DOCSLIB.ORG

Supp Tables S1-S7.Pdf

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text

Load more

Table S1. Full gene list of mRNAs present in embryonic axons. Affy ID [E](raw) Gene Title Description 1389956_a_at 16250.9 Transcribed locus, moderately similar to XP_001103956.1 albumin 1375340_at 12365.09 mt-Nd2 Transcribed locus, strongly similar to NP_570949.2 specific protease 48 [Mus musculus] 1375651_at 12307.65 mt-Nd1 Transcribed locus, moderately similar to XP_001082071.1 similar to NADH-ubiquinone oxidoreductase chain 1 (NADH dehydrogenase subunit 1) 1388159_at 10121.99 mt-Co3///mt-CytbCDK110 mRNA 1375107_at 7114.216 mt-Co3///mt-Co2Transcribed locus, strongly similar to XP_001090177.1 DNA-directed RNA polymerase III 39 kDa polypeptide F isoform 2 1384548_at 5516.235 Rpl32 Ribosomal protein L32 1370242_at 5243.519 Rps23 Ribosomal protein S23 1375219_a_at 4444.669 LOC688473///Rps2///RGD1559516Ribosomal protein S2 1387890_at 4144.663 Rps29 Ribosomal protein S29 1370213_at 3975.827 Ybx1 Y box protein 1 1388481_at 3947.455 Rps28///LOC684733Similar to 40S ribosomal protein S28 1367565_a_at 3885.406 Fth1 ferritin, heavy polypeptide 1 1377114_at 3718.382 Transcribed locusEST239154 Normalized rat heart, Bento Soares Rattus sp. cDNA clone RHECZ07 3' end, . 1386852_x_at 3672.111 Ubb polyubiquitin 1370274_at 3638.481 Ubb polyubiquitin 1370866_at 3572.591 Rpl41 Ribosomal protein L41 1370886_a_at 3420.229 Klc1 Kinesin light chain 1 1371245_a_at 3390.706 LOC100134871///MGC72973///LOC689064Beta-globin 1398852_at 3328.41 Rps21 Transcribed locus, strongly similar to XP_001088137.1 similar to ribosomal protein S21 1375517_at 3309.746 Trp53inp2 Tumor protein p53 inducible nuclear protein 2 1367610_at 3135.942 Rpl19 ribosomal protein L19 1388372_at 3109.76 Rpl35 Ribosomal protein L35 1398789_at 3050.09 Rpl37 ribosomal protein L37 1388131_at 2768.213 Tubb2b tubulin, beta 2b 1367634_at 2767.515 Rpl31 ribosomal protein L31 1368028_at 2666.312 Prph peripherin 1 1375632_at 2666.195 LOC681502///LOC690833///LOC685963///LOC681221///LOC689671///Rpl38///LOC682793///LOC690468///LOC688248Similar to 60S ribosomal protein L38 1367597_at 2643.222 Rps8 ribosomal protein S8 1370751_at 2578.567 LOC257642 rRNA promoter binding protein 1371301_at 2494.81 Ehd2///Rpl9 Transcribed locus, strongly similar to XP_001106717.1 similar to ribosomal protein L9 1367583_at 2461.133 Tpt1 tumor protein, translationally-controlled 1 1398240_at 2419.898 Hspa8 heat shock protein 8 1371504_at 2393.89 LOC687187///LOC679823///LOC689401///Rpl37aRGD1561181 (predicted) 1388244_s_at 2381.342 Rpsa Ribosomal protein SA 1371344_at 2380.377 Rpl27a Similar to 60S ribosomal protein L27a (predicted) 1367845_at 2375.861 Nefm neurofilament 3, medium 1373470_at 2336.033 Ctnnb1 Catenin (cadherin associated protein), beta 1 1388303_at 2335.272 Rpl26 Transcribed locus, strongly similar to XP_001084401.1 similar to 60S ribosomal protein L26 1388296_at 2333.345 Rps18 Transcribed locus, strongly similar to XP_001090113.1 similar to ribosomal protein S18 isoform 1 1370041_at 2291.266 Stmn2 stathmin-like 2 1398324_at 2230.196 Rpl18a Similar to 60S ribosomal protein L18a 1397579_x_at 2206.636 Apc2 Transcribed locus 1375108_at 2109.767 mt-Nd3 Transcribed locus, weakly similar to NP_149938.1 dehydrogenase subunit 3 [Trichosurus vulpecula] 1398350_at 2086.374 Basp1 Brain abundant, membrane attached signal protein 1 1371297_at 2080.111 Rpl7a Transcribed locus, moderately similar to XP_001100792.1 similar to 60S ribosomal protein L7a 1398839_at 2077.773 Txn1 thioredoxin 1 1367588_a_at 1991.457 Rpl13a hexokinase 3 1367640_at 1977.742 Rps12 ribosomal protein S12 1398767_at 1938.803 Ubc ubiquitin C 1388670_at 1882.397 Kif1a Kinesin family member 1A 1372092_at 1844.9 Trak2 Trafficking protein, kinesin binding 2 1388370_at 1837.503 Ccni Cyclin I (predicted) 1371307_at 1792.599 Rplp1 Ribosomal protein, large, P1 1388110_at 1782.332 RGD1566344///Eef1a1eukaryotic translation elongation factor 1 alpha 1 1369410_at 1775.741 golgi SNAP receptor complex member 1 1371327_a_at 1766.795 LOC295810///Actg1Transcribed locus, weakly similar to XP_001112288.1 similar to actin-related protein M2 isoform 2 1398754_at 1754.881 Uba52 ubiquitin A-52 residue ribosomal protein fusion product 1 1367630_at 1741.39 Rps11 ribosomal protein S11 1370281_at 1738.508 Fabp5 fatty acid binding protein 5, epidermal 1398761_at 1729.438 Rpl5 ribosomal protein L5 1373187_at 1721.014 Transcribed locusAT005533 rat brain Rattus norvegicus cDNA clone 9-Ad-2, . 1372444_at 1718.955 Transcribed locusTranscribed locus 1367645_at 1718.048 Rps17 ribosomal protein S17 1367596_at 1716.044 Rps26 ribosomal protein S26 1398751_at 1699.74 LOC497813///Rps7ribosomal protein S7 1375181_at 1695.964 LOC499782///Rpl12_predicted///LOC685320///LOC688511Similar to 60S ribosomal protein L12 1373718_at 1671.245 Tubb2a Tubulin, beta 2b 1367930_at 1667.677 Gap43 growth associated protein 43 1398835_at 1646.764 Actb actin, beta 1370284_at 1639.192 Atp5e ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit 1398774_at 1603.367 Rpl30 ribosomal protein L30 1383162_at 1591.269 EST203097 Normalized rat embryo, Bento Soares Rattus sp. cDNA clone REMBB18 3' end, . 1398764_at 1578.66 Rpl21///LOC690841///LOC679852ribosomal protein L21 1371398_at 1542.106 LOC684567 Similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 1388391_at 1529.423 Ndufa1 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (predicted) 1367623_at 1402.694 Rpl18 ribosomal protein L18 1371412_a_at 1402.368 Nrep Neuronal regeneration related protein 1367578_at 1369.736 Prdx2 peroxiredoxin 2 1388311_at 1349.386 Mrfap1 Morf4 family associated protein 1 1371313_at 1334.855 Rpl23a Transcribed locus, moderately similar to XP_001084658.1 similar to 60S ribosomal protein L23a 1371308_at 1331.875 Rps4x Ribosomal protein S4, X-linked 1367584_at 1329.952 Anxa2 annexin A2 1374426_at 1315.558 Uqcrb///LOC687741///Uqcrb_predictedUbiquinol-cytochrome c reductase binding protein (predicted) 1371321_at 1303.729 Cox6b1 Transcribed locus, strongly similar to XP_001085256.1 similar to Cytochrome c oxidase subunit VIb isoform 1 (COX VIb-1) 1377237_at 1296.7 Transcribed locusTranscribed locus 1367639_a_at 1289.388 Rps2 ribosomal protein S2 1398830_at 1288.607 Rpl28 ribosomal protein L28 1367573_at 1287.976 Rps6 ribosomal protein S6 1383161_a_at 1283.44 EST203097 Normalized rat embryo, Bento Soares Rattus sp. cDNA clone REMBB18 3' end, . 1398760_at 1277.456 Rpl35a ribosomal protein L35a 1370253_at 1275.607 Rpl22 Ribosomal protein L22 1387862_at 1273.194 Ywhaq Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide 1367717_at 1267.794 Rps27 ribosomal protein S27 1398762_at 1255.179 Sdcbp syndecan binding protein 1371701_at 1224.88 Ndufb9 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9 (predicted) 1370190_at 1217.543 H3f3b H3 histone, family 3B 1373977_at 1210.174 Kif5c Transcribed locus 1398885_at 1200.141 Rpl23 Ribosomal protein L23 1371318_at 1186.451 Rps16 Ribosomal protein S16 1370176_at 1183.621 Trak2 Trafficking protein, kinesin binding 2 1368211_at 1163.103 Rps14 ribosomal protein S14 1367561_at 1158.125 Rpl27 ribosomal protein L27 1367764_at 1148.912 Ccng1 cyclin G1 1388314_at 1147.412 Hmgn1 High mobility group nucleosomal binding domain 1 1398245_at 1146.822 Sncg synuclein, gamma 1382467_at 1145.741 Bex1///Bex2 Similar to brain expressed X-linked protein 2 1386921_at 1144.776 Cpe carboxypeptidase E 1367757_at 1142.137 Cox6c cytochrome c oxidase, subunit VIc 1375422_at 1128.148 UI-R-AB1-yt-f-08-0-UI.s1 UI-R-AB1 Rattus norvegicus cDNA clone UI-R-AB1-yt-f-08-0-UI 3', . 1370861_at 1124.296 Cox6a1 Cytochrome c oxidase, subunit VIa, polypeptide 1 1367606_at 1120.192 Rps3a ribosomal protein S3a 1398872_at 1111.558 LOC684988///Rps13Ribosomal protein S13 1388076_at 1097.674 Serbp1 Serpine1 mRNA binding protein 1 1371417_at 1073.285 Uqcrq Low molecular mass ubiquinone-binding protein 1375246_at 1055.75 LOC685117///Ccdc72Hypothetical protein LOC679747 1371377_at 1054.204 Rps19 Ribosomal protein S19 1371337_at 1051.047 Cox7a2l Cytochrome c oxidase subunit VIIa polypeptide 2 like (predicted) 1368097_a_at 1047.002 Rtn1 reticulon 1 1372446_at 1045.351 Ppp1r2 Protein phosphatase 1, regulatory (inhibitor) subunit 2 1398598_at 1041.098 Dst Dystonin (predicted) 1376629_at 1028.462 Transcribed locus 1388113_at 1012.096 Cox8a Cytochrome c oxidase, subunit VIIIa 1399106_at 994.0443 Myeov2 Similar to CG17059-PA 1388449_at 984.7638 Eef1b2 Eukaryotic translation elongation factor 1 beta 2 (predicted) 1367629_at 983.0917 Cox7a2 cytochrome c oxidase, subunit VIIa 2 1398315_at 972.7006 Rpl15 Ribosomal protein L15 1371300_at 972.161 Rpl3 Ribosomal protein L3 1398626_s_at 951.0516 Actr2 ARP2 actin-related protein 2 homolog (yeast) 1398753_at 941.5374 Akr1a1 aldo-keto reductase family 1, member A1 1367460_at 930.4448 Gdi2 GDP dissociation inhibitor 2 1370238_at 927.5332 Usmg5 Upregulated during skeletal muscle growth 5 1367620_at 927.1371 Atp5g3 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) isoform 3 1379605_at 922.0049 Transcribed locusTranscribed locus 1367607_at 909.5524 Cox4i1 cytochrome c oxidase subunit IV isoform 1 1371295_at 906.2705 Rps20 Ribosomal protein S20 1386890_at 904.2583 S100a10 S100 calcium binding protein A10 (calpactin) 1380172_at 901.6611 Kif5c Kinesin family member 5C (predicted) 1388310_at 900.7708 Eif1 Suppressor of initiator codon mutations, related sequence 1 (S. cerevisiae) (predicted) 1398917_at 894.7798 Rpl7 Transcribed locus, moderately similar to XP_001118306.1 similar to 60S ribosomal protein
Recommended publications
  • C8cc08685k1.Pdf

    C8cc08685k1.Pdf

    Electronic Supplementary Material (ESI) for ChemComm. This journal is © The Royal Society of Chemistry 2018 Supporting Information Minimalist Linkers Suitable for Irreversible Inhibitors in Simultaneous Proteome Profiling, Live-Cell Imaging and Drug Screening Cuiping Guo,Yu Chang, Xin Wang, Chengqian Zhang, Piliang Hao*, Ke Ding and Zhengqiu Li* School of Pharmacy, Jinan University, Guangzhou, China 510632 *Corresponding author ([email protected]) 1. General Information All chemicals were purchased from commercial vendors and used without further purification, unless indicated otherwise. All reactions requiring anhydrous conditions were carried out under argon or nitrogen atmosphere using oven-dried glassware. AR-grade solvents were used for all reactions. Reaction progress was monitored by TLC on pre-coated silica plates (Merck 60 F254 nm, 0.25 µm) and spots were visualized by UV, iodine or other suitable stains. Flash column chromatography was carried out using silica gel (Qingdao Ocean). All NMR spectra (1H-NMR, 13C-NMR) were recorded on Bruker 300 MHz/400 MHz NMR spectrometers. Chemical shifts were reported in parts per million (ppm) referenced with respect to appropriate internal standards or residual solvent peaks (CDCl3 = 7.26 ppm, DMSO-d6 = 2.50 ppm). The following abbreviations were used in reporting spectra, br s (broad singlet), s (singlet), d (doublet), t (triplet), q (quartet), m (multiplet), dd (doublet of doublets). Mass spectra were obtained on Agilent LC-ESI-MS system. All analytical HPLC were carried out on Agilent system. Water with 0.1% TFA and acetonitrile with 0.1% TFA were used as eluents and the flow rate was 0.5 mL/min.
  • The Rise and Fall of the Bovine Corpus Luteum

    The Rise and Fall of the Bovine Corpus Luteum

    University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Spring 5-6-2017 The Rise and Fall of the Bovine Corpus Luteum Heather Talbott University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Part of the Biochemistry Commons, Molecular Biology Commons, and the Obstetrics and Gynecology Commons Recommended Citation Talbott, Heather, "The Rise and Fall of the Bovine Corpus Luteum" (2017). Theses & Dissertations. 207. https://digitalcommons.unmc.edu/etd/207 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. THE RISE AND FALL OF THE BOVINE CORPUS LUTEUM by Heather Talbott A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Biochemistry and Molecular Biology Graduate Program Under the Supervision of Professor John S. Davis University of Nebraska Medical Center Omaha, Nebraska May, 2017 Supervisory Committee: Carol A. Casey, Ph.D. Andrea S. Cupp, Ph.D. Parmender P. Mehta, Ph.D. Justin L. Mott, Ph.D. i ACKNOWLEDGEMENTS This dissertation was supported by the Agriculture and Food Research Initiative from the USDA National Institute of Food and Agriculture (NIFA) Pre-doctoral award; University of Nebraska Medical Center Graduate Student Assistantship; University of Nebraska Medical Center Exceptional Incoming Graduate Student Award; the VA Nebraska-Western Iowa Health Care System Department of Veterans Affairs; and The Olson Center for Women’s Health, Department of Obstetrics and Gynecology, Nebraska Medical Center.
  • Reprogramming of Trna Modifications Controls the Oxidative Stress Response by Codon-Biased Translation of Proteins

    Reprogramming of Trna Modifications Controls the Oxidative Stress Response by Codon-Biased Translation of Proteins

    Reprogramming of tRNA modifications controls the oxidative stress response by codon-biased translation of proteins The MIT Faculty has made this article openly available. Please share how this access benefits you. Your story matters. Citation Chan, Clement T.Y. et al. “Reprogramming of tRNA Modifications Controls the Oxidative Stress Response by Codon-biased Translation of Proteins.” Nature Communications 3 (2012): 937. As Published http://dx.doi.org/10.1038/ncomms1938 Publisher Nature Publishing Group Version Author's final manuscript Citable link http://hdl.handle.net/1721.1/76775 Terms of Use Article is made available in accordance with the publisher's policy and may be subject to US copyright law. Please refer to the publisher's site for terms of use. Reprogramming of tRNA modifications controls the oxidative stress response by codon-biased translation of proteins Clement T.Y. Chan,1,2 Yan Ling Joy Pang,1 Wenjun Deng,1 I. Ramesh Babu,1 Madhu Dyavaiah,3 Thomas J. Begley3 and Peter C. Dedon1,4* 1Department of Biological Engineering, 2Department of Chemistry and 4Center for Environmental Health Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139; 3College of Nanoscale Science and Engineering, University at Albany, SUNY, Albany, NY 12203 * Corresponding author: PCD, Department of Biological Engineering, NE47-277, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139; tel 617-253-8017; fax 617-324-7554; email [email protected] 2 ABSTRACT Selective translation of survival proteins is an important facet of cellular stress response. We recently demonstrated that this translational control involves a stress-specific reprogramming of modified ribonucleosides in tRNA.
  • Identification of Candidate Substrates of the Leucine Rich Repeat Kinase 2 by Mass Spectrometry

    Identification of Candidate Substrates of the Leucine Rich Repeat Kinase 2 by Mass Spectrometry

    Identification of candidate substrates of the leucine rich repeat kinase 2 by mass spectrometry- based phosphoproteomics William Carl Edelman A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Washington 2016 Reading Committee: Judit Villén, Chair Leo Pallanck Deborah Nickerson Program Authorized to Offer Degree: Department of Genome Sciences 2 © Copyright 2016 William Carl Edelman 3 University of Washington Abstract Identification of candidate substrates of the leucine rich repeat kinase 2 by mass spectrometry-based phosphoproteomics William Carl Edelman Chair of the Supervisory Committee: Assistant Professor, Judit Villén Department of Genome Sciences Mutations in the kinase domain of the leucine rich repeat kinase (LRRK2) have been implicated in heritable forms of Parkinson’s disease (PD). Specifically, a glycine to serine mutation (G2019S) has demonstrated hyperactive autophosphorylation, neuronal toxicity, and locomotor deficits in the fruit fly Drosophila melanogaster— all of which are related to its pathogenicity in PD. My dissertation focuses on identifying novel substrates of LRRK2 through analysis of proteome-wide changes in protein abundance as well as identifying changes in phosphorylation of proteins in vitro and in the in vivo fruit fly model. Using mass spectrometry, I provide quantitative information on thousands of proteins and phosphorylation sites. In vitro kinase assays on peptides derived from fly heads or a neuroblastoma cell line provide evidence for direct substrates of LRRK2, while the in vivo experiment in flies expressing LRRK2 identifies both direct and indirect phosphorylation substrates of the kinase. Herein, I present evidence for novel, LRRK2-mediated phosphorylation sites in the Drosophila melanogaster and the neuroblastoma models of PD.
  • Allele-Specific Expression of Ribosomal Protein Genes in Interspecific Hybrid Catfish

    Allele-Specific Expression of Ribosomal Protein Genes in Interspecific Hybrid Catfish

    Allele-specific Expression of Ribosomal Protein Genes in Interspecific Hybrid Catfish by Ailu Chen A dissertation submitted to the Graduate Faculty of Auburn University in partial fulfillment of the requirements for the Degree of Doctor of Philosophy Auburn, Alabama August 1, 2015 Keywords: catfish, interspecific hybrids, allele-specific expression, ribosomal protein Copyright 2015 by Ailu Chen Approved by Zhanjiang Liu, Chair, Professor, School of Fisheries, Aquaculture and Aquatic Sciences Nannan Liu, Professor, Entomology and Plant Pathology Eric Peatman, Associate Professor, School of Fisheries, Aquaculture and Aquatic Sciences Aaron M. Rashotte, Associate Professor, Biological Sciences Abstract Interspecific hybridization results in a vast reservoir of allelic variations, which may potentially contribute to phenotypical enhancement in the hybrids. Whether the allelic variations are related to the downstream phenotypic differences of interspecific hybrid is still an open question. The recently developed genome-wide allele-specific approaches that harness high- throughput sequencing technology allow direct quantification of allelic variations and gene expression patterns. In this work, I investigated allele-specific expression (ASE) pattern using RNA-Seq datasets generated from interspecific catfish hybrids. The objective of the study is to determine the ASE genes and pathways in which they are involved. Specifically, my study investigated ASE-SNPs, ASE-genes, parent-of-origins of ASE allele and how ASE would possibly contribute to heterosis. My data showed that ASE was operating in the interspecific catfish system. Of the 66,251 and 177,841 SNPs identified from the datasets of the liver and gill, 5,420 (8.2%) and 13,390 (7.5%) SNPs were identified as significant ASE-SNPs, respectively.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Supplementary Materials

    Supplementary Materials

    1 Supplementary Materials: Supplemental Figure 1. Gene expression profiles of kidneys in the Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice. (A) A heat map of microarray data show the genes that significantly changed up to 2 fold compared between Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice (N=4 mice per group; p<0.05). Data show in log2 (sample/wild-type). 2 Supplemental Figure 2. Sting signaling is essential for immuno-phenotypes of the Fcgr2b-/-lupus mice. (A-C) Flow cytometry analysis of splenocytes isolated from wild-type, Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice at the age of 6-7 months (N= 13-14 per group). Data shown in the percentage of (A) CD4+ ICOS+ cells, (B) B220+ I-Ab+ cells and (C) CD138+ cells. Data show as mean ± SEM (*p < 0.05, **p<0.01 and ***p<0.001). 3 Supplemental Figure 3. Phenotypes of Sting activated dendritic cells. (A) Representative of western blot analysis from immunoprecipitation with Sting of Fcgr2b-/- mice (N= 4). The band was shown in STING protein of activated BMDC with DMXAA at 0, 3 and 6 hr. and phosphorylation of STING at Ser357. (B) Mass spectra of phosphorylation of STING at Ser357 of activated BMDC from Fcgr2b-/- mice after stimulated with DMXAA for 3 hour and followed by immunoprecipitation with STING. (C) Sting-activated BMDC were co-cultured with LYN inhibitor PP2 and analyzed by flow cytometry, which showed the mean fluorescence intensity (MFI) of IAb expressing DC (N = 3 mice per group). 4 Supplemental Table 1. Lists of up and down of regulated proteins Accession No.
  • In Vivo Dual RNA-Seq Analysis Reveals the Basis for Differential Tissue Tropism of Clinical Isolates of Streptococcus Pneumoniae

    In Vivo Dual RNA-Seq Analysis Reveals the Basis for Differential Tissue Tropism of Clinical Isolates of Streptococcus Pneumoniae

    In Vivo Dual RNA-Seq Analysis Reveals the Basis for Differential Tissue Tropism of Clinical Isolates of Streptococcus pneumoniae Vikrant Minhas,1,4 Rieza Aprianto,2,4 Lauren J. McAllister,1 Hui Wang,1 Shannon C. David,1 Kimberley T. McLean,1 Iain Comerford,3 Shaun R. McColl,3 James C. Paton,1,5,6,* Jan-Willem Veening,2,5 and Claudia Trappetti,1,5 Supplementary Information Supplementary Table 1. Pneumococcal differential gene expression in the lungs 6 h post-infection, 9-47-Ear vs 9-47M. Genes with fold change (FC) greater than 2 and p < 0.05 are shown. FC values highlighted in blue = upregulated in 9-47-Ear, while values highlighted in red = upregulated in 9- 47M. Locus tag in 9-47- Product padj FC Ear Sp947_chr_00844 Sialidase B 3.08E-10 313.9807 Sp947_chr_02077 hypothetical protein 4.46E-10 306.9412 Sp947_chr_00842 Sodium/glucose cotransporter 2.22E-09 243.4822 Sp947_chr_00841 N-acetylneuraminate lyase 4.53E-09 227.7963 scyllo-inositol 2-dehydrogenase Sp947_chr_00845 (NAD(+)) 4.36E-09 221.051 Sp947_chr_00848 hypothetical protein 1.19E-08 202.7867 V-type sodium ATPase catalytic subunit Sp947_chr_00853 A 1.29E-06 100.5411 Sp947_chr_00846 Beta-glucoside kinase 3.42E-06 98.18951 Sp947_chr_00855 V-type sodium ATPase subunit D 8.34E-06 85.94879 Sp947_chr_00851 V-type sodium ATPase subunit C 2.50E-05 72.46612 Sp947_chr_00843 hypothetical protein 2.17E-05 65.97758 Sp947_chr_00839 HTH-type transcriptional regulator RpiR 3.09E-05 61.28171 Sp947_chr_00854 V-type sodium ATPase subunit B 1.32E-06 50.86992 Sp947_chr_00120 hypothetical protein 3.00E-04
  • Modulating Hallmarks of Cholangiocarcinoma

    Modulating Hallmarks of Cholangiocarcinoma

    University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Fall 12-14-2018 Modulating Hallmarks of Cholangiocarcinoma Cody Wehrkamp University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Part of the Molecular Biology Commons Recommended Citation Wehrkamp, Cody, "Modulating Hallmarks of Cholangiocarcinoma" (2018). Theses & Dissertations. 337. https://digitalcommons.unmc.edu/etd/337 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. MODULATING HALLMARKS OF CHOLANGIOCARCINOMA by Cody J. Wehrkamp A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Biochemistry and Molecular Biology Graduate Program Under the Supervision of Professor Justin L. Mott University of Nebraska Medical Center Omaha, Nebraska November 2018 Supervisory Committee: Kaustubh Datta, Ph.D. Melissa Teoh‐Fitzgerald, Ph.D. Richard G. MacDonald, Ph.D. Acknowledgements This endeavor has led to scientific as well as personal growth for me. I am indebted to many for their knowledge, influence, and support along the way. To my mentor, Dr. Justin L. Mott, you have been an incomparable teacher and invaluable guide. You upheld for me the concept that science is intrepid, even when the experience is trying. Through my training, and now here at the end, I can say that it has been an honor to be your protégé. When you have shaped your future graduates to be and do great, I will be privileged to say that I was your first one.
  • Serum Albumin OS=Homo Sapiens

    Serum Albumin OS=Homo Sapiens

    Protein Name Cluster of Glial fibrillary acidic protein OS=Homo sapiens GN=GFAP PE=1 SV=1 (P14136) Serum albumin OS=Homo sapiens GN=ALB PE=1 SV=2 Cluster of Isoform 3 of Plectin OS=Homo sapiens GN=PLEC (Q15149-3) Cluster of Hemoglobin subunit beta OS=Homo sapiens GN=HBB PE=1 SV=2 (P68871) Vimentin OS=Homo sapiens GN=VIM PE=1 SV=4 Cluster of Tubulin beta-3 chain OS=Homo sapiens GN=TUBB3 PE=1 SV=2 (Q13509) Cluster of Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 (P60709) Cluster of Tubulin alpha-1B chain OS=Homo sapiens GN=TUBA1B PE=1 SV=1 (P68363) Cluster of Isoform 2 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 (Q13813-2) Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 Cluster of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 (Q01082) Cluster of Pyruvate kinase isozymes M1/M2 OS=Homo sapiens GN=PKM PE=1 SV=4 (P14618) Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens GN=DYNC1H1 PE=1 SV=5 Cluster of ATPase, Na+/K+ transporting, alpha 2 (+) polypeptide OS=Homo sapiens GN=ATP1A2 PE=3 SV=1 (B1AKY9) Fibrinogen beta chain OS=Homo sapiens GN=FGB PE=1 SV=2 Fibrinogen alpha chain OS=Homo sapiens GN=FGA PE=1 SV=2 Dihydropyrimidinase-related protein 2 OS=Homo sapiens GN=DPYSL2 PE=1 SV=1 Cluster of Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 (P12814) 60 kDa heat shock protein, mitochondrial OS=Homo
  • Elabscience.Com ® E-Mail:Techsupport@Elabscience.Com Elabscience Elabscience Biotechnology Inc

    Elabscience.Com ® E-Mail:[email protected] Elabscience Elabscience Biotechnology Inc

    Tel:240-252-7368(USA) Fax:240-252-7376(USA) www.elabscience.com ® E-mail:[email protected] Elabscience Elabscience Biotechnology Inc. RPL7 Polyclonal Antibody Catalog No. E-AB-32805 Reactivity H,M,R Storage Store at -20℃. Avoid freeze / thaw cycles. Host Rabbit Applications WB,IHC-p,ELISA Isotype IgG Note: Centrifuge before opening to ensure complete recovery of vial contents. Images Immunogen Information Immunogen Synthesized peptide derived from the C-terminal region of human Ribosomal Protein L7 Swissprot P18124 Synonyms RPL7,60S ribosomal protein L7 Western Blot analysis of 293 cells Product Information using RPL7 Polyclonal Antibody at Calculated MW 29kDa dilution of 1:2000. Observed MW 32kDa Buffer PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4 Purify Affinity purification Dilution WB 1:500-1:2000, IHC 1:100-1:300, ELISA 1:10000 Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30P family of ribosomal proteins. It contains an N-terminal basic region-leucine zipper (BZIP)-like domain and the RNP consensus submotif RNP2. In vitro the BZIP-like domain mediates homodimerization and stable binding to DNA and RNA, with a preference for 28S rRNA and mRNA. The protein can inhibit cell- free translation of mRNAs, suggesting that it plays a regulatory role in the translation apparatus.
  • ARP36414 P050) Data Sheet

    ARP36414 P050) Data Sheet

    SNRNP200 antibody - N-terminal region (ARP36414_P050) Data Sheet Product Number ARP36414_P050 Product Name SNRNP200 antibody - N-terminal region (ARP36414_P050) Size 50ug Gene Symbol SNRNP200 Alias Symbols ASCC3L1; BRR2; FLJ11521; HELIC2; RP33; U5-200KD Nucleotide Accession# NM_014014 Protein Size (# AA) 2136 amino acids Molecular Weight 244kDa Product Format Lyophilized powder NCBI Gene Id 23020 Host Rabbit Clonality Polyclonal Official Gene Full Name Small nuclear ribonucleoprotein 200kDa (U5) This is a rabbit polyclonal antibody against SNRNP200. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR Pre-mRNA splicing is catalyzed by the spliceosome, a complex of specialized RNA and protein subunits that removes introns from a transcribed pre-mRNA segment. The spliceosome consists of small nuclear RNA proteins (snRNPs) U1, U2, U4, U5 and U6, together with approximately 80 conserved proteins. U5 snRNP Description of Target contains nine specific proteins. This gene encodes one of the U5 snRNP-specific proteins. This protein belongs to the DEXH-box family of putative RNA helicases. It is a core component of U4/U6-U5 snRNPs and appears to catalyze an ATP-dependent unwinding of U4/U6 RNA duplices.