Product datasheet Anti-non-muscle Myosin IIB/MYH10 Antibody Catalog Number: A02681-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Basic Information Product Name Anti-non-muscle Myosin IIB/MYH10 Antibody Gene Name MYH10 Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB,IHC-P,ICC/IF,FCM Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human non-muscle Myosin IIB/MYH10 (QRTGLEDPERYLFVDRAVIYNPATQADWTAKK). Purification Immunogen affinity purified. Observed MW 229KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section IHC-(P): 1:50-400 Immunocytochemistry/Immunofluorescence (ICC/IF): 1:50-400 Flow cytometry (FCM): 1-3μg/1x106 cells (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user.
Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing
Background Information This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.
Reference
Anti-non-muscle Myosin IIB/MYH10 Antibody被引用在0文献中。
暂无引用
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-non-muscle Myosin IIB/MYH10 Antibody Catalog Number: A02681-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Selected Validation Data
Figure 1. Western blot Figure 2.IHC analysis analysis of anti-MYH10 using anti-MYH10 antibody (A02681-1). The antibody (A02681-1). sample well of each lane detected in paraffin- was loaded with 50ug of embedded section of sample under reducing human mammary cancer conditions.Lane 1: Rat tissue. Biotinylated goat brain tissue lysates,Lane anti-rabbit IgG was used 2: Mouse brain tissue as secondary antibody. lysates,Lane 3: Mouse The tissue section was NIH/3T3 whole cell developed using Strepavi lysates,Lane 4: human din-Biotin-Complex SKOV-3 whole cell (SABC) (Catalog # lysates.Use rabbit anti- SA1022) with DAB as the MYH10 1:1000, probed chromogen. with a goat anti-rabbit IgG-HRP secondary antibody. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002). A specific band was detected for MYH10 at approximately 229KD. The expected band size for MYH10 is at 229KD.
Figure 3.IHC analysis Figure 4.IHC analysis using anti-MYH10 using anti-MYH10 antibody (A02681-1). antibody (A02681-1). detected in paraffin- detected in paraffin- embedded section of embedded section of rat human mammary cancer brain tissue. Biotinylated tissue. Biotinylated goat goat anti-rabbit IgG was anti-rabbit IgG was used used as secondary as secondary antibody. antibody. The tissue The tissue section was section was developed developed using Strepavi using Strepavidin-Biotin- din-Biotin-Complex Complex (SABC) (Catalog (SABC) (Catalog # # SA1022) with DAB as SA1022) with DAB as the the chromogen. chromogen.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2
Powered by TCPDF (www.tcpdf.org)