ 7KH LPSURYHPHQW LQ WKH RSHUDWLRQDO WHPSHUDWXUHFRQWUROOHGVHUYLFHVIRUORQJGLVWDQFHWUDYHOWRDOO HI¿FLHQF\DQGVXVWDLQDELOLW\LVWKHNH\WRWKHJURZWKRIWKH VHJPHQWV RI SDVVHQJHUV LQ ,QGLD ,5 LV FRPPLWWHG WR UDLOZD\VLQ,QGLD Annual Subscription: Book this space for `3500/- (Downloadable PDF) www.ProjectReporter.co.in Vol. 12 No. 13 l January 1, 2017 Rs 30,000 in India’s Project Database Project Reporter 174 Projects & Tenders Digital Edition and reach out to 50,000 prospects from all over India. For Advertising: ® Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected] Project Reporter 36 August 1, 2018 Focus | Railways PROMINENT RAILWAY SECTOR COMPANIES INDIAN RAILWAYS Key Executive(s) 7DPLO1DGXTel: 5DLOZD\%RDUG'HOKL'HOKL 9LVKQXEKDL03DWHO0DQDJLQJ'LUHFWRU Website:ZZZVRXWKHUQUDLOZD\RUJ Tel: 5DKXOGHHS0LWWDO'*0 60 69 Key Executive(s) Email:GSUUO\#JPDLOFRP $.5DVWRJL'500'8 Key Executive(s) SAN ENGINEERING & 'U*1DUD\DQDQ$*0 *KDQ6K\DP6LQJK0HPEHU 7UDFWLRQ LOCOMOTIVE CO. LTD 0.*XSWD0HPEHU(QJLQHHULQJ 1R:KLWH¿HOG5RDG TEXMACO LTD *LULVK3LOODL0HPEHU7UDI¿F 0DKDGHYDSXUD2SSRVLWH7R,WSO 510XNKHUMHH5RDG $QDQG0DWKXU'LUHFWRU*HQHUDO %HQJDOXUX.DUQDWDND .RONDWD:HVW%HQJDO 3HUVRQQHO Tel: Tel: 'U$QLO.XPDU'LUHFWRU*HQHUDO 5+6 Fax: Fax: $QLO6D[HQD Email:HQTXLULHV#VDQHQJLQHHULQJFRP Email:WH[PDLO#WH[PDFRLQ 'LUHFWRU *HQHUDO3XEOLF5HODWLRQV Website:ZZZVDQHQJLQHHULQJFRP Website:ZZZWH[PDFRLQ E:GSUUO\#JPDLOFRP Key Executive(s) Key Executive(s) 5DPQDWK6XEUDPDQLDP 6.3RGGDU'LUHFWRUV RAIL VIKAS NIGAM LTD 0DQDJLQJ'LUHFWRU $&&KDNUDERUWWL'LUHFWRUV 3ORW1R)LUVW)ORRU$XJXVW.UDQWL %KDZDQ%KLNDML&DPD3ODFH SOUTH CENTRAL RAILWAY TITAGARH WAGONS LTD 5.3XUDP1HZ'HOKL'HOKL 5DLO+RXVH/DQFHUOLQHV 7LWDJDUK7RZHUV$QDQGDSXU(0 Tel: 6HFXQGHUDEDG.DUQDWDND %\SDVV.RONDWD:HVW%HQJDO Fax: Tel: Tel: Email:LQIR#UYQORUJ Website:ZZZVFUDLOZD\JRYLQ Fax: Website:ZZZUYQORUJ Key Executive(s) Email:FRUS#WLWDJDUKLQ Key Executive(s) $.0LWDO*0 Website:ZZZWLWDJDUKLQ 6&$JQLKRWUL $%KDUDW%KXVKDQ&&0 Key Executive(s) &KDLUPDQDQG0DQDJLQJ'LUHFWRU -DJGLVK3UDVDG&KRZGKDU\ 0V*LWD0LVKUD'LUHFWRU 3HUVRQQHO SOUTH EAST CENTRAL RAILWAY ([HFXWLYH&KDLUPDQ $UXQ.XPDU'LUHFWRU 2SHUDWLRQV 5DLO1LYDV%XQJORZQR5DLOZD\ 8PHVK&KRZGKDU\9LFH&KDLUPDQ 9LMD\$QDQG'LUHFWRU3URMHFWV 2I¿FHU¶V&RORQ\%LODVSXU 0DQDJLQJ'LUHFWRU &KKDWWLVJDUK 'KDUPHQGDU1DWK'DYDU'LUHFWRU RAILTEL CORPORATION OF INDIA LTD Tel: 0LQLVWU\RI5DLOZD\V 3ORW1R Fax: UNIRAIL ,QGXVWULDO$UHD2SS*ROG6XNH0DOO Website:ZZZVFUDLOZD\JRYLQ 6WUHHW1R1DJDUMXQD 6HFWRU*XUXJUDP+DU\DQD Key Executive(s) 1DJDU7DUQDND6HFXQGHUDEDG Tel: 'U6.1HPD&0' $QGKUD3UDGHVK Fax: ,QGUD*KRVK OD *0 Tel: Email:LQIR#UDLOWHOLQGLDFRP %.-RVKL&20 Fax: Website:ZZZUDLOWHOLQGLDFRP Website:ZZZXQLUDLOLQ Key Executive(s) SOUTH EASTERN RAILWAY Key Executive(s) 5.%DKXQJXQD&0' *DUGHQ5HDFK5RDG 6KLY.XPDU6ULQLYDVDQ .RONDWD:HVW%HQJDO 9LFH3UHVLGHQW±%XVLQHVV'HYHORSPHQW RITES LTD Tel: 6KRHE$KVDQ.KDQ 0LQLVWU\RI5DLOZD\V 5,7(62I¿ Website:ZZZVHUDLOZD\FRP 0DQDJHU±%XVLQHVV'HYHORSPHQW FH&RPSOH[3ORW1R6HFWRU± Key Executive(s) *XUXJUDP+DU\DQD $0LWDO'50$'5$ BEML LTD Tel: %(0/628'+$WK0DLQ65 Fax: SOUTH WESTERN RAILWAY 1DJDU%HQJDOXUX.DUQDWDND Email:LQIR#ULWHVFRP *HQHUDO0DQDJHU2I¿FH6RXWK:HVWHUQ Tel: Website:ZZZULWHVFRP 5DLOZD\&OXE5RDG.HVKZDSXU Email:RI¿FHFLR#EHPOFRLQ Key Executive(s) +XEOL.DUQDWDND Website:ZZZEHPOLQGLDLQ 5DMHHY0HKURWUD&0' Tel: Key Executive(s) $UELQG.XPDU'LUHFWRU3URMHFWV Fax: '.+RWD&KDLUPDQ 0DQDJLQJ'LUHFWRU $MD\.U*XDU'LUHFWRU)LQDQFH Website:ZZZVZULQGLDQUDLOZD\VJRYLQ %59LVZDQDWKD Key Executive(s) 'LUHFWRU 0LQLQJ &RQVW%XVL SADBHAV ENGINEERING LTD $.0LWDO*0 5+0XUDOLGKDUD &:LQJ*RGUHM&ROLVHXP $QLO.XPDU$JDUZDO'506%& 'LUHFWRU 'HIHQFH%XVLQHVV %K(YHUDUG1DJDU6LRQ (DVW 0XPEDL0DKDUDVKWUD SOUTHERN RAILWAY BESCO LTD (WAGON DIVISION) Tel: VWÀRRU1*2PDLQ%XLOGLQJ6RXWKHUQ $QLO0DLWUD5RDG%DOO\JXQJH Fax: 5DLOZD\3DUN7RZQ&KHQQDL .RONDWD:HVW%HQJDO Project Reporter 37 August 1, 2018 Focus | Railways Tel:Fax: KERALA RAPID TRANSIT Website:ZZZQRUWKZHVWHUQUDLOZD\FRP Email:LQIR#RPEHVFRLQ CORPORATION LTD Key Executive(s) PGV#RPEHVFRLQ 7&9HOOD\DPEDODP± $EKD\.XPDU*XSWD$'50-8 Website:ZZZRPEHVFRLQ .RZGLDU5RDG.RZGLDU32 $QDQG'HY&(( Key Executive(s) 7KLUXYDQDQWKDSXUDP.HUDOD 'HHSDN'DYH&20 2P3UDNDVK7DQWLD)RXQGHU &KDLUPDQ Tel:Fax: 0DGKXVXGDQ7DQWLD0DQDJLQJ'LUHFWRU Email:LQIR#NHUDODPRQRUDLORUJ NORTH EAST FRONTIER RAILWAY Key Executive(s) .DPUXS0DOLJDRQ$VVDP BHARAT WAGON & 6KHLN3DUHHWK0DQDJLQJ'LUHFWRU Tel: ENGINEERING LTD Website:ZZZQIUUDLOQHWJRYLQ &¶%ORFN0DXU\DORN&RPSOH[ KONKAN RAILWAY Key Executive(s) 3DWQD%LKDU CORPORATION LTD $.6KDUPD'50.DWLKDU Tel: %HODSXU%KDYDQ3ORW1R6HFWRU &6DLNLD&32 Fax: &%'%HODSXU1DYL0XPEDL Email:EZHOBSDWQD\DKRRFRLQ 0DKDUDVKWUD NORTHERN RAILWAY Website:ZZZEKDUDWZDJRQELKQLFLQ Tel: 1RUWKHUQ5DLOZD\1'&5%XLOGLQJ6WDWH Key Executive(s) Fax: (QWU\5RDG1HZ'HOKL'HOKL 0.5R\0DQDJLQJ'LUHFWRU Email:JHQHUDO#NRQNDQUDLOZD\FRP Tel: -D\DQW.XPDU'LUHFWRU Website:ZZZNRQNDQUDLOZD\FRP Website:ZZZQULQGLDQUDLOZD\VJRYLQ 1LUDM.XPDU'LUHFWRU)LQDQFH Key Executive(s) Key Executive(s) 0DPWD3DODUL\D'LUHFWRU 6DQMD\*XSWD $.6DFKDQ'50'/, &KDLUPDQ 0DQDJLQJ'LUHFWRU $MD\.XPDU6LQJKDO$'500% INTEGRAL COACH FACTORY %KDQX7D\DO0DQDJLQJ'LUHFWRU 'U$PEHGNDU5RDG.RQQXU+,JKZD\ $PLWDEK%DQHUMHH'LUHFWRU )LQDQFH VNR GROUP ,QWHJUDO&RDFK)DFWRU\$UHD 5RDG1R%DQMDUD+LOOV ,&)1RUWK&RORQ\ MEDHA SERVO DRIVES PVT LTD +\GHUDEDG7HODQJDQD .RQQXU&KHQQDL7DPLO1DGX $%HKLQG0LQW&RPSRXQG Tel: Tel: +\GHUDEDG7HODQJDQD Fax: Website:ZZZLFILQGLDQUDLOZD\VJRYLQ Tel:Fax: Email:LQIR#YQULOFRP Key Executive(s) Email:PDUNHWLQJ#PHGKDLQGLDFRP Website:ZZZYQULOFRP 6XGKDQVKX0DQL*HQHUDO0DQDJHU Website:ZZZPHGKDLQGLDFRP Key Executive(s) 9HQNDWHVDQ*93XEOLF5HODWLRQV2I¿FHU Key Executive(s) 91DUD\DQD5HGG\0DQDJLQJ'LUHFWRU < Project Reporter 38 August 1, 2018 Focus | Railways INDIAN RAILWAY CATERING AND Fax: CENTRAL ORGANISATION FOR TOURISM CORPORATION LTD Email:LQIR#EKDUDWUDLOFRP RAILWAY ELECTRIFICATION WK)ORRU%DQNRI%DURGD%XLOGLQJ PXPEDL#EKDUDWUDLOFRP 1DZDE Project Reporter 39 August 1, 2018 Focus | Railways 0HWUR6WDWLRQ%XLOGLQJ&RPSOH[ EASTERN RAILWAY Key Executive(s) 1HZ'HOKL'HOKL )DLUOLH3ODFH1HWDML6XEKDV5RDG LVK&KDQGUD$JQLKRWUL&KDLUPDQ Tel:Fax: .RONDWD:HVW%HQJDO $VKRN.ULVKQD*DQMX'LUHFWRU Website:ZZZGIFFLOJRYLQ Tel: 0XNXO-DLQ'LUHFWRU Key Executive(s) Fax: $QVKXPDQ6KDUPD Website:ZZZHULQGLDQUDLOZD\VJRYLQ HIND RECTIFIERS LTD 0DQDJLQJ'LUHFWRU Key Executive(s) /DNH5RDG%KDQGXS : $'DWWD'50+RZUDK 0XPEDL0DKDUDVKWUD EAST CENTRAL RAILWAY $.*XSWD$'5076HDOGDK Tel:Fax: *02I¿FH.RQDKDUD*KDW5RDG $.-KD3U&( Email:PDUNHWLQJ#KLUHFWFRP +DMLSXU9DLVKDOL%LKDU $.6KXNOD$'50$VDQVRO Website:ZZZKLUHFWFRP Tel Key Executive(s) Website:ZZZHFULQGLDQUDLOZD\VJRYLQ FEDDERS ELECTRIC AND 6.1HYDWLD Key Executive(s) ENGINEERING LTD &KDLUPDQ 0DQDJLQJ'LUHFWRU /DOLW&KDQGUD7ULYHGL*0 2NKOD3KDVH1HZ'HOKL 6DXUDEK1HYDWLD&(2 1DVLN3ODQW 5DMHVK.XPDU&352 'HOKLTel: Fax: HINDUSTHAN ENGINEERING & EAST-COAST RAILWAY Email:LQIR#IHGGHUVHOHFWULFFRP INDUSTRIES LTD 5DLO6DGDQ&KDQGUDVHNKDUSXU.KXUGD Website:ZZZIHGGHUVHOHFWULFFRP .DQFKDQMXQJD WK)ORRU %DUDNKDPED %KXEDQHVZDU2GLVKD Key Executive(s) 5RDG1HZ'HOKL'HOKL Tel: %ULM5DM3XQM&KDLUPDQ Tel:WRFax: Fax: 5DMHHY.XPDU%DQVDO Email:VP#KHLOLQGLDFRP Email:VGJP#HFRUUDLOQHWJRYLQ &KLHI)LQDQFLDO2I¿FHU Website:ZZZKHLOLQGLDFRP Website:ZZZHDVWFRDVWUDLOZD\JRYLQ Key Executive(s) Key Executive(s) HIGH SPEED RAIL CORPORATION OF 530RG\&KDLUPDQ $.*XSWD'506DPEDOSXU INDIA LTD 6DWLVK.DSXU'LUHFWRU $QLO.XPDU'50:DOWDLU 591/&RUSRUDWH2I¿FHVW)ORRU$XJXVW %LVZDMLW&KRXGKXU\'LUHFWRU %36ZDLQ&62 .UDQWL%KDZDQ%KLNDML&DPD3ODFH1HZ &0DGKXVXGKDQD5DR$'50:DOWDLU 'HOKL'HOKLEmail:LQIR#KVUFLQ *Partial list Annual Subscription: Book this space for `3500/- (Downloadable PDF) www.ProjectReporter.co.in Vol. 12 No. 13 l January 1, 2017 Rs 30,000 in India’s Project Database Project Reporter 174 Projects & Tenders Digital Edition and reach out to 50,000 prospects from all over India. For Advertising: ® Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected] Project Reporter 40 August 1, 2018 Focus | Railways PROMINENT METRO RAIL COMPANIES BANGALORE METRO RAIL $VKZDQL6D[HQD'LUHFWRU 3URMHFW Key Executive(s) CORPORATION LTD 5DMHVK.XPDU$JHUZDO'LUHFWRU 6DKDGHYD6LQJK UG)ORRU%PWF&RPSOH[.KURDG &RUS$IIDLUV 'LUHFWRU 3URMHFW 3ODQQLQJ 6KDQWKLQDJDU%HQJDOXUX 6KDUDG.XPDU3XEOLF5HODWLRQ2I¿FHU %LUHQ3DUPDU,$$6'LUHFWRU )LQDQFH .DUQDWDND Tel: KOCHI METRO RAIL LTD MUMBAI METRO ONE PVT LTD Website:ZZZEPUFFRLQ WK)ORRU5HYHQXH7RZHU3DUN$YHQXH 0HWUR&RUSRUDWH&HQWUH)RXU Key Executive(s) .RFKL.HUDOD %XQJDORZV$QGKHUL : ''3DKXMD'LUHFWRU Tel: 0XPEDL0DKDUDVKWUD 9LMD\.XPDU'KL'LUHFWRU 3 3 Email:DGPLQ#NRFKLPHWURPDLOFRP Tel: Website:ZZZNRFKLPHWURRUJ Email:FRUSFRP#UHOLDQFHPXPEDLPHWURFRP CHENNAI METRO RAIL LTD Key Executive(s) Website:ZZZUHOLDQFHPXPEDLPHWURFRP +DULQL7RZHUV1R&RQUDQ6PLWK 'U6XGKLU.ULVKQD&KDLUPDQ Key Executive(s) 5RDG*RSDODSXUDP&KHQQDL (OLDV*HRUJH,$60DQDJLQJ'LUHFWRU .0DKHVKZDUL'LUHFWRU 7DPLO1DGX 6LWDUDP3DUHHN'LUHFWRU Tel: KOLKATA METRO RAIL Email:FKHQQDLPHWURUDLO#JPDLOFRP CORPORATION LTD MUMBAI METRO RAIL CORPORATION Website:ZZZFKHQQDLPHWURUDLOJRYLQ +5%&&RPSOH[.05&/%KDZDQ LTD Key Executive(s) QGDQGUG)ORRU0XQVL3UHPFKDQG 1$0775,%XLOGLQJ3ORW1R5%ORFN 'U6XGKLU.ULVKQD,$6&KDLUPDQ 6DUDQL.RONDWD:HVW%HQJDO %DQGUD.XUOD&RPSOH[%DQGUD (DVW .5DMDUDPDQ,$60DQDJLQJ'LUHFWRU Tel: 0XPEDL0DKDUDVKWUD Fax: Tel: DELHI METRO RAIL Email:LQIR#NPUFLQ Email:FRQWDFW#PPUFOFRP CORPORATION LTD Website:ZZZNPUFLQ Key Executive(s) 0LQLVWU\RI8UEDQ'HYHORSPHQW Key Executive(s) $VKZLQL%KLGH,$60DQDJLQJ'LUHFWRU 0HWUR%KDZDQ)LUH%ULJDGH/DQH 3DUDVKXUDP6LQJK0DQDJLQJ'LUHFWRU 6X\DVK7ULYHGL&30 &LYLO %DUDNKDPED5RDG '0%LQQDU'\*0 &LYLO 1HZ'HOKL'HOKL LUCKNOW METRO RAIL E:GDWWDELQQDU#PPUFOFRP Tel: CORPORATION Fax: $GPLQLVWUDWLYH%XLOGLQJ1HDU'U%KLPUDR PUNE METRO RAIL Website:ZZZGHOKLPHWURUDLOFRP $PEHGNDU6DPDMLN3DULYDUWDQ6WKDO 7KH2ULRQ%XLOGLQJVWÀRRU2SSRVLWH Key Executive(s) 9LSLQ.KDQG*RPWL1DJDU 'RQ%RVFR Project Reporter 41 August 1, 2018 Road Watch TWO LANING OF BHILWARA-LADPURA SECTION 7ZRODQLQJZLWKSDYHGVKRXOGHUFRQ¿JXUDWLRQRI%KLOZDUDWR/DGSXUD6HFWLRQRI Project Details 1+ IURPNPWRNP LQWKH6WDWHRI5DMDVWKDQRQ(3&PRGH XQGHU1+'33KDVH±,9 Name of Authority National Highways Authority of India Contractor =LJQHJR&RPSDQ\,QF±*+9 ,QGLD 3YW/WG±-9 Authority Engineer 7KHPH(QJLQHHULQJ6HUYLFHV3YW/WG Project Cost `&URUH Project Length .P Contract Agreement Signing Date WK)HE Date of Commencement WK0DUFK Construction Period 'D\V Date of Completion VW'HFHPEHU Revised date of Completion Current Status 3HUFHQWZRUNLVFRPSOHWHG 6DWHQGUD.XPDU3URMHFW'LUHFWRU$5&9\DV&RORQ\%KLOZDUD5DMDVWKDQ Contacts 7FKLW#QKDLRUJ Source: NHAI Project Reporter 31 August 1, 2018 ASAPP Info Global Group Presents 4th Edition of ORDER YOUR COPY NOW! ` 5000/- ` 3999/- A unique, integrated business directory on Cement Industry Contact: [email protected] Tel: + 91 22 2419 3000 Cement Infobank is a practical database with a wealth of information that includes: 'DWDEDVHRIFRPSDQLHVIURPWKHFHPHQW $SURÀOHRIWKHFRPSDQLHVWKHDUHDVRI VHFWRUFRPSULVLQJ²PDQXIDFWXUHUVGHDOHUV EXVLQHVVNH\RSHUDWLQJXQLWVVXEVLGLDULHVHWF VXSSOLHUVFHPHQWSODQWPDFKLQHU\ 1DPHVDQGFRPSOHWHFRQWDFWGHWDLOVRINH\ FRQVXOWDQWVFHPHQWFRQFUHWHEORFN50& H[HFXWLYHV FHPHQWSURGXFWVFHPHQWVWRUDJHWUDQVSRUW 9LWDOVHFWRUGDWDDQGVWDWLVWLFV DQGDOOLHGLQGXVWULHV 3URMHFWRSSRUWXQLWLHV²DURXQGSURMHFWV 6HFWRURYHUYLHZ ZKHUHFHPHQWUHTXLUHPHQWH[LVWV ® $1DYEKDUDW(VWDWH=DNDULD%XQGHU5RDG6HZUL :HVW 0XPEDL Tel.:Fax: To order online visit: www.ASAPPinfoGlobal.com/Subscribe INDUSTRIAL OPPORTUNITIES Project Reporter 34 August 1, 2017 Equipment Tender 130 | Karnataka Power Corporation Ltd 134 | Uttar Pradesh Rajya Vidyut PRXQWHGÀRRUPRXQWHGUDFNVDQG Details: KPCL/2018-19/IND2672 | Utpadan Nigam Ltd support guide rail for EOT crane. Tenders are invited for supply of Details: T-44/CF-246/EPD-I/DTPS/ hydraulic excavators and hydraulic ANP/2018-19 ID:2018_ Submission Date: 13/11/2018, backhoe loader. RVUNL_224492_1 | Tenders are invited Location: Tamil Nadu, Submission Date: 10/08/2018, for procurement of conveyor belt for Tender Value (Rs.): 119179 Location: Karnataka coal handling plant. Contact: Head AUGF & NDDP, Contact: B R Suresha, Bellary, Submission Date: 13/08/2018, Kalpakkam-603102, Tamil Nadu. Karnataka. T: 08392-288616, Location: Uttar Pradesh T: 27480500 - 40228 M: 9448290750 Contact: Superintending Engineer Operation And Maintenance Circle-I 138 | Uttar Pradesh Rajya Vidyut 131 | National Marine Dredging Atps Anpara Thermal Project Anpara Utpadan Nigam Ltd Company Ltd Distt Sonebhadra-231225, Details: 05/EPD-III/ATPS/2018- Details: HQMM/3003-15/03ZN1/253 | Uttar Pradesh. 19ID:2018_RVUNL_206979_1 | Tenders are invited for diesel driven T: 05446-272781 Tenders are invited for supply of 50 ton backhoe loader with bucket on front & hydraulic rough terrain crane. rear of suitable size & width for 135 | South East Central Railway Submission Date: 16/10/2018, equipment with operating weight not Details: WRS-05-2018-19 | Hiring of Location: Uttar Pradesh less than 7.3 T cap. Road Mobile Cranes to off track and Contact: Superintending Engineer Submission Date: 10/08/2018, grounding of condemned wagons at Operation And Maintenance Circle-I Location: Telangana exchange yard Raipur, shifting and/or Atps Anpara Thermal Project Anpara Contact: Executive Director (Materials), ORDGLQJRIH[FOXGHG¿WWLQJVDWH[FKDQJH Distt Sonebhadra-231225, 10-3-311/A, Castle Hills, Masab Tank, yard Raipur, and shifting of wheel discs, Uttar Pradesh. T: 05446-272781 Hyderabad-500028, Telagana. axles etc at Wagon Repair Shop Raipur. T: 40-23536809, 23538713, 23538721, Submission Date: 20/08/2018, 139 | Military Engineer Services [email protected] Location: Raipur, Chattisgarh Details: 88987/E8ID:2018_ Tender Value (Rs.): 3736014.25 MES_192718_1 | Tenders are invited 132 | Cement Corporation of India Ltd Contact: Dayanand Sahu, Dy.CME-I, for construction of caustic washing bay Details: Tenders are invited for spares 3Rd Floor, GM Building, Bilaspur including washing cum cleaning for 300 mm dia of screw conveyor. -495004, Chhattisgarh. facility with caustic tank and eot crane Submission Date: 20/08/2018, T: 07752-247000, 247102 at Kankinara. Location: Himachal Pradesh Submission Date: 17/10/2018, Contact: HOD (MM), P.O.Rajban, 136 | Ordnance Factory Board Location: Kankinara, West Bengal Distt.Sirmaur-173025, Details: 2206/EO/13/2017-18 | Tenders Tender Value (Rs.): 21400000 Himachal Pradesh. are invited for hydraulic type mounted Contact: CE, Hq Chief Engineer T: 266227, 266221, crane of 14 ton @ 1.5 meter min., six Kolkata Zone, Ballygunge Maidan [email protected] fall, hydraulic winch motor, telescopic Camp, Gurusaday Road, boom /slotted boom, rope compensation Kolkata-700019, West Bengal. 133 | Karnataka Power Corporation Ltd DQGJHQHUDOO\FRQ¿UPLQJZLWK T: 033-24865714, Details: KPCL/2018-19/EL/WORK_ VSHFL¿FDWLRQIRUVWDQGDUG¿WPHQW [email protected] INDENT7426 | Tenders are invited in crane. for supply, erection, testing & Submission Date: 30/08/2018, _&HQWUDO&RDO¿HOGV/WG commissioning of heavy duty roll e drag Location: Maharashtra Details: CCL/CM(Pur)/HEMM/Sps for chain cable carrier system in place of Contact: General Manager, Madhav CAT 773E Dumper/146/18 | Tenders are conventional festoon trolley system Nagar, Ordnance Factory Katni, invited for procurement of spares for shuttle conveyor 55b in Madhya Pradesh. suitable for cat 773e (60t) dumper for chp-2 bunker area. T: 07622- 2238012, 221621, entire CCL against mb 18-19. Submission Date: 14/08/2018, 221605, 224082 Submission Date: 11/08/2018, Location: Karnataka Location: Ranchi, Jharkhand Contact: Chief Engineer 137 | Bhabha Atomic Research Tender Value (Rs.): 12984000 (Fuel Management) , Centre ( BARC ) Contact: MM Dept, CCL, Shakthinagar – 584170, Details: BARCF/AUGF/ME/TR/4/2017 | Ranchi, Jharkhand. Raichur District, Karnataka. Tenders are invited for fabrication & T: 0651-2360198, T: 08532-246135, 246125 erection of acoustic insulated door, wall [email protected] Project Reporter 44 August 1, 2018 Equipment Tender _1RUWKHUQ&RDO¿HOGV/WG Submission Date: 31/08/2018, INDENT70901 | Tenders are invited for Details: NCL/NGH/PUR/18- Location: Disergarh, West Bengal SURYLGLQJDQG¿[LQJLQWHUORFNSDYHUVDQG 19/18033/080ID:2018_NCL_108611_1 | Contact: Kaushik Gupta, Sr. Manager grill in Govt Urdu School at Kanti Oni Tenders are invited for procurement of (Pr), Sanctoria Dishergarh, and road and drain work at Nadaf Oni hoses for cat777d dumpers for the year Burdwan-713333, and Matti plot in ward no.6 at Dharwad. 2018 19 at Nigahi area. West Bengal. T: 0341-6451079, Submission Date: 16/08/2018, Submission Date: 13/08/2018, Location: Dharwad, Karnataka Location: Singrauli, Madhya Pradesh 143 | Uranium Corporation of India Contact: Executive Engineer, Tender Value (Rs.): 5768519.26 ltd HDMC, Dharwad, Karnataka. Contact: Dy General Manager (MM), Details: 3/PE180777/1 | Tenders are T: 0836-2213838 Nigahi Project, Area Purchase Cell LQYLWHGIRUVXSSO\RIGLHVHO¿OWHULQVHUW Nigahi Area, /WUVWDU)+)GLHVHO¿OWHU 145 | South East Central Railway Po: Nigahi Dist, Singrauli-486884, insert 1.1Ltr cloth 1457431003 8-F8 Details: SECR-HQ-ENGG-BL-18-19-05 Mdhya Pradesh. T: 07805-276040, make Bosch / Mico only and for HM | Tenders are invited for hiring of one [email protected] Loader Truck JCB. pickup van / mini truck or similar vehicle Submission Date: 13/08/2018, for 12 months under the jurisdiction of _(DVWHUQ&RDO¿HOGV/WG Location: Jharkhand SSE. Details: ECL/HQ/GM(CMC)/Transport/ Contact: P.O. Jaduguda Mines, Submission Date: 23/08/2018, Regn./2016/2287 | Tenders are invited Jadugoda-832102, Jharkhand. T: Location: Chhattisgarh, for application (NIA) for registration of 0657-2730122 2730222/2730353, Tender Value (Rs.): 320198.64 FRQWUDFWRUVLQ(DVWHUQ&RDO¿HOGV [email protected] Contact: B V S Subrahmanyam, Limited towards transportation 3Rd Floor, GM Building, of coal/sand and loading by 144 | Hubli-Dharwad City Corporation Bilaspur-495004, Chhattisgarh. pay-loader / excavator. Details: DMA/2017-18/OW/WORK_ T: 0775-2410893 Annual Subscription: Book this space for `3500/- (Downloadable PDF) www.ProjectReporter.co.in Vol. 12 No. 13 l January 1, 2017 Rs 30,000 in India’s Project Database Project Reporter 174 Projects & Tenders Digital Edition and reach out to 50,000 prospects from all over India. For Advertising: ® Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected] Project Reporter 45 August 1, 2018 Industrial Tenders Andaman and Nicobar hand held thermal imager, un-cooled ELECTRICAL & ELECTRONIC Tender Value (Rs.): 2576000 (binocular, long range) alongwith EQUIPMENT Contact: 621, Haddo Post, Port accessories. Blair–744102, Andaman and Nicobar. Submission Date: 08/11/2018 146 | Mahanagar Telephone T: 03192–248239, 248397, 233863, Location: New Delhi, Delhi Nigam Ltd F: 232808, [email protected] Contact: Provisioning Directorate, Details: MTNL/SM(MM-II)/DP BOX/e- Procurement Branch, East Block-v, R.K.Puram, Tender-01/2018-19 | E-Procurement of INDUSTRIAL SUPPLIES DP-boxes. New Delhi-110066, Delhi. Submission Date: 16/08/2018 T: 011-26177024, F: 26195724, Location: Mumbai, Maharsahtra 150 | All India Institute of Medical 26101054, [email protected] Contact: Sr. Manager, Parel Telephone Sciences 154 | Indian Institute of Technology Complex, Sr. Manager, Parel, Details: AIIMS/R/CS/Opth/17/6591/OT | Details: IITJMU/CF/2018/SP-030 | Mumbai-400012, Maharashtra. Retender for supply of spectral Tender for 500 MHz NMR spectrometer T: 022-24706922, 24716799, domain OCT and ND YAG laser for for advanced multi dimensional solution [email protected] ophthalmology department at AIIMS Raipur. state experiments. 147 | Department of Electronics and Submission Date: 08/11/2018 Submission Date: 14/08/2018 Information Technology Location: Raipur, Chhattisgarh Location: Jammu, Jammu and Kashmir Details: ERTLE/PUR/66/98/2018/3/ Contact: G.E. Road, Tatibandh, Contact: Central Instrument Facility, OT-13 | Procurement of Signal Raipur-492099, Chhattisgarh. Jagti, PO Nagrota, NH-44, Generator. T: 0771-2971307, Jammu-181221, Jammu and Kashmir. Submission Date: 16/08/2018 [email protected] M: 8082828215, Location: Kolakata, West Bengal [email protected], Contact: G Biswas, Joint Director, [email protected] Electronics Regional Test Laboratory, PUMPS & VALVES 155 | Defence Research and DN-63, Sector-V, Development Organisation Salt Lake, Kolkata-700091, 151 | Engineers India Ltd Details: DMSRDE/19ATT053/18-19 | West Bengal. T: 033-23673662, 6577, Details: DC/ A731-000-QV-MR-9020 Procurement of air jet erosion tester. 7543, F: 23679472, 8974, /1003Date | Procurement of ball valves. Submission Date: 13/08/2018 [email protected] Submission Date: 14/08/2018 Location: Kanpur, Uttar Pradesh Location: New Delhi, Delhi Contact: Director, G.T.Road, GAS GENERATION & GAS Tender Value (Rs.): 99999999999 Kanpur-208013, Uttar Pradesh. PURIFICATION PLANTS Contact: D Chatterjee, DGM (SCM), T: 0512-2451759, 78, 201, 202, (,/2I¿FH%KLNDML&DPD3ODFH F: 2450404, 2404774, New Delhi-110066, Delhi. [email protected] 148 | Defence Research and T: 011-26763203, 3209, Development Organisation [email protected], Details: DMSRDE/19ATT055/18-19 | [email protected] Advertise in Project Procurement of gases and regulator (as Reporter Digital Edition SHUVSHFL¿FDWLRQ Submission Date: 13/08/2018 TEST & MEASURING INSTRUMENTS and reach out to Location: Kanpur, Uttar Pradesh 50,000 Prospects Contact: Director, G.T.Road, 152 | Material Organisation Kanpur-208013, Uttar Pradesh. Details: MOPBR / NS / 17PQBC030 | from all over India. Annual Subscription: `3500/- (Downloadable PDF) T: 0512-2451759, 78, 201, 202, Procurement of water poison detection F: 2450404, 2404774, kit (WPDK). www.ProjectReporter.co.in Vol. 14 No. 1 l July 1, 2018 India’s Project Database [email protected] Submission Date: 13/08/2018 Location: Port Blair, INDUSTRIAL SAFETY & SECURITY Andaman and Nicobar FLY HIGH SYSTEMS Tender Value (Rs.): 513135 Contact: 621, Haddo Post, Port ® Blair–744102, Andaman and Nicobar. For Advertising: 149 | Material Organisation T: 03192–248239, 248397, 233863, Contact Sandeep Sharma Details: MOPBR / NS / 18PQBC001 | F: 232808, [email protected] Procurement of emergency life support on +91-22-24193000 / 24193096 apparatus (elsa) with transparent hood. 153 | Ministry of Home Affairs Email: Submission Date: 16/08/2018 Details: HHTI(Uncooled)/2018/1307-08 [email protected] Location: Port Blair, dated 29-06-2018 | Procurement of Project Reporter 46 August 1, 2018 Industrial Projects 156 | Neelkanth Pulp & Paper Boards 160 | Shree Cement Ltd Contact: 0LU]D6KXMD'HVLJQDWHG Industrial Entrepreneurs Memorandum Industrial Entrepreneurs Memorandum 3DUWQHU=HUR0LOH6WRQH5DQLNKHW ,(0 ZDV¿OHGZLWK'HSDUWPHQWRI ,(0 ZDV¿OHGZLWK'HSDUWPHQWRI 5RDG9LOO0RKDQ$PDUSXU5DPQDJDU Industrial Policy & Promotion on Industrial Policy & Promotion on 1DLQLWDO8WWDUDNKDQG IRUWKHPDQXIDFWXULQJRI IRUWKHPDQXIDFWXUHRI GFSDQGH\#UHGWDSHLQGLDFRP 0)*FUDIWSDSHU portland and cement, aluminous Location: Rajkot, Gujarat FHPHQWVODJFHPHQWDQGVLPLODU 164 | J K Cement Ltd Contact: +LWHVK3DWHO'LUHFWRU$QNXU K\GUDXOLFFHPHQW Industrial Entrepreneurs Memorandum (VWDWH2SS9UXQGDYDQ(VWDWH Location: 3DOL5DMDVWKDQ ,(0 ZDV¿OHGZLWK'HSDUWPHQWRI $PDUQDJDU0DLQ5RDG Contact: +0%DQJXU0DQDJLQJ Industrial Policy & Promotion on 0DYGL3ORW5DMNRW*XMDUDW 'LUHFWRU6WUDQG5RDG IRUWKHPDQXIDFWXUH 7LQIRGQ#QSSERDUGFRP .RONDWD:HVW%HQJDO RI3RUWODQGFHPHQW 7 Location: $OLJDUK8WWDU3UDGHVK 157 | Shree Cement Ltd VKUHHEZU#VKUHHFHPHQWOWGFRP Contact: Project Reporter 47 August 1, 2018 Industrial Projects 'LUHFWRU0RXQW5RDG6DGDU IRUWKHPDQXIDFWXULQJ ,(0 ZDV¿OHGZLWK'HSDUWPHQWRI 1DJSXU0DKDUDVKWUD RI3LSH&5&RLOV Industrial Policy & Promotion on 7 Location: &KLNEDOODSXU.DUQDWDND WRVHWXS&OLQNHUXQLW DGPLQ#VXQÀDJVWHHOFRP Contact: $QMDOL/DO'LUHFWRU Location: 'KDU0DGK\D3UDGHVK .DXVKDPEL1HDU$QDQG9LKDU7HUPLQDO Contact: 'LUHFWRU$LUHQ+HLJKWV _6XQÀDJ,URQ$QG6WHHO 1&5'HOKL 386FKHPH1RRSS&0DOO Company Ltd 7 $%5RDG,QGRUH Industrial Entrepreneurs VOPXO#DSODSROORFRP 0DGK\D3UDGHVK 0HPRUDQGXP ,(0 ZDV¿OHGZLWK 7 'HSDUWPHQWRI,QGXVWULDO3ROLF\ 171 | J K Cement Ltd VDWJXUXFHPHQW#\DKRRFRLQ 3URPRWLRQRQIRUWKH Industrial Entrepreneurs Memorandum PDQXIDFWXUHRI6WHHOLQLQJRWVRU ,(0 ZDV¿OHGZLWK'HSDUWPHQWRI 174 | Penna Cement Industries Ltd RWKHUSULPDU\IRUPVDQGRWKHU Industrial Policy & Promotion on Industrial Entrepreneurs Memorandum VHPL¿QLVKHGSURGXFWVRIVWHHO IRUWKHPDQXIDFWXUH ,(0 ZDV¿OHGZLWK'HSDUWPHQWRI Location: %KDQGDUD0DKDUDVKWUD RISRUWODQGFHPHQW Industrial Policy & Promotion on Contact: 3UDQDY%KDUGZDM0DQDJLQJ Location: 0DKLVDJDU*XMDUDW WRVHWXS:DVWHKHDW 'LUHFWRU0RXQW5RDG6DGDU Contact: Annual Subscription: `3500/- (Downloadable PDF) www.ProjectReporter.co.in Book this space for Rs 20,000 in Project Reporter Vol. 11 No. 23 l June 1, 2016 India’s Project Database Digital Edition and reach out to 50,000 prospects L&T Hyderabad Metro Station – Hyderabad, Telangana from all over India. For Advertising: 195 Projects & Tenders Contact Sandeep Sharma on +91-22-24193000 / 24193096 Email: [email protected] ® Project Reporter 48 August 1, 2018 Smart Cities Tender Project Reporter 36 November 15, 2017 Smart Cities Tender 176 | 5HWUR¿WWLQJRIWRZQ+DOO%XLOG 179 | ,QWUDVWUXFWXUDOZRUNIRU EHDXWL¿FDWLRQRIYDULRXVSDUNVDQGRSHQ LQJLQ9LVDNKDSDWQDP &KLWUDNRRW7RZQ spaces at Amritsar under Amritsar GVSCCL/Projects/64/(Town Hall MPUDCL/139 (Second Call) | Tenders Smart City Project (Phase-1) with 01 Building)/ 2018-19 | Tenders are invited are invited for construction of Intrastruc- year of Defect Liability Period followed IRUUHWUR¿WWLQJRIWRZQ+DOO%XLOGLQJ tural work for Chitrakoot Town under by 03 years of O&M. under Heritage Conservation in Vi- Mini Smart City Scheme. 6XEPLVVLRQ'DWH02/08/2018 sakhapatnam under Smart City Mission. 6XEPLVVLRQ'DWH23/08/2018 7HQGHUV9DOXH37062000 6XEPLVVLRQ'DWH16/08/2018 7HQGHUV9DOXH223200000 /RFDWLRQ Amritsar Punjab 7HQGHUV9DOXH31043760 /RFDWLRQ Chitrakoot Madhya Pradesh $PULWVDU6PDUW&LW\/LPLWHG $6&/ /RFDWLRQ Visakhapatnam 0DGK\D3UDGHVK8UEDQ'HYHORSPHQW &RQWDFW$GGUHVVCEO, S.C.U. 21, Andhra Pradesh &RPSDQ\/WG 2nd Floor, B-BIOCK, District Shopping *UHDWHU9LVDNKDSDWQDP0XQLFLSDO &RQWDFW$GGUHVVChief In Engineer, Complex, Ranjlt Avenue, Amritsar, &RUSRUDWLRQ Jail Marg, Bhopal-462011, Madhya Punjab. T: 0183-5015048 &RQWDFW$GGUHVVManaging Director, Pradesh. Room No.306, Asilmetta Junction, T: 0755-2763060, 616, 22762825, 183 | 5HGHYHORSPHQWRI2OG%XV Visakhapatnam – 530003, Stand Andhra Pradesh. 180 | ,QIUDVWUXFWXUDOZRUNIRU SSCL/4975/2018-TENDER-3 | Tenders T: 0891-2746300, *XQD7RZQ are invited for Redevelopment of Old [email protected] MPUDCL/142 | Tenders are invited Bus Stand under Smart City Mission. for construction of Infrastructural 6XEPLVVLRQ'DWH24/08/2018 177 | ,QIUDVWUXFWXUDOZRUNIRU work for Guna Town under Mini 7HQGHUV9DOXH921300000 *DQMEDVRGD7RZQ Smart City Scheme. /RFDWLRQ Salem Tamil Nadu MPUDCL/141 | Tenders are invited for 6XEPLVVLRQ'DWH23/08/2018 6DOHP6PDUW&LW\/WG construction of infrastructural work for 7HQGHUV9DOXH210800000 &RQWDFW$GGUHVVManaging Director, Ganjbasoda Town under Mini Smart /RFDWLRQ Guna Town Madhya Pradesh Salem-636007, Tamil Nadu. City Scheme. 0DGK\D3UDGHVK8UEDQ'HYHORSPHQW T: 0427-2212844, F: 2220191, 6XEPLVVLRQ'DWH23/08/2018 &RPSDQ\/WG 7HQGHUV9DOXH210800000 &RQWDFW$GGUHVVChief In Engineer, 184 | 0XOWLOHYHO&DU3DUNLQJQHDU /RFDWLRQ Ganj Basoda Madhya Pradesh Jail Marg, Bhopal-462011, 9LFWRULD&RPPHUFLDO&RPSOH[ 0DGK\D3UDGHVK8UEDQ'HYHORSPHQW Madhya Pradesh. SSCL/4975/2018-TENDER-2 | Tenders &RPSDQ\/WG T: 0755-2763060, 616, 22762825, are invited for Multilevel Car Parking &RQWDFW$GGUHVVChief In Engineer, [email protected] near Victoria Commercial Complex Jail Marg, Bhopal-462011, under Smart City Mission. Madhya Pradesh. 181 | 0XOWL0RGDO7UDQVLW+XELQ3XQH 6XEPLVVLRQ'DWH24/08/2018 T: 0755-2763060, 616, 22762825, PSCDCL/Transit Hub/18/2018 | 7HQGHUV9DOXH78500000 [email protected] Expression of interest are invited for /RFDWLRQ Salem Tamil Nadu development of Multi Modal Transit Hub 6DOHP6PDUW&LW\/WG 178 | ,QIUDVWUXFWXUDOZRUNIRU6LGKL in Pune on Public Private Partnership &RQWDFW$GGUHVVManaging Director, 7RZQ (PPP) in Balewadi Area, under Pune Salem-636007, Tamil Nadu. MPUDCL/140 | Tenders are invited for Smart City Mission. T: 0427-2212844 construction of Infrastructural work for 6XEPLVVLRQ'DWH17/08/2018 Sidhi Town under Mini Smart City /RFDWLRQ Pune Maharashtra 185 | 0XOWLOHYHO&DU3DUNLQJQHDU Scheme, etc. 3XQH6PDUW&LW\'HYHORSPHQW $QDQGKD%ULGJH 6XEPLVVLRQ'DWH23/08/2018 &RUSRUDWLRQ/WG SSCL/4975/2018-TENDER-1 | Tenders 7HQGHUV9DOXH210800000 &RQWDFW$GGUHVVRajendra Jagtap, are invited for Multilevel Car Parking /RFDWLRQ Sidhi District CEO, 204, A wing, ICC Trade Tower, near Anandha Bridge under Madhya Pradesh Senapati Bapad Rd, Shivajinagar, Smart City Mission. 0DGK\D3UDGHVK8UEDQ'HYHORSPHQW Pune-411016, Maharashtra. 6XEPLVVLRQ'DWH24/08/2018 &RPSDQ\/WG T: 020-25252525, M: 9689931300, 7HQGHUV9DOXH135000000 &RQWDFW$GGUHVVChief In Engineer, 9923483832, [email protected] /RFDWLRQ Salem Tamil Nadu Jail Marg, Bhopal-462011, 6DOHP6PDUW&LW\/WG Madhya Pradesh. 182 | %HDXWL¿FDWLRQRIYDULRXVSDUNV &RQWDFW$GGUHVVManaging Director, T: 0755-2763060, 616, 22762825, DQGRSHQVSDFHVDW$PULWVDU Salem-636007, Tamil Nadu. [email protected] Tenders are invited for development and T: 0427-2212844, F: 2220191 Project Reporter 50 August 1, 2018 ASAPP Info Global Group Presents 5th Edition of A one stop source for business contacts of the power industry. POWER INFOBANK is a practical database that contains: &Listings of companies, organizations and associations & $SURÀOHRIWKHFRPSDQLHVWKHDUHDVRIEXVLQHVVNH\ RSHUDWLQJXQLWVVXEVLGLDULHVHWF &1DPHVDQGFRPSOHWHFRQWDFWGHWDLOVRINH\SHUVRQQHORI FRQVWLWXHQWFRPSDQLHV &9LWDOVHFWRUGDWDDQGVWDWLVWLFV & Power Sector project information 7KHEX\HUVXVHUVRIWKLVUHVRXUFHJXLGHGLUHFWRU\ ZRXOGEHDOOWKHVWDNHKROGHUVRIWKHSRZHUVHFWRUEHLW SRZHUJHQHUDWLRQGLVWULEXWLRQDQGWUDQVPLVVLRQFRPSDQLHV VWDWHHOHFWULFLW\ERDUGVIXHOVXSSOLHUVHTXLSPHQW FRPSRQHQWPDQXIDFWXUHUV VXSSOLHUVWHQGHULQJ DXWKRULWLHVLQWHUQDWLRQDOFRPSDQLHVLQYHVWRUVJRYHUQPHQW DJHQFLHVHPEDVVLHVFRQVWUXFWLRQ LQIUDVWUXFWXUH Offer Price FRPSDQLHVGHFLVLRQPDNHUVDQGPDQ\FRPSDQLHVZKRDUH `3999 only GLUHFWO\DQGLQGLUHFWO\UHODWHGZLWKWKH3RZHUVHFWRULQ,QGLD ` 5000only MRP Order your copy now, call 022-2419 3000 | 65267837/38 or write to [email protected] ® $1DYEKDUDW(VWDWH=DNDULD%XQGHU5RDG6HZUL :HVW 0XPEDL 7HO)D[ To order online visit : www.ASAPPinfoGlobal.com/Subscribe Power Statistics Capacity Addtion Targets and Achievements in the 12th Plan (i) Targets (MW) Type/Sector Central State Private Total Thermal 14,878.00 13,922.00 43,540.00 72,340.00 Hydro 6,004.00 1,608.00 3,285.00 10,897.00 Nuclear 5,300.00 0.00 0.00 5,300.00 Total 26,182.00 15,530.00 46,825.00 88,537.00 (ii) Achievements upto Apr, 2017 during the 12th Plan (MW) Type/Sector Central State Private Total Thermal 15,868.60 22,201.35 53,660.50 91,730.45 Hydro 2,584.02 2,276.00 619.00 5,479.02 Nuclear 2,000.00 0.00 0.00 2,000.00 Total 20,452.62 24,477.35 54,279.50 99,209.47 Acievement % 78.12 157.61 115.92 112.05 Achievement of Capacity Addition during the Current Plan upto April 2017 12th Plan Target 88,537 MW, Achieved so far 99,209.47 MW 90,000.00 80,000.00 72,340.00 70,000.00 60,000.00 50,000.00 40,000.00 30,000.00 20,000.00 10,897.00 5,479.02 5,300.00 10,000.00 2,000.00 0.00 Thermal Hydro Nuclear Target Achievement Project Reporter 52 August 1, 2018 Power Statistics ALL INDIA INSTALLED CAPACITY (IN MW) OF POWER STATIONS (As on 31.05.2018) (UTILITIES) Modewise breakup Ownership/ Grand Region Thermal RES * Sector Nuclear Hydro Total Coal Gas Diesel Total (MNRE) State 16794.00 2879.20 0.00 19673.20 0.00 8643.55 689.56 29006.31 Northern Private 22760.83 558.00 0.00 23318.83 0.00 2514.00 11854.66 37687.49 Region Central 13290.37 2344.06 0.00 15634.43 1620.00 8496.22 329.00 26079.65 Sub Total 52845.20 5781.26 0.00 58626.46 1620.00 19653.77 12873.22 92773.45 State 21280.00 2849.82 0.00 24129.82 0.00 5446.50 311.19 29887.51 Western Private 34285.67 4676.00 0.00 38961.67 0.00 481.00 19473.89 58916.56 Region Central 15042.95 3280.67 0.00 18323.62 1840.00 1620.00 661.30 22444.92 Sub Total 70608.62 10806.49 0.00 81415.11 1840.00 7547.50 20446.38 111248.99 State 19432.50 791.98 ######## 20512.36 0.00 11808.03 518.02 32838.41 Southern Private 12124.50 5322.10 ######## 17920.30 0.00 0.00 33359.36 51279.66 Region Central 14225.02 359.58 0.00 14584.60 3320.00 0.00 491.90 18396.50 Sub Total 45782.02 6473.66 ######## 53017.26 3320.00 11808.03 34369.28 102514.57 State 6950.00 100.00 0.00 7050.00 0.00 3537.92 225.11 10813.03 Eastern Private 6375.00 0.00 0.00 6375.00 0.00 399.00 803.29 7577.29 Region Central 13876.64 0.00 0.00 13876.64 0.00 1005.20 10.00 14891.84 Sub Total 27201.64 100.00 0.00 27301.64 0.00 4942.12 1038.40 33282.16 State 0.00 457.95 36.00 493.95 0.00 422.00 254.25 1170.20 North Private 0.00 24.50 0.00 24.50 0.00 0.00 23.31 47.81 Eastern Region Central 520.02 1253.60 0.00 1773.62 0.00 1030.00 5.00 2808.62 Sub Total 520.02 1736.05 36.00 2292.07 0.00 1452.00 282.56 4026.63 State 0.00 0.00 40.05 40.05 0.00 0.00 5.25 45.30 Private 0.00 0.00 0.00 0.00 0.00 0.00 2.21 2.21 Islands Central 0.00 0.00 0.00 0.00 0.00 0.00 5.10 5.10 Sub Total 0.00 0.00 40.05 40.05 0.00 0.00 12.56 52.61 State 64456.50 7078.95 ######## 71899.38 0.00 29858.00 2003.37 103760.75 Private 75546.00 10580.60 ######## 86600.30 0.00 3394.00 65516.72 155511.02 All India Central 56955.00 7237.91 0.00 64192.91 6780.00 12151.42 1502.30 84626.63 Total 196957.50 24897.46 ######## 222692.59 6780.00 45403.42 69022.39 343898.39 Figures at decimal may not tally due to rounding off $EEUHYLDWLRQ6+3 6PDOO+\GUR3URMHFW 0: %3 %LRPDVV3RZHU8 , 8UEDQ ,QGXVWULDO:DVWH3RZHU5(6 5HQHZDEOH(QHUJ\6RXUFHV 1RWH5(6LQFOXGH6+3%38 ,6RODUDQG:LQG(QHUJ\,QVWDOOHGFDSDFLW\LQUHVSHFWRI5(6 015( DVRQ $VSHUODWHVWLQIRUPDWLRQDYDLODEOHZLWK015( *Break up of RES all India as on 31.03.2018 is given below (in MW) : Bio-Power Small Hydro Power Wind Power Solar Power Total Capacity BM Power/Cogen. Waste to Energy 4485.81 34046.00 8700.80 138.30 21651.48 69022.39 A. Capacity Addedduring April., 2018 110 MW 8 RI3$5(+36 0: KDVEHHQFRPPLVVLRQHGDQGDGGHGWRWKH&HQWUDO6HFWRURI1(5VWDWHVDVSHUWKHLUDOORFDWLRQ B. Capacity Retired during April., 2018 0 MW C. Capacity Derated April., 2018 0 MW D. Net Capacity April., 2018 A-B-C 110 MW 6KDUHRIVWDWHVIURP.,6+$1*$1*$+36 0: KDVEHHQUHYLVHGDVSHUWKHLUDFWXDODOORFDWLRQ Project Reporter 53 August 1, 2018 ECONOMIC INSIGHTS INDEX OF EIGHT CORE INDUSTRIES (BASE: 2011-12=100) MAY, 2018 The Eight Core Industries comprise 40.27 per cent of the weight of items included in the Index of Industrial Production (IIP). The combined Index of Eight Core Industries stands at 131.4 in May, 2018, which was 3.6 per cent higher as compared to the index of May, 2017. Its cumulative growth during April to May, 2018-19 was 4.1 per cent. COAL Coal production (weight: 10.33 per cent) increased by 12.1 per cent in May, 2018 over May, 2017. Its cumulative index increased by 14.0 per cent during April to May, 2018-19 over corresponding period of the previous year. CRUDE OIL Crude Oil production (weight: 8.98 per cent) declined by 2.9 per cent in May, 2018 over May, 2017. Its cumulative index declined by 1.9 per cent during April to May, 2018-19 over the corresponding period of previous year. NATURAL GAS The Natural Gas production (weight: 6.88 per cent) declined by 1.4 per cent in May, 2018 over May, 2017. Its cumulative index increased by 2.0 per cent during April to May, 2018-19 over the corresponding period of previous year. REFINERY PRODUCTS 3HWUROHXP5H¿QHU\SURGXFWLRQ ZHLJKWSHUFHQW LQFUHDVHGE\SHUFHQWLQ0D\RYHU0D\ Its cumulative index increased by 3.9 per cent during April to May, 2018-19 over the corresponding period of previous year. FERTILIZERS Fertilizers production (weight: 2.63 per cent) increased by 8.4 per cent in May, 2018 over May, 2017. Its cumulative index increased by 6.6 per cent during April to May, 2018-19 over the corresponding period of previous year. STEEL Steel production (weight: 17.92 per cent) increased by 0.5 per cent in May, 2018 over May, 2017. Its cumulative index increased by 2.1 per cent during April to May, 2018-19 over the corresponding period of previous year. CEMENT Cement production (weight: 5.37 per cent) increased by 5.2 per cent in May, 2018 over May, 2017. Its cumulative index increased by 10.7 per cent during April to May, 2018-19 over the corresponding period of previous year. ELECTRICITY Electricity generation (weight: 19.85 per cent) increased by 3.5 per cent in May, 2018 over May, 2017. Its cumulative index increased by 2.8 per cent during April to May, 2018-19 over the corresponding period of previous year. Note 1: Data for March, 2018, April, 2018 and May, 2018 are provisional. Note 2: Since April, 2014, Electricity generation data from Renewable sources are also included. Note 3: The industry-wise weights indicated above are individual industry weight derived from IIP and blown up on pro rata basis to a combined weight of ICI equal to 100. Project Reporter 54 August 1, 2018 ECONOMIC INSIGHTS Performance of Eight Core Industries Yearly Index & Growth Rate Base Year: 2011-12=100 Sector Weight 2012-13 2013-14 2014-15 2015-16 2016-17 2017-18 Apr-May Apr-May 2017-18 2018-19 Coal 10.3335 103.2 104.2 112.6 118.0 121.8 124.9 107.4 122.4 Crude Oil 8.9833 99.4 99.2 98.4 97.0 94.5 93.7 95.1 93.3 Natural Gas 6.8768 85.6 74.5 70.5 67.2 66.5 68.4 66.6 67.9 5H¿QHU\ 28.0376 107.2 108.6 108.8 114.1 119.7 125.2 120.7 125.4 Products Fertilizers 2.6276 96.7 98.1 99.4 106.4 106.6 106.6 93.7 99.9 Steel 17.9166 107.9 115.8 121.7 120.2 133.1 140.5 138.5 141.4 Cement 5.3720 107.5 111.5 118.1 123.5 122.0 129.7 125.4 138.9 Electricity 19.8530 104.0 110.3 126.6 133.8 141.6 149.2 154.4 158.7 Overall Index 100.0000 103.8 106.5 111.7 115.1 120.5 125.7 122.7 127.8 Growth Rates (in per cent) Sector Weight 2012-13 2013-14 2014-15 2015-16 2016-17 2017-18 Apr-May Apr-May 2017-18 2018-19 Coal 10.3335 3.2 1.0 8.0 4.8 3.2 2.6 -3.2 14.0 Crude Oil 8.9833 -0.6 -0.2 -0.9 -1.4 -2.5 -0.9 0.1 -1.9 Natural Gas 6.8768 -14.4 -12.9 -5.3 -4.7 -1.0 2.9 3.3 2.0 5H¿QHU\ 28.0376 7.2 1.4 0.2 4.9 4.9 4.6 2.8 3.9 Products Fertilizers 2.6276 -3.3 1.5 1.3 7.0 0.2 0.03 -0.5 6.6 Steel 17.9166 7.9 7.3 5.1 -1.3 10.7 5.6 6.3 2.1 Cement 5.3720 7.5 3.7 5.9 4.6 -1.2 6.3 -3.3 10.7 Electricity 19.8530 4.0 6.1 14.8 5.7 5.8 5.3 6.8 2.8 Overall Index 100.0000 3.8 2.6 4.9 3.0 4.8 4.3 3.3 4.1 Project Reporter 55 August 1, 2018 PERFORMANCE OF EIGHT CORE INDUSTRIES MONTHLY INDEX & GROWTH RATE BASE YEAR: 2011-12=100 INDEX Sector Coal Crude Oil Natural 5H¿QHU\ Fertiliz- Steel Cement Electric- Overall Gas Products ers ity Index Weight 10.3335 8.9833 6.8768 28.0376 2.6276 17.9166 5.3720 19.8530 100.0000 May-17 111.8 97.6 69.7 125.4 98.3 142.9 128.6 158.1 126.8 Jun-17 107.6 94.1 69.3 119.4 107.3 138.0 132.0 147.4 121.7 Jul-17 98.5 96.4 72.2 119.4 108.6 131.3 122.4 151.9 120.4 Aug-17 101.3 95.1 69.5 121.6 115.4 139.0 117.3 155.4 123.0 Sep-17 103.1 92.0 68.8 122.7 105.3 138.7 119.8 150.5 122.0 Oct-17 119.4 95.7 71.0 132.1 116.8 146.7 125.2 149.8 128.7 Nov-17 133.5 90.8 68.5 126.0 111.8 137.5 125.4 140.1 124.1 Dec-17 142.6 94.2 69.2 133.1 112.1 138.0 135.3 143.9 128.8 Jan-18 149.5 93.8 67.6 135.4 105.5 145.0 140.6 149.5 132.5 Feb-18 143.2 86.1 62.1 120.9 102.2 141.7 138.0 136.1 123.2 Mar-18 185.0 95.8 69.8 130.3 107.0 153.2 148.9 156.7 138.4 Apr-18 119.6 91.8 67.1 119.1 93.1 139.2 142.4 153.7 124.2 May-18 125.3 94.8 68.7 131.6 106.6 143.7 135.3 163.7 131.4 Growth Rates (in per cent) Sector Coal Crude Oil Natural 5H¿QHU\ Fertilizers Steel Cement Electricity Overall Gas Products Index Weight 10.3335 8.9833 6.8768 28.0376 2.6276 17.9166 5.3720 19.8530 100.0000 May-17 -3.2 0.7 4.5 5.4 -5.9 3.8 -1.4 8.2 3.9 Jun-17 -6.7 0.6 6.4 -0.2 -2.7 6.0 -3.3 2.2 1.0 Jul-17 0.6 -0.5 6.6 -2.7 0.2 9.4 1.0 6.6 2.9 Aug-17 15.4 -1.6 4.2 2.4 -0.6 2.2 0.7 8.3 4.4 Sep-17 10.4 0.1 6.3 8.1 -7.7 3.7 0.1 3.4 4.7 Oct-17 3.9 -0.4 2.8 7.5 3.0 8.6 -1.3 3.2 5.0 Nov-17 0.7 0.2 2.4 8.2 0.3 14.5 16.9 3.9 6.9 Dec-17 0.4 -2.1 1.1 6.6 3.0 0.4 17.7 4.4 3.8 Jan-18 3.8 -3.2 -1.2 11.0 -1.6 1.7 19.6 7.7 6.2 Feb-18 1.3 -2.4 -1.8 7.8 5.2 5.0 23.0 4.6 5.4 Mar-18 9.1 -1.6 0.9 1.1 3.2 4.7 13.0 6.0 4.4 Apr-18 16.0 -0.8 5.8 2.7 4.6 3.8 16.5 2.1 4.6 May-18 12.1 -2.9 -1.4 4.9 8.4 0.5 5.2 3.5 3.6 Source: Ministry of Commerce & Industry Project Reporter 56 August 1, 2018 Database | Consultants, Certifying And Rating Agencies CREDIT ANALYSIS AND RESEARCH LTD DESIGN GROUP PROJECT M NChakravarty, Director (Technical) 4th Floor, Godrej Coliseum, Behind CONSULTANTS PVT LTD Prashant Kumar Jha, Everard Nagar, Off Eastern Express No. 110/4, M. Krishnappa, Layout, Marketing Manager Highway, Sion (E), Lalbagh Road, D: 011-26841122 Mumbai-400022, Maharashtra Bangalore-560027, Karnataka E: [email protected] Tel: 022-67543456, 555 Tel: 080-22238706, 22242570 Fax: 022-67543457 Fax: 080-22227308 ELCON ENGINEERS PVT LTD Email: [email protected] Email: [email protected] Website: www.careratings.com Website: www.designgroup.in 416-417 Center point, Key Executive(s) Key Executive(s) R.C. Dutt Road, Alkapuri, D R Dogra, Managing Director and B L Lakshminarasimha, Vadodara-390007, Gujarat &KLHI([HFXWLYH2I¿FHU Managing Director and CEO Tel: 0265-2985152, 2359152 P N Sathees Kumar, Chief General M M Reddy, Fax: 0265-2335152 Manager (Ratings) Director (Electrical) Email: [email protected] E: [email protected] Website: www.elconengineers.com Ravikiran Apate, Key Executive(s) Head (Business Development) Extn-641 DEVELOPMENT CONSULTANTS Arvind Mehta, E: [email protected] PVT LTD Chairman and Managing Director Development Consultant House, Block Mrunal Mehta, Director DG 4 Sector 2, Bhavesh Darwani, Purchase Manager CRISIL LTD Kolkata-700091, West Bengal CRISIL House, Central Avenue, Tel: 033-40125300 ELSYTEC POWER PROJECTS PVT Hiranandani Business Park, Email: [email protected] LTD Powai, Mumbai-400076, Maharashtra Website: www.dcpl.net.in Tel: 022-33423000 Key Executive(s) 12/1, 57th Street, Ashok Nagar, Fax: 022-33423001 G. C. Nundy, Managing Director Chennai-600083, Tamil Nadu Email: [email protected], E: [email protected] Tel: 044-42060447, 24711169 [email protected] Dr. A. R. Ghosal, Director Fax: 044-42080447 Website: www.crisil.com E: [email protected] Email: [email protected], Key Executive(s) P. K Banerjee, [email protected] Ashu Suyash, Managing Director CEO Executive Director (Marketing) Website: www.elsytec.com Sunetra Banerjee, Director (Marketing E: [email protected] Key Executive(s) and Communication) N Ramakrishnan, Managing Director D: 022-33421838 M: 9500067680 E: [email protected] DHI (INDIA) WATER AND S Balakrishnan, Director (Marketing) Raman Uberoi, ENVIRONMENT PVT. LTD. M: 9444566879 Business Development Rating NSIC Bahwan, III Floor, Vasanthi Ramakrishnan, Director E: [email protected] NSIC - STP Complex, M: 9500067681 Okhla Industrial Estate, New Deenadayalan Parthiban, Delhi-110020, Delhi Manager-Designs DESEIN PVT LTD Tel: 011-47034500 Fax: 011-47034501 M: 9940639771 Desein House, Greater Kailash-II, New Email: [email protected], Surendra Kumar, Manager-Technical Delhi-110048, Delhi [email protected] M: 9840067429 Tel: 011-41891400, 41891445 Website: www.dhigroup.com R.Krishnaswamy, Sr. Executive Fax: 011-29218393, 29219566 Key Executive(s) M: 9444024216 Email: [email protected] Flemming Jakobsen Greve, Website: www.desein.com Managing Director ENTURA HYDRO TASMANIA INDIA Key Executive(s) E:ÀM#GKLJURXSFRP PVT LTD Anant Gupta, Managing Director E: [email protected] FC 24, Film City, Sector 16 A, Bhavna Gupta, Director DIMENSION ENGINEERING Noida-201301, Uttar Pradesh Sunil Sharma, CONSULTANTS PVT LTD Tel: 0120-4033100 Fax: 0120-4033130 Executive Director (Power) L-15, First Floor, Kalkaji, New Email: [email protected] E: [email protected] Delhi-110019, Delhi Website: www.entura.com.au, www. Rakesh Bhargav, Tel: 011-26426574, 26448122 hydrotasmania.com.au Executive Director (Marketing) Fax: 011-26239871 Key Executive(s) E: [email protected] Email: [email protected] Ajay Sharma, Managing Director N P Gupta, President Website: www.dimensionengg.com M: 9910386409 Sanjeev Kumar, Key Executive(s) Ajit Garg, Director (Marketing) Purchase Manager Mita Chakravarty, Managing Director For more such databaase call on 022-24193000 to order our sectoral directories Project Reporter 57 August 1, 2018 ISSN 2277-6532 Date of Publication: 1st & 15th of Every Month. Presented by In Association with CONSTRUCTION COUNCIL Register FOUNDATION OF INFRASTRUCTURE RESEARCH STUDIES TRAINING October 24th-25th | Taj Palace | New Delhi Now! ...THIS TIME WITH GLOBAL CONSTRUCTION LEADERS. IT’S BACK!!! THE BIGGEST CONGREGATION OF CONSTRUCTION LEADERS IN INDIA! CHIEF GUEST KEYNOTE SPEAKER 24th OCTOBER 2018 Suresh Prabhakar Prabhu Graham Robinson Awarding Top 100 Minister of Commerce & Industry and Executive Director – Global Civil Aviation Construction Perspectives Global International Contractors Business Consultant – Pinsent and Design Firms Masons LLP 25th OCTOBER 2018 Construction World Leadership A true moment of victory: Winners of CW Annual Awards 2017. The winners. Summit In New York 2011 In New York 2011 CW Annual Awards 2 DAYS | OCT 24-25, 2018 | CONSTRUCTION CEOs | STATE GOVERNMENT OFFICIALS | MINISTERS | TECHNOLOGY EQUIPMENT CEOs | STEEL CEOs | BANKERS | FUND MANAGERS | LOGISTICS CEOs | CV CEOs Supporting Organizations Media Partners ASAPP Info Global Services Pvt. Ltd. www.IndiaConstructionFestival.com A-303, Nav Bharat Estate, Zakaria Bunder Road, Email: [email protected] Sewri (West), Mumbai- 400015. INDIA. Tel: +91-22-2419 3000 Mob: 8422 987 407