Expression, ERK Phosphorylation and WNT Signaling in EPHB6 Receptor

Total Page:16

File Type:pdf, Size:1020Kb

Load more

CANCER GENOMICS & PROTEOMICS 11 : 239-250 (2014) Modulation of Liver-Intestine Cadherin (Cadherin 17) Expression, ERK Phosphorylation and WNT Signaling in EPHB6 Receptor-expressing MDA-MB-231 Cells LOKESH BHUSHAN 1, NADIA TAVITIAN 1, DILIP DEY 1, ZOHRA TUMUR 2, CYRUS PARSA 3 and RAJ P. KANDPAL 1 Departments of 1Basic Medical Sciences, 2Dental Medicine and 3Pathology Western University of Health Science, Pomona, CA, U.S.A. Abstract. Aberrant expression of erythropoietin-producing inverse relationship between the levels of phospho-ERK and hepatocellular carcinoma cell (EPH) receptors has been the abundance of cadherin 17, β- catenin and phospho- reported in a variety of human cancer types. In addition to GSK3 β in EPHB6-expressing MDA-MB-231 cells. From modulating cell proliferation and migration, EPH receptors these data we conclude that EPHB6-mediated alterations are also involved in tumor progression. The transcriptional arise due to changes in abundance and localization of activation and silencing of EPH receptors are also cadherin 17 and activation of WNT signaling pathway. associated with tumorigenesis. However, the mechanisms Transcriptional silencing of EPHB6 in native MDA-MB-231 underlying the involvement of EPH receptors in cells and consequent effects on cadherin 17 and WNT tumorigenesis have not been completely deciphered. We have pathway may, thus, be responsible for the invasive behavior investigated and described the role of EPHB6, a kinase- of these cells. deficient receptor, in modulating the abundance of cadherin 17 and activation of other intracellular signaling proteins. Erythropoietin-producing hepatocellular carcinoma cell We previously showed that EPHB6 alters the tumor receptor B6 (EPHB6) is a member of the largest family of phenotype of breast carcinoma cells. However, the receptor tyrosine kinases (1, 2). EPHB6 and EPHA10 are the mechanisms underlying these phenotypic changes had not only kinase-deficient members of this family. These kinase- previously been investigated. Herein we demonstrated the deficient receptors are likely to transduce signals by downstream effects of EPHB6 expression on the abundance associating with other kinase-sufficient receptors (3).The of cadherin 17, mitogen-activated protein kinase (MEK2), modulation of cell attachment and cell migration by EPH extracellular signal-regulated kinase (ERK), phospho-ERK, receptors has been correlated to invasiveness of tumor cells β- catenin, phospho- glycogen synthase kinase 3 beta (4-6). The decrease in the expression of EPHB6 receptor has (GSK3 β) (ser21/9), cell morphology and actin cytoskeleton. been linked to aggressiveness and invasiveness in melanoma These comparisons were made between EPHB6-deficient (7), neuroblastoma (8) and non-small cell lung carcinoma MDA-MB-231 cells transfected with an empty pcDNA3 (9). The invasiveness of MDA-MB-231 cells has been vector and cells stably transfected with an expression attributed, in part, to loss of EPHB6 (10), and ectopic construct of EPHB6. The results indicate elevated levels of expression of EPHB6 has been shown to suppress in vitro MEK2 and phospho-ERK. While there was no change in the invasiveness of MDA-MB-231 cells (11). However, the amount of ERK, the abundance of cadherin 17, β- catenin mechanism by which EPHB6 receptor suppresses the and phospho-GSK3 β was significantly reduced in EPHB6- invasive phenotype of MDA-MB-231 cells remains unclear. transfected cells. These studies clearly demonstrate an In addition to transducing signals from the cell surface to the nucleus, EPH receptors also contribute to cell adhesion. Similarly, a superfamily of cell surface molecules, which contribute to cell adhesion and signal transduction, is Correspondence to: Raj Kandpal, Department of Basic Medical comprised of cadherins. Cadherins are transmembrane Sciences, Western University of Health Sciences, Pomona, CA 91766, U.S.A. Tel: +1 9097063520, e-mail: [email protected] receptors that mediate calcium-dependent homophilic or heterophilic adhesion between cells. Members of the Key Words: EPHB6 , cadherin 17, CDH17 , ERK, WNT, β- catenin, cadherin superfamily include classical cadherins, GSK3 β, breast carcinoma. desmosomal cadherins, protocadherins and products of 1109 -6535 /2014 239 CANCER GENOMICS & PROTEOMICS 11 : 239-250 (2014) tumor-suppressor genes such as c-rearranged during catenin and phosphorylated glycogen synthase kinase 3 beta transfection ( RET ) gene and FAT (12). Classical cadherins (GSK3 β). We discussed these molecular changes in the enable adhesion between cells, maintain cell polarity and context of morphological and cytoskeletal rearrangements in preserve tissue integrity (13). Cadherins are linked with the native and EPHB6-expressing MDA-MB-231 cells. Our actin cytoskeleton via α, β, and γ isoforms of cytoplasmic studies suggest that EPHB6 down-regulates the levels of catenins (14-16), and facilitate a variety of molecular cadherin 17, and possibly also alters its cellular localization. changes during cell development and morphogenesis (17, 18). Aberrant expression of cadherins has been associated Materials and Methods with a variety of tumors (19, 20), and oncogenic properties of some cadherins have been confirmed (21, 22). Altered Cell culture. MCF10A, MCF7, BT20, MDA-MB-435, and MDA- expression of cadherin 17, in particular, has been implicated MB-468 cells were grown as described previously (10, 11). Native in several types of cancers (21, 23), and it has also been MDA-MB-231 cells transfected with pcDNA3 vector and EPHB6- considered a useful marker for gastrointestinal carcinomas transfected MDA-MB-231 cells (11) were cultured at 37˚C/7% CO 2 in Dulbecco’s modified eagle’s medium (DMEM) supplemented (24). The association of cadherin 17 expression with caudal- with 2 mM L-glutamine, 1 mM sodium pyruvate, 100 units/ml type homeobox protein 2 (CDX2) transcription factor in PenStrep, and 10% fetal bovine serum (all Life Technologies, Grand ovarian cancer (23), and epidermal growth factor receptor Island, NY, USA). and nuclear factor kappa-light-chain-enhancer of activated B cells (NF- κB) signaling proteins in gastric cancer (21, 25) Total RNA isolation and reverse transcription polymerase chain suggests important roles of cadherin 17 in signal reaction (RT PCR). Cells were grown until 85-95% confluence in 25- transduction. Although EPH receptors and cadherins have mm cell culture flasks. RNA was isolated from various cell lines using TRI reagent (Molecular Research Center, Cincinnati, OH, been investigated extensively, detailed investigations of USA) according to the manufacturer’s protocol. The amount of RNA interactions between these two families of cell surface was determined by NanoDrop (Thermo Scientific, Waltham, MA, molecules have not been performed. Some recent USA), and its purity checked by determining the ratio of absorbance investigations, however, demonstrate modulation of signal at 260 nm and 280 nm. The RNA preparation was treated with transduction by cadherin and EPH receptor (26, 27). RNase-free DNase and 1.5 μg RNA was reverse transcribed with The altered regulation of various EPH receptors has been oligo dT using the Superscript III First-Strand RNA synthesis kit observed in a variety of cancer types (28). However, the (Life Technologies) according to the manufacturer’s protocol. The abundance of cadherin 17 ( CDH17 ) transcript was quantified by PCR downstream intracellular effector molecules have not been using 5’ACAATCGACCCACGTTTCTC3’ and characterized completely. Some EPH receptor signaling 5’ATATTGTGCACCGGGATCAT3’ oligonucleotides (Integrated events include EPHB4 dependent modulation of estrogen DNA Technologies, Inc., Coralville, IA, USA) as forward and receptor-alpha in breast cancer (29), activation of reverse primers, respectively. The reaction mixture (20 μl) containing mammalian target of rapamycin complex 1 and extracellular- 10 ng cDNA, 6.0 pmol each of forward and reverse primers, 4.0 regulated kinase pathways by EPHA2 (30), interaction of nmol dATP, dCTP, dGTP and dTTP, 0.4 units Taq DNA polymerase EPHB1 receptor with tumor-suppressor phosphatase and and 1X reaction buffer was amplified for 35 cycles of denaturation at 95˚C for 1 min, annealing at 65˚C for 1 min and extension at 72˚C tensin homolog (31), and EPHB3-mediated suppression of for 1 min. The amplified product was separated by electrophoresis metastasis via protein phosphatase 2(PP2A)/RAC/AKT on a 1% agarose gel and visualized by staining with ethidium signaling pathway in non-small cell lung carcinoma (32). bromide. PCR amplifications were also carried out with primers Morphological changes mediated by EPH have been corresponding to housekeeping gene β-actin transcript to normalize characterized by co-localization of EPHA2 and integrin α3 the amounts of cDNA templates used from various cell lines. at cell edges and protrusions in a glioblastoma cell line (33). The modulation of cell proliferation, migration and apoptosis Western blotting. MDA-MB-231 cells, stably transfected with an EPHB6 construct (MDA-MB-231-EPHB6) or an empty pcDNA3 has been attributed to specific activation of EPH receptors vector (MDA-MB-231-pCDNA), were grown in DMEM to 85-90% by their cognate ephrin ligands (34-39). Given the diversity confluence. The culture medium was aspirated and the dish washed of intracellular proteins affected by EPH receptors, it is not with 3 ml of ice-cold phosphate buffered saline (PBS). Cells were surprising that EPHB4 has been designated as both a tumor lysed by
Recommended publications
  • Type of the Paper (Article

    Type of the Paper (Article

    Table S1. Gene expression of pro-angiogenic factors in tumor lymph nodes of Ibtk+/+Eµ-myc and Ibtk+/-Eµ-myc mice. Fold p- Symbol Gene change value 0,007 Akt1 Thymoma viral proto-oncogene 1 1,8967 061 0,929 Ang Angiogenin, ribonuclease, RNase A family, 5 1,1159 481 0,000 Angpt1 Angiopoietin 1 4,3916 117 0,461 Angpt2 Angiopoietin 2 0,7478 625 0,258 Anpep Alanyl (membrane) aminopeptidase 1,1015 737 0,000 Bai1 Brain-specific angiogenesis inhibitor 1 4,0927 202 0,001 Ccl11 Chemokine (C-C motif) ligand 11 3,1381 149 0,000 Ccl2 Chemokine (C-C motif) ligand 2 2,8407 298 0,000 Cdh5 Cadherin 5 2,5849 744 0,000 Col18a1 Collagen, type XVIII, alpha 1 3,8568 388 0,003 Col4a3 Collagen, type IV, alpha 3 2,9031 327 0,000 Csf3 Colony stimulating factor 3 (granulocyte) 4,3332 258 0,693 Ctgf Connective tissue growth factor 1,0195 88 0,000 Cxcl1 Chemokine (C-X-C motif) ligand 1 2,67 21 0,067 Cxcl2 Chemokine (C-X-C motif) ligand 2 0,7507 631 0,000 Cxcl5 Chemokine (C-X-C motif) ligand 5 3,921 328 0,000 Edn1 Endothelin 1 3,9931 042 0,001 Efna1 Ephrin A1 1,6449 601 0,002 Efnb2 Ephrin B2 2,8858 042 0,000 Egf Epidermal growth factor 1,726 51 0,000 Eng Endoglin 0,2309 467 0,000 Epas1 Endothelial PAS domain protein 1 2,8421 764 0,000 Ephb4 Eph receptor B4 3,6334 035 V-erb-b2 erythroblastic leukemia viral oncogene homolog 2, 0,000 Erbb2 3,9377 neuro/glioblastoma derived oncogene homolog (avian) 024 0,000 F2 Coagulation factor II 3,8295 239 1 0,000 F3 Coagulation factor III 4,4195 293 0,002 Fgf1 Fibroblast growth factor 1 2,8198 748 0,000 Fgf2 Fibroblast growth factor
  • Eph Receptor B4 (EPHB4) Rabbit Polyclonal Antibody Product Data

    Eph Receptor B4 (EPHB4) Rabbit Polyclonal Antibody Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AP14301PU-N Eph receptor B4 (EPHB4) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: IHC, WB Recommended Dilution: ELISA: 1/1,000. Western blotting: 1/50 - 1/100. Immunohistochemistry: 1/10 - 1/50. Reactivity: Human Host: Rabbit Isotype: Ig Clonality: Polyclonal Immunogen: This antibody is generated from rabbits immunized with human recombinant EphB4 protein. Specificity: This antibody reacts to EphB4. Formulation: PBS with 0.09% (W/V) sodium azide State: Purified State: Liquid purified Ig Concentration: lot specific Purification: Prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by dialysis against PBS Conjugation: Unconjugated Storage: Store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. Stability: Shelf life: one year from despatch. Gene Name: EPH receptor B4 Database Link: Entrez Gene 2050 Human P54760 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 Eph receptor B4 (EPHB4) Rabbit Polyclonal Antibody – AP14301PU-N Background: Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins.
  • Supplementary Table 1. in Vitro Side Effect Profiling Study for LDN/OSU-0212320. Neurotransmitter Related Steroids

    Supplementary Table 1. in Vitro Side Effect Profiling Study for LDN/OSU-0212320. Neurotransmitter Related Steroids

    Supplementary Table 1. In vitro side effect profiling study for LDN/OSU-0212320. Percent Inhibition Receptor 10 µM Neurotransmitter Related Adenosine, Non-selective 7.29% Adrenergic, Alpha 1, Non-selective 24.98% Adrenergic, Alpha 2, Non-selective 27.18% Adrenergic, Beta, Non-selective -20.94% Dopamine Transporter 8.69% Dopamine, D1 (h) 8.48% Dopamine, D2s (h) 4.06% GABA A, Agonist Site -16.15% GABA A, BDZ, alpha 1 site 12.73% GABA-B 13.60% Glutamate, AMPA Site (Ionotropic) 12.06% Glutamate, Kainate Site (Ionotropic) -1.03% Glutamate, NMDA Agonist Site (Ionotropic) 0.12% Glutamate, NMDA, Glycine (Stry-insens Site) 9.84% (Ionotropic) Glycine, Strychnine-sensitive 0.99% Histamine, H1 -5.54% Histamine, H2 16.54% Histamine, H3 4.80% Melatonin, Non-selective -5.54% Muscarinic, M1 (hr) -1.88% Muscarinic, M2 (h) 0.82% Muscarinic, Non-selective, Central 29.04% Muscarinic, Non-selective, Peripheral 0.29% Nicotinic, Neuronal (-BnTx insensitive) 7.85% Norepinephrine Transporter 2.87% Opioid, Non-selective -0.09% Opioid, Orphanin, ORL1 (h) 11.55% Serotonin Transporter -3.02% Serotonin, Non-selective 26.33% Sigma, Non-Selective 10.19% Steroids Estrogen 11.16% 1 Percent Inhibition Receptor 10 µM Testosterone (cytosolic) (h) 12.50% Ion Channels Calcium Channel, Type L (Dihydropyridine Site) 43.18% Calcium Channel, Type N 4.15% Potassium Channel, ATP-Sensitive -4.05% Potassium Channel, Ca2+ Act., VI 17.80% Potassium Channel, I(Kr) (hERG) (h) -6.44% Sodium, Site 2 -0.39% Second Messengers Nitric Oxide, NOS (Neuronal-Binding) -17.09% Prostaglandins Leukotriene,
  • SU5416 Does Not Attenuate Early RV Angiogenesis in the Murine Chronic Hypoxia PH Model Grace L

    SU5416 Does Not Attenuate Early RV Angiogenesis in the Murine Chronic Hypoxia PH Model Grace L

    Peloquin et al. Respiratory Research (2019) 20:123 https://doi.org/10.1186/s12931-019-1079-x RESEARCH Open Access SU5416 does not attenuate early RV angiogenesis in the murine chronic hypoxia PH model Grace L. Peloquin1, Laura Johnston2, Mahendra Damarla2, Rachel L. Damico2, Paul M. Hassoun2 and Todd M. Kolb2* Abstract Background: Right ventricular (RV) angiogenesis has been associated with adaptive myocardial remodeling in pulmonary hypertension (PH), though molecular regulators are poorly defined. Endothelial cell VEGFR-2 is considered a “master regulator” of angiogenesis in other models, and the small molecule VEGF receptor tyrosine kinase inhibitor SU5416 is commonly used to generate PH in rodents. We hypothesized that SU5416, through direct effects on cardiac endothelial cell VEGFR-2, would attenuate RV angiogenesis in a murine model of PH. Methods: C57 BL/6 mice were exposed to chronic hypoxia (CH-PH) to generate PH and stimulate RV angiogenesis. SU5416 (20 mg/kg) or vehicle were administered at the start of the CH exposure, and weekly thereafter. Angiogenesis was measured after one week of CH-PH using a combination of unbiased stereological measurements and flow cytometry-based quantification of myocardial endothelial cell proliferation. In complementary experiments, primary cardiac endothelial cells from C57 BL/6 mice were exposed to recombinant VEGF (50 ng/mL) or grown on Matrigel in the presence of SU5416 (5 μM) or vehicle. Result: SU5416 directly inhibited VEGF-mediated ERK phosphorylation, cell proliferation, and Kdr transcription, but not Matrigel tube formation in primary murine cardiac endothelial cells in vitro. SU5416 did not inhibit CH-PH induced RV angiogenesis, endothelial cell proliferation, or RV hypertrophy in vivo, despite significantly altering the expression profile of genes involved in angiogenesis.
  • Eph Receptor B4 (EPHB4) (NM 004444) Human Mass Spec Standard Product Data

    Eph Receptor B4 (EPHB4) (NM 004444) Human Mass Spec Standard Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH308559 Eph receptor B4 (EPHB4) (NM_004444) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: EPHB4 MS Standard C13 and N15-labeled recombinant protein (NP_004435) Species: Human Expression Host: HEK293 Expression cDNA Clone RC208559 or AA Sequence: Predicted MW: 108.27 kDa Protein Sequence: >RC208559 representing NM_004444 Red=Cloning site Green=Tags(s) MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQA HWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDT VAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPET VPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLS GEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESG GREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN RAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAV LCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVC RGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGA LDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSS DPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGT
  • Original Article a RTK-Based Functional Rnai Screen Reveals Determinants of PTX-3 Expression

    Original Article a RTK-Based Functional Rnai Screen Reveals Determinants of PTX-3 Expression

    Int J Clin Exp Pathol 2013;6(4):660-668 www.ijcep.com /ISSN:1936-2625/IJCEP1301062 Original Article A RTK-based functional RNAi screen reveals determinants of PTX-3 expression Hua Liu*, Xin-Kai Qu*, Fang Yuan, Min Zhang, Wei-Yi Fang Department of Cardiology, Shanghai Chest Hospital affiliated to Shanghai JiaoTong University, Shanghai, China. *These authors contributed equally to this work. Received January 30, 2013; Accepted February 15, 2013; Epub March 15, 2013; Published April 1, 2013 Abstract: Aim: The aim of the present study was to explore the role of receptor tyrosine kinases (RTKs) in the regu- lation of expression of PTX-3, a protector in atherosclerosis. Methods: Human monocytic U937 cells were infected with a shRNA lentiviral vector library targeting human RTKs upon LPS stimuli and PTX-3 expression was determined by ELISA analysis. The involvement of downstream signaling in the regulation of PTX-3 expression was analyzed by both Western blotting and ELISA assay. Results: We found that knocking down of ERBB2/3, EPHA7, FGFR3 and RET impaired PTX-3 expression without effects on cell growth or viability. Moreover, inhibition of AKT, the downstream effector of ERBB2/3, also reduced PTX-3 expression. Furthermore, we showed that FGFR3 inhibition by anti-cancer drugs attenuated p38 activity, in turn induced a reduction of PTX-3 expression. Conclusion: Altogether, our study demonstrates the role of RTKs in the regulation of PTX-3 expression and uncovers a potential cardiotoxicity effect of RTK inhibitor treatments in cancer patients who have symptoms of atherosclerosis or are at the risk of athero- sclerosis.
  • Kinome Expression Profiling to Target New Therapeutic Avenues in Multiple Myeloma

    Kinome Expression Profiling to Target New Therapeutic Avenues in Multiple Myeloma

    Plasma Cell DIsorders SUPPLEMENTARY APPENDIX Kinome expression profiling to target new therapeutic avenues in multiple myeloma Hugues de Boussac, 1 Angélique Bruyer, 1 Michel Jourdan, 1 Anke Maes, 2 Nicolas Robert, 3 Claire Gourzones, 1 Laure Vincent, 4 Anja Seckinger, 5,6 Guillaume Cartron, 4,7,8 Dirk Hose, 5,6 Elke De Bruyne, 2 Alboukadel Kassambara, 1 Philippe Pasero 1 and Jérôme Moreaux 1,3,8 1IGH, CNRS, Université de Montpellier, Montpellier, France; 2Department of Hematology and Immunology, Myeloma Center Brussels, Vrije Universiteit Brussel, Brussels, Belgium; 3CHU Montpellier, Laboratory for Monitoring Innovative Therapies, Department of Biologi - cal Hematology, Montpellier, France; 4CHU Montpellier, Department of Clinical Hematology, Montpellier, France; 5Medizinische Klinik und Poliklinik V, Universitätsklinikum Heidelberg, Heidelberg, Germany; 6Nationales Centrum für Tumorerkrankungen, Heidelberg , Ger - many; 7Université de Montpellier, UMR CNRS 5235, Montpellier, France and 8 Université de Montpellier, UFR de Médecine, Montpel - lier, France ©2020 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol. 2018.208306 Received: October 5, 2018. Accepted: July 5, 2019. Pre-published: July 9, 2019. Correspondence: JEROME MOREAUX - [email protected] Supplementary experiment procedures Kinome Index A list of 661 genes of kinases or kinases related have been extracted from literature9, and challenged in the HM cohort for OS prognostic values The prognostic value of each of the genes was computed using maximally selected rank test from R package MaxStat. After Benjamini Hochberg multiple testing correction a list of 104 significant prognostic genes has been extracted. This second list has then been challenged for similar prognosis value in the UAMS-TT2 validation cohort.
  • An Advanced Refractory Breast Cancer Patient with Human Epidermal Growth Factor Receptor 2 Discordance: a Case Report

    An Advanced Refractory Breast Cancer Patient with Human Epidermal Growth Factor Receptor 2 Discordance: a Case Report

    7 Case Report Page 1 of 7 An advanced refractory breast cancer patient with human epidermal growth factor receptor 2 discordance: a case report Yijia Hua1#, Chunxiao Sun1#, Fan Yang1#, Yiqi Yang1, Shengnan Bao1, Xueqi Yan1, Tianyu Zeng1, Wei Li1, Yongmei Yin1,2 1Department of Oncology, The First Affiliated Hospital of Nanjing Medical University, Nanjing, China; 2Jiangsu Key Lab of Cancer Biomarkers, Prevention and Treatment, Collaborative Innovation Center for Personalized Cancer Medicine, Nanjing Medical University, Nanjing, China #These authors equally contributed to this work. Correspondence to: Yongmei Yin; Wei Li. The First Affiliated Hospital of Nanjing Medical University, 300 Guangzhou Road, Nanjing 210029, China. Email: [email protected]; [email protected]. Abstract: Breast cancer is heterogeneous at the molecular level, and receptor discordance has frequently been observed in breast cancer patients during treatment. Patients with human epidermal growth factor receptor 2 (HER2) discordance are reported to have poor survival, but guidelines for the treatment of these patients are still being explored. In this case report, we will share our experience in treating a hormone receptor-positive breast cancer patient with HER2 discordance. This patient was first diagnosed as Luminal B-like HER2+, and had previously undergone several lines of anti-HER2 therapy with limited effectiveness. Pathological reassessment of the patient’s later metastasis showed Luminal B-like HER2–. Next-generation sequencing (NGS) testing was performed on the patient’s surgical samples, and she was prescribed a therapy consisting of palbociclib and exemestane in December, 2018. This patient was subsequently followed up and her progression-free survival (PFS) has reached 16 months.
  • High Throughput Kinase Discovery, Inhibitor Screening and Specificity Analysis Using Multi-Array Technology

    High Throughput Kinase Discovery, Inhibitor Screening and Specificity Analysis Using Multi-Array Technology

    High Throughput Kinase Discovery, Inhibitor Screening and Specificity Analysis using Multi-Array Technology Nisar Pampori, Pankaj Oberoi, Ryan Swenerton, Ilia Davydov, Stefanie Nelson, Hans A. Biebuyck, John H. Kenten, and Jacob N. Wohlstadter TM TM A division of Meso Scale DiagnosticsTM, LLC. High Throughput Kinase Discovery, Inhibitor Screening and Specificity Analysis using Multi-Array Technology Abstract We developed a high-throughput system for biological discovery and compound screening. A systematic and deterministic approach allowed us to categorize and quantify functional aspects of our library of 22,000 mammalian proteins (based on Unigene) coded by 50,000 individual full- length cDNA clones. Our methodology combined MSD's proprietary Multi-ArrayTM detection technology with high-throughput cell-free production, labeling, immobilization and purification of proteins. Here we report on several approaches we used to identify and characterize proteins with tyrosine kinase activity. First, we screened a set of 20,000 clones (14,000 unique Unigenes) for proteins with tyrosine kinase activity using a screening assay that simultaneously measured auto- phosphorylation and phosphorylation of a consensus tyrosine kinase substrate. The screen recovered known tyrosine kinases, previously unidentified kinases and, under low stringency conditions, proteins that recruited kinases. Second, we selected a redacted set of clones on the basis of homology to known kinases and demonstrated that we could identify ~ 70% of the expected tyrosine kinases in this redacted set. Third, we used MSD Multi-Array technology to test, in parallel, the specificity of 21 of these well-characterized kinases for a panel of known kinase inhibitors. Finally, we carried out a focused screen of 2,000 compounds for inhibitors of two of the identified kinases.
  • EPHB4 Kinase–Inactivating Mutations Cause Autosomal Dominant Lymphatic-Related Hydrops Fetalis

    EPHB4 kinase–inactivating mutations cause autosomal dominant lymphatic-related hydrops fetalis Silvia Martin-Almedina, … , Taija Makinen, Pia Ostergaard J Clin Invest. 2016;126(8):3080-3088. https://doi.org/10.1172/JCI85794. Research Article Genetics Hydrops fetalis describes fluid accumulation in at least 2 fetal compartments, including abdominal cavities, pleura, and pericardium, or in body tissue. The majority of hydrops fetalis cases are nonimmune conditions that present with generalized edema of the fetus, and approximately 15% of these nonimmune cases result from a lymphatic abnormality. Here, we have identified an autosomal dominant, inherited form of lymphatic-related (nonimmune) hydrops fetalis (LRHF). Independent exome sequencing projects on 2 families with a history of in utero and neonatal deaths associated with nonimmune hydrops fetalis uncovered 2 heterozygous missense variants in the gene encoding Eph receptor B4 (EPHB4). Biochemical analysis determined that the mutant EPHB4 proteins are devoid of tyrosine kinase activity, indicating that loss of EPHB4 signaling contributes to LRHF pathogenesis. Further, inactivation of Ephb4 in lymphatic endothelial cells of developing mouse embryos led to defective lymphovenous valve formation and consequent subcutaneous edema. Together, these findings identify EPHB4 as a critical regulator of early lymphatic vascular development and demonstrate that mutations in the gene can cause an autosomal dominant form of LRHF that is associated with a high mortality rate. Find the latest version: https://jci.me/85794/pdf RESEARCH ARTICLE The Journal of Clinical Investigation EPHB4 kinase–inactivating mutations cause autosomal dominant lymphatic-related hydrops fetalis Silvia Martin-Almedina,1 Ines Martinez-Corral,2 Rita Holdhus,3 Andres Vicente,4 Elisavet Fotiou,1 Shin Lin,5,6 Kjell Petersen,7 Michael A.
  • Tyrosine Phosphoproteomics of Patient-Derived Xenografts Reveals Ephrin Type-B Receptor 4 Tyrosine Kinase As a Therapeutic Target in Pancreatic Cancer

    cancers Article Tyrosine Phosphoproteomics of Patient-Derived Xenografts Reveals Ephrin Type-B Receptor 4 Tyrosine Kinase as a Therapeutic Target in Pancreatic Cancer Santosh Renuse 1,2 , Vijay S. Madamsetty 3 , Dong-Gi Mun 1, Anil K. Madugundu 1,4,5, Smrita Singh 1,4,5 , Savita Udainiya 1,6, Kiran K. Mangalaparthi 1,4,7, Min-Sik Kim 8,9, Ren Liu 10, S. Ram Kumar 11, Valery Krasnoperov 12, Mark Truty 13, Rondell P. Graham 1, Parkash S. Gill 10, Debabrata Mukhopadhyay 3,* and Akhilesh Pandey 1,2,5,6,* 1 Department of Laboratory Medicine and Pathology, Mayo Clinic, Rochester, MN 55905, USA; [email protected] (S.R.); [email protected] (D.-G.M.); [email protected] (A.K.M.); [email protected] (S.S.); [email protected] (S.U.); [email protected] (K.K.M.); [email protected] (R.P.G.) 2 Center for Individualized Medicine, Mayo Clinic, Rochester, MN 55905, USA 3 Department of Biochemistry and Molecular Biology, Mayo Clinic College of Medicine and Science, Jacksonville, FL 32224, USA; [email protected] 4 Institute of Bioinformatics, International Technology Park, Bangalore 560066, Karnataka, India 5 Manipal Academy of Higher Education (MAHE), Manipal 576104, Karnataka, India Citation: Renuse, S.; Madamsetty, 6 Center for Molecular Medicine, NIMHANS, Bangalore 560027, Karnataka, India 7 V.S.; Mun, D.-G.; Madugundu, A.K.; Amrita School of Biotechnology, Amrita Vishwa Vidyapeetham University, Kollam 69025, Kerala, India 8 Singh, S.; Udainiya, S.; McKusick-Nathans Institute of Genetic Medicine, Johns Hopkins University School of Medicine, Mangalaparthi, K.K.; Kim, M.-S.; Liu, Baltimore, MD 21205, USA; [email protected] 9 Department of Biological Chemistry, Johns Hopkins University School of Medicine, R.; Kumar, S.R.; et al.
  • Probe Set ID Gene Symbol Gene Name Refseq Transcript ID Chrom . Loc. 1007 S at DDR1 Discoidin Domain Receptor Family, Member

    Probe Set ID Gene Symbol Gene Name Refseq Transcript ID Chrom . Loc. 1007 S at DDR1 Discoidin Domain Receptor Family, Member

    Supplementary Table 2 : List of the 435 kinases well characterized on the Affymetrix's GeneChip U133 Plus 2.0 from the kinome list of Manning et al. Probe Set ID Gene Symbol Gene Name RefSeq Transcript ID Chrom . Loc. 1007_s_at DDR1 discoidin domain receptor family, member 1 NM_001954 6p21.3 1552395_at TSSK3 testis-specific serine kinase 3 NM_052841 1p35-p34 1552504_a_at BRSK1 BR serine/threonine kinase 1 NM_032430 19q13.4 1552519_at ACVR1C activin A receptor, type IC NM_145259 2q24.1 1552578_a_at MYO3B myosin IIIB NM_138995 2q31.1-q31.2 1553114_a_at PTK6 PTK6 protein tyrosine kinase 6 NM_005975 20q13.3 1554112_a_at ULK2 unc-51-like kinase 2 (C. elegans) NM_014683 17p11.2 1555310_a_at PAK6 p21(CDKN1A)-activated kinase 6 NM_020168 15q14 1555935_s_at HUNK hormonally upregulated Neu-associated kinase NM_014586 21q22.1 1556043_a_at TTN Titin NM_003319 2q31 1556340_at MAPK12 Mitogen-activated protein kinase 12 NM_002969 22q13.33 1557073_s_at TTBK2 Tau tubulin kinase 2 NM_173500 15q15.2 1557103_a_at LMTK3 lemur tyrosine kinase 3 XM_055866 19q13.32 1557170_at NEK8 NIMA (never in mitosis gene a)- related kinase 8 NM_178170 17q11.1 1557316_at STK24 Serine/threonine kinase 24 (STE20 homolog, yeast) NM_001032296 13q31.2-q32.3 1557675_at RAF1 V-raf-1 murine leukemia viral oncogene homolog 1 NM_002880 3p25 1558556_at CAMK1 Calcium/calmodulin-dependent protein kinase I NM_003656 3p25.3 1559394_a_at ROR1 Receptor tyrosine kinase-like orphan receptor 1 NM_005012 1p32-p31 1561190_at CDKL3 cyclin-dependent kinase-like 3 NM_016508 5q31 1562031_at JAK2 Janus