Symbolism Discussion of the Angels and Demons Movie
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
The Names of Wind -Summer 2009
The Names of Wind ccording to the Western Abenaki of New England, the winds of their world Awere generated by a giant eagle that lived on a craggy peak and flapped its wings continuously. Various nomadic tribes of central Asia had a comparable myth. They believed that the wind originated from a vast hole in a mountain somewhere to the west. And the Inuit of Alaska thought that the winds issued forth from an opening in the sky. Here in the West, we believe that the wind is generated by the mother of all earthly things, our own star Sun. According to our legend, the sun beats down on the equatorial tropics, heating the air, which subsequently rises high into the stratosphere, creating a vacuum all along the equator. Because of the physical phenomenon known as the Coriolis effect, air from both the north and the south rushes in to fill the space, thereby creating, because of the rotation of the earth, the ever-reliable trade winds. This basic system is much complicated by landforms such as deserts and mountain ranges, which churn and blend the moving airs, creating a variety of local winds. Some of these such as the foehn are warm dry winds that flow down the lee side of the mountains. Some, such as the sirocco, are bred in deserts and drawn northward by low-pressure areas. Many of these local winds are notorious for their strength as well as their effect on the human psyche, and most of them are named, a fact that has added to the rich tapestry of languages. -
Science & Technology Trends 2020-2040
Science & Technology Trends 2020-2040 Exploring the S&T Edge NATO Science & Technology Organization DISCLAIMER The research and analysis underlying this report and its conclusions were conducted by the NATO S&T Organization (STO) drawing upon the support of the Alliance’s defence S&T community, NATO Allied Command Transformation (ACT) and the NATO Communications and Information Agency (NCIA). This report does not represent the official opinion or position of NATO or individual governments, but provides considered advice to NATO and Nations’ leadership on significant S&T issues. D.F. Reding J. Eaton NATO Science & Technology Organization Office of the Chief Scientist NATO Headquarters B-1110 Brussels Belgium http:\www.sto.nato.int Distributed free of charge for informational purposes; hard copies may be obtained on request, subject to availability from the NATO Office of the Chief Scientist. The sale and reproduction of this report for commercial purposes is prohibited. Extracts may be used for bona fide educational and informational purposes subject to attribution to the NATO S&T Organization. Unless otherwise credited all non-original graphics are used under Creative Commons licensing (for original sources see https://commons.wikimedia.org and https://www.pxfuel.com/). All icon-based graphics are derived from Microsoft® Office and are used royalty-free. Copyright © NATO Science & Technology Organization, 2020 First published, March 2020 Foreword As the world Science & Tech- changes, so does nology Trends: our Alliance. 2020-2040 pro- NATO adapts. vides an assess- We continue to ment of the im- work together as pact of S&T ad- a community of vances over the like-minded na- next 20 years tions, seeking to on the Alliance. -
Introducing Ambigrams in the Classroom
Of Art & Math: Introducing Ambigrams in the classroom Mathematicians love puzzles—they love to play with numbers P���� M����� and shapes but often their love can turn to words and other areas G����� B�������� that, at least on the surface, have little to do with mathematics. In wordplay (and its relationship to mathematics) called ambigrams. Thethis articleword ambigram we are going was to coined focus byon cognitivea very speci�ic scientist kind Douglas of artistic Hofstadter from ‘ambi’ which suggests ambiguous and ‘gram’ for letter. Ambigrams exploit how words are written and bring together the mathematics of symmetry, the elegance of typography and the psychology of visual perception to create surprising, artistic designs. Most of all, they are great fun! All right, let’s start with the example in Figure 1. Can you read it? Figure 1. A 180-degree rotation ambigram for the word “Wordplay” Keywords: ambigrams, calligraphy, symmetry, perception, palindrome, mapping, transformation, re�lection 28 At Right Angles | Vol. 2, No. 3, November 2013 Rotating the page you are holding will reveal something interesting. The word stays the same! much sense in the design for “ambigram” has now In other words, it has rotational symmetry. the natural “g-b” transformation that made so maps onto itself. Thus ambigrams are a way of writing words such shifted to a “b-a” transformation while “g” now that they can be read or interpreted in more than one way. Figure 2 is another one, an ambigram for the word “ambigram.” Figure 3.The fi rst of two ambigrams, for “ambigrams.” This design reads the same when rotated 180-degrees. -
“Talk” on Albanian Territories (1392–1402)
Doctoral Dissertation A Model to Decode Venetian Senate Deliberations: Pregadi “Talk” on Albanian Territories (1392–1402) By: Grabiela Rojas Molina Supervisors: Gerhard Jaritz and Katalin Szende Submitted to the Medieval Studies Department Central European University, Budapest In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Medieval Studies, Budapest, Hungary 2020 CEU eTD Collection To my parents CEU eTD Collection Table of Contents Acknowledgments .................................................................................................................................. 1 List of Maps, Charts and Tables .......................................................................................................... 2 Introduction ............................................................................................................................................ 3 A Survey of the Scholarship ........................................................................................................................... 8 a) The Myth of Venice ........................................................................................................................... 8 b) The Humanistic Outlook .................................................................................................................. 11 c) Chronicles, Histories and Diaries ..................................................................................................... 14 d) Albania as a Field of Study ............................................................................................................. -
The Image Imagining Ourselves
Eighth International Conference on The Image Imagining Ourselves 31 OCTOBER–1 NOVEMBER 2017 | VENICE INTERNATIONAL UNIVERSITY | VENICE, ITALY ONTHEIMAGE.COM Eighth International Conference on The Image “Imagining Ourselves” 31 October–1 November 2017 | Venice International University | Venice, Italy www.ontheimage.com www.facebook.com/OnTheImage @ontheimage | #ICOTI17 Eighth International Conference on the Image www.ontheimage.com First published in 2017 in Champaign, Illinois, USA by Common Ground Research Networks www.cgnetworks.org © 2017 Common Ground Research Networks All rights reserved. Apart from fair dealing for the purpose of study, research, criticism, or review as permitted under the applicable copyright legislation, no part of this work may be reproduced by any process without written permission from the publisher. For permissions and other inquiries, please contact [email protected]. Common Ground Research Networks may at times take pictures of plenary sessions, presentation rooms, and conference activities which may be used on Common Ground’s various social media sites or websites. By attending this conference, you consent and hereby grant permission to Common Ground to use pictures which may contain your appearance at this event. Designed by Ebony Jackson Cover image by Phillip Kalantzis-Cope The Image ontheimage.com Dear Image Conference Delegates, Welcome to Venice and to the Eighth International Conference on The Image. The Image Research Network—its conference, journal, and book imprint—is brought together around -
Barry Lawrence Ruderman Antique Maps Inc
Barry Lawrence Ruderman Antique Maps Inc. 7407 La Jolla Boulevard www.raremaps.com (858) 551-8500 La Jolla, CA 92037 [email protected] Carte de L'Amerique Nouvellement dressee suivant les Nouvelles descouvertes . 1661 [and] Carte Nouvelle de L'Europe Asie & Afrique Nouvellement . Stock#: 74198 Map Maker: Tavernier Date: 1661 Place: Paris Color: Hand Colored Condition: VG+ Size: 24 x 12 inches Price: $ 3,400.00 Description: Rare pair of eastern and western hemispheric maps, published by Melchior Tavernier. Tavernier's map provides a fine blend of contemporary cartographic information with unique details in the concentric circles outside of the geographical hemisphere. In the outermost circle, Tavernier names the 32 compass point directions in French. In the center circle, are the names of the 12 Classical Winds described by Timothenes of Rhodes (circa 282 BC) in both Latin and the original Greek spellings (see below). In the innermost circle, the 8 Winds of the Mediterranean (the modern compass points) are named (Tramontane, Greco (Grecale), Levante, Sirocco, Austral (Ostro or Mezzogiorno), Sebaca (Libeccio or Garbino), Ponent (Ponente) and Maestral (Mistral or Maestro). Cartographically, the map is a marvelous blend of information and conjecture. Tavernier treats the massive northwestern landmass to the north of California as conjecture, employing a lighter coastal outline to signify that the lands depicted are not known with certainty. California is shown as a curiously shaped island, not consistent with either the Briggs or Sanson models. A single Great Lake is depicted. In the Arctic regions, a notation describes Thomas Button's search for a Northwest Passage. In South America, there is a small Lake Parime in Guiana, and both the Amazon and Rio de la Plata flow from the large interior Lago de los Xarayes. -
View Brochure
Our specialist range of designs for first home buyers and investors Single & No Garage The Classique Range 22 independentbuilders.com.au The Classique Range 22 independentbuilders.com.au About the Caribbean Range For the owner getting in to the property market for the first time or the savvy property investor this range delivers a substantial varying offering of project homes that deliver smart designs ranging from 2-bedroom to 4-beds / 3 living areas to optimise rate of return on your investment. Contents 1-2 Caribbean Range & Why Build with IBN Single Garage Plans 3-4 Facade Selection & Antigua Design 5-6 Aruba & Bridgetown 1 Designs 7-8 Fraser & Georgetown 1 Designs 9-10 Hayman & Kensington 2 Designs 11-12 Keswick & Kingston 1 Designs 13-14 Moreton & Nevis 1 Designs 15-16 Port of Spain 2 Design & IBN Ranges No Garage Plans 17- 18 IBN Ranges & Facade Selection 19-20 Cayman 1 & 2 & Curacao Designs 21-22 Grenada & Guyana 1 & 2 Designs About the Caribbean Range 1 independentbuilders.com.au Why Build With the Independent Builders Network? Our builders are personally selected, Our house design library comprises highly experienced, qualified builders. of over 100 unique house designs. We have over 60 house façade options IBN builders are dynamic, professional to give you the ability to personalise industry leaders. your home and keep our designs fresh and with the You will deal directly with your own current trends. builder throughout your build, not just a salesman. You can customise our house plans to suit your needs and lifestyle. IBN builders support your local sporting clubs and community groups in your Our complete standard inclusions have area. -
Antipodes: in Search of the Southern Continent Is a New History of an Ancient Geography
ANTIPODES In Search of the Southern Continent AVAN JUDD STALLARD Antipodes: In Search of the Southern Continent is a new history of an ancient geography. It reassesses the evidence for why Europeans believed a massive southern continent existed, About the author and why they advocated for its Avan Judd Stallard is an discovery. When ships were equal historian, writer of fiction, and to ambitions, explorers set out to editor based in Wimbledon, find and claim Terra Australis— United Kingdom. As an said to be as large, rich and historian he is concerned with varied as all the northern lands both the messy detail of what combined. happened in the past and with Antipodes charts these how scholars “create” history. voyages—voyages both through Broad interests in philosophy, the imagination and across the psychology, biological sciences, high seas—in pursuit of the and philology are underpinned mythical Terra Australis. In doing by an abiding curiosity about so, the question is asked: how method and epistemology— could so many fail to see the how we get to knowledge and realities they encountered? And what we purport to do with how is it a mythical land held the it. Stallard sees great benefit gaze of an era famed for breaking in big picture history and the free the shackles of superstition? synthesis of existing corpuses of That Terra Australis did knowledge and is a proponent of not exist didn’t stop explorers greater consilience between the pursuing the continent to its sciences and humanities. Antarctic obsolescence, unwilling He lives with his wife, and to abandon the promise of such dog Javier. -
Global Journal of Computer Science and Technology
Online ISSN : 0975-4172 Print ISSN : 0975-4350 DOI : 10.17406/GJCST AnAmbigramicImageFileFormat TheImpactofDifferentImage MammogramImageSegmentation ComputerGenerationofFractals VOLUME21ISSUE1VERSION1.0 G lobal Journal of Computer Science and Technology: F Graphics & Vision G lobal Journal of Computer Science and Technology: F Graphics & Vision Volume 2 1 Issue 1 (Ver. 1.0) Open Association of Research Society *OREDO-RXUQDORI&RPSXWHU Global Journals Inc. Science and Technology. 2021. (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Sponsors:Open Association of Research Society $OOULJKWVUHVHUYHG Open Scientific Standards 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ RI³*OREDO-RXUQDORI&RPSXWHU6FLHQFHDQG Publisher’s Headquarters office 7HFKQRORJ\´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHV GLVWULEXWHGXQGHU³*OREDO-RXUQDORI&RPSXWHU 945th Concord Streets, 6FLHQFHDQG7HFKQRORJ\´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO USA Toll Free: +001-888-839-7392 -RXUQDORI&RPSXWHU6FLHQFHDQG7HFKQRORJ\´ USA Toll Free Fax: +001-888-839-7392 XQOHVVRWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJSKRWRFRS\ G lobal Journals Incorporated UHFRUGLQJRUDQ\LQIRUPDWLRQVWRUDJHDQG UHWULHYDOV\VWHPZLWKRXWZULWWHQSHUPLVVLRQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLVERRN -
The Dream of Zobrist to Avoid the Growth Population
THE DREAM OF ZOBRIST TO AVOID THE GROWTH POPULATION A PAPER BY BULAN HANDAYANI REG. NO. 132202061 DIPLOMA III ENGLISH STUDY PROGRAM FACULTY OF CULTURE STUDY UNIVERSITY OF NORTH SUMATERA MEDAN 2017 UNIVERSITAS SUMATERA UTARA It has been approved by Supervisor, Drs. Siamir Marulafau, M.Hum NIP. 19580517198503 003 Submitted to Faculty of Cultural Study, University of Sumatera Utara in partial fulfillment of the requirements for Diploma-III in English Study Program Approved by Head of English Diploma Study Program, Dr. Matius C.A Sembiring, M.A NIP. 19521126198112 1 001 Approved by the Diploma-III of English Study Program Faculty of Cultural Study, University of Sumatera Utara as a Paper for the Diploma-III Examination UNIVERSITAS SUMATERA UTARA Accepted by Board of Examiners in partial fulfillment of the requirements for the D-III Examination of the Diploma Study Program, Faculty of Cultural Study, University of Sumatera Utara The examination is held on January 2017 Faculty of Cultural Study, University of Sumatera Utara Dean, Dr. Budi Agustono, M.S Board of Examiners Signature 1. Dr. Matius C.A. Sembiring, M.A (Head of ESP) ……….... 2. Drs. Siamir Marulafau, M.Hum (Supervisor) ………… 3. Dr. Matius C.A. Sembiring, M.A (Reader) ………… UNIVERSITAS SUMATERA UTARA AUTHOR’S DECLARATION I am BULAN HANDAYANI, declare that I am the sole author of this paper. Except where the reference is made in the text of this paper, this paper contains no material published elsewhere or extracted in whole or in part from a paper by which I have qualified for or awarded another degree. No other person’s work has been used without due acknowledgement in the main text of this paper. -
Representation of Spatial and Temporal Variability of Daily Wind
Nat. Hazards Earth Syst. Sci., 11, 1983–2001, 2011 www.nat-hazards-earth-syst-sci.net/11/1983/2011/ Natural Hazards doi:10.5194/nhess-11-1983-2011 and Earth © Author(s) 2011. CC Attribution 3.0 License. System Sciences Representation of spatial and temporal variability of daily wind speed and of intense wind events over the Mediterranean Sea using dynamical downscaling: impact of the regional climate model configuration M. Herrmann1, S. Somot2, S. Calmanti3, C. Dubois2, and F. Sevault2 1IRD, LEGOS, UMR5566, CNRS – CNES – IRD – Universite´ de Toulouse, Toulouse, France 2CNRM/GAME, CNRS – Met´ eo-France,´ Toulouse, France 3UTMEA, ENEA, Roma, Italy Received: 26 October 2010 – Revised: 28 March 2011 – Accepted: 3 June 2011 – Published: 19 July 2011 Abstract. Atmospheric datasets coming from long term re- Second, the influence of the choice of the RCM configu- analyzes of low spatial resolution are used for different pur- ration has an influence one order of magnitude smaller than poses. Wind over the sea is, for example, a major ingre- the improvement induced by the initial downscaling. The dient of oceanic simulations. However, the shortcomings use of spectral nudging or of a smaller domain helps to im- of those datasets prevent them from being used without an prove the realism of the temporal chronology. Increasing the adequate corrective preliminary treatment. Using a regional resolution very locally (both spatially and temporally) im- climate model (RCM) to perform a dynamical downscaling proves the representation of spatial variability, in particular of those large scale reanalyzes is one of the methods used in regions strongly influenced by the complex surrounding in order to produce fields that realistically reproduce atmo- orography. -
Download Paper
ChLcp/1 LES CARTES PORTOLANES: A CRITICAL ANALYSIS OF THE TECHNICAL SECTIONS, WINDS AND DRAUGHTSMANSHIP USING THE ORIGINAL TEXT ORDER AS THE DETERMINANT. ABSTRACT The text by R J Pujades i Bataller referring to the winds and technical items within Les Cartes Portolanes1 is contained within pages 473-481 and 513-514. Here-in R J Pujades sets down his research and reasoning for the origination of the physical work entailed in producing a Portolan Chart, the process of copying and the possible scales used as a reason for the charts observed sizes. He clearly focuses upon the wind diagrams and its draughtsmanship, but, it can be clearly shown that his reasoning is based upon a false premise. The background graticule can be shown to be the arbiter of the Portolan Chart with the copying method to obtain a number of similar charts merely the use of templates. The background graticule assists in the primary positioning of the map, and certainly provides the chart scale. The text is 28 A4 pages and 21 A4 diagrams. ChLcp/1 LES CARTES PORTOLANES: A CRITICAL ANALYSIS OF THE TECHNICAL SECTIONS, WINDS AND DRAUGHTSMANSHIP USING THE ORIGINAL TEXT ORDER AS THE DETERMINANT. INTRODUCTION Within his text concerning the Carta Pisana2, R J Pujades in a very self critical manner corrected his opinion of the date for the chart. He commented he had taken the original research as correct and just accepted it. On the other hand J Alves Gaspar3 commented that after 200 years of research there was no agreement concerning the charts. But, the fundamental flaw in their basic research was that neither of them, nor one researcher had taken the charts in their logical date order and endeavoured to redraw the basic forma and information; both their background and foregrounds to establish the fundamentals.