The Iron-Sulfur Scaffold Protein HCF101 Unveils The Complexity of Organellar Evolution in SAR, Haptista and Cryptista
Jan Pyrih Charles University Faculty of Science: Univerzita Karlova Prirodovedecka fakulta Vojtech Žárský Charles University Faculty of Science: Univerzita Karlova Prirodovedecka fakulta Jastin D. Fellow University of Georgia Christopher Grosche University of Marburg: Philipps-Universitat Marburg Dorota Wloga Nencki Institute of Experimental Biology: Instytut Biologii Doswiadczalnej im M Nenckiego Polskiej Akademii Nauk Boris Striepen University of Georgia Uwe G. Maier University of Marburg: Philipps-Universitat Marburg Jan Tachezy ( [email protected] ) Charles University: Univerzita Karlova https://orcid.org/0000-0001-6976-8446
Research article
Keywords: HCF101, Ind1, iron-sulfur cluster, mitochondrion, plastid, evolution
Posted Date: December 15th, 2020
DOI: https://doi.org/10.21203/rs.3.rs-126638/v1
License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License
Version of Record: A version of this preprint was published on March 19th, 2021. See the published version at https://doi.org/10.1186/s12862-021-01777-x. 1 The iron-sulfur scaffold protein HCF101 unveils the complexity of organellar evolution
2 in SAR, Haptista and Cryptista
3
4 Jan Pyriha, Vojtěch Žárskýa, Justin D. Fellowsb, Christopher Groschec,d, Dorota Wlogae, Boris
5 Striepenb, Uwe G. Maierc,d, Jan Tachezya,f.
6
7 a Department of Parasitology, Faculty of Science, Charles University, BIOCEV, Průmyslová
8 595, 252 50 Vestec, Czech Republic.
9 b Department of Cellular Biology, University of Georgia, Athens, Georgia, USA.
10 c Laboratory for Cell Biology, Philipps University Marburg, Karl-von-Frisch-Str. 8, 35032,
11 Marburg, Germany.
12 d LOEWE Center for Synthetic Microbiology (Synmikro), Hans-Meerwein-Str. 6, 35032
13 Marburg, Germany
14 e Laboratory of Cytoskeleton and Cilia Biology, Nencki Institute of Experimental Biology of
15 Polish Academy of Sciences, 3 Pasteur Street, 02-093 Warsaw, Poland.
16
17
18 f To whom correspondence should be addressed: Jan Tachezy, Department of Parasitology,
19 Faculty of Science, Charles University BIOCEV, Průmyslová 595, 252 50 Vestec, Czech
20 Republic.
21 E-mail: [email protected]
1
22 Abstract
23 Background: Nbp35-like proteins (Nbp35, Cfd1, HCF101, Ind1, and AbpC) are P-loop
24 NTPases that serve as components of iron-sulfur cluster (FeS) assembly machineries. In
25 eukaryotes, Ind1 is present in mitochondria, and its function is associated with the assembly
26 of FeS clusters in subunits of respiratory Complex I, Nbp35 and Cfd1 are the components of
27 the cytosolic FeS assembly (CIA) pathway, and HCF101 is involved in FeS assembly of
28 photosystem I in plastids of plants (chHCF101). The AbpC protein operates in Bacteria and
29 Archaea. To date, the cellular distribution of these proteins is considered to be highly
30 conserved with only a few exceptions.
31 Results: We searched for the genes of all members of the Nbp35-like protein family and
32 analyzed their targeting sequences. Nbp35 and Cfd1 were predicted to reside in the cytoplasm
33 with some exceptions of Nbp35 localization to the mitochondria; Ind1was found in the
34 mitochondria, and HCF101 was predicted to reside in plastids (chHCF101) of all
35 photosynthetically active eukaryotes. Surprisingly, we found a second HCF101 paralog in all
36 members of Cryptista, Haptista, and SAR that was predicted to predominantly target
37 mitochondria (mHCF101), whereas Ind1 appeared to be absent in these organisms. We also
38 identified a few exceptions, as apicomplexans possess mHCF101 predicted to localize in the
39 cytosol and Nbp35 in the mitochondria. Our predictions were experimentally confirmed in
40 selected representatives of Apicomplexa (Toxoplasma gondii), Stramenopila (Phaeodactylum
41 tricornutum, Thalassiosira pseudonana), and Ciliophora (Tetrahymena thermophila) by
42 tagging proteins with an transgenic reporter. Phylogenetic analysis suggested that chHCF101
43 and mHCF101 evolved from a common ancestral HCF101 independently of the Nbp35/Cfd1
44 and Ind1 proteins. Interestingly, phylogenetic analysis supports rather a lateral gene transfer
45 of ancestral HCF101 from bacteria than its acquisition being associated with either α-
46 proteobacterial or cyanobacterial endosymbionts.
2
47 Conclusion: Our searches for Nbp35-like proteins across eukaryotic lineages revealed that
48 SAR, Haptista, and Cryptista possess mitochondrial HCF-101. Because plastid localization of
49 HCF101 was only known thus far, the discovery of its mitochondrial paralog explains
50 confusion regarding the presence of HCF101 in organisms that possibly lost secondary
51 plastids (e.g., ciliates, Cryptosporidium) or possess reduced nonphotosynthetic plastids
52 (apicomplexans).
53
54 Keywords
55 HCF101, Ind1, iron-sulfur cluster, mitochondrion, plastid, evolution
56
57 Background
58 Iron-sulfur (FeS) cluster assembly pathways are essential for all three domains of life:
59 Bacteria, Archaea, and Eukarya. In eukaryotes, there are three main pathways, which are
60 localized in distinct cellular compartments: mitochondria, plastids, and the cytosol. The
61 organellar pathways were acquired through endosymbiosis of proteobacteria and
62 cyanobacteria that evolved into mitochondria and plastids, respectively [1, 2]. The
63 mitochondrial FeS cluster assembly (ISC) machinery operates in nearly all forms of
64 mitochondria including anaerobic hydrogenosomes [3] and highly reduced mitosomes [4].
65 The pathway in plastids is called the sulfur utilization factor (SUF) system, which is present
66 in primary [5] as well as secondary plastids [6–8]. The ISC machinery is functionally linked
67 to the third system, the cytosolic FeS cluster assembly (CIA) machinery. Phylogenetic
68 analysis suggested that the CIA pathway was present in the last eukaryotic common ancestor
69 (LECA) and that its components are predominantly of bacterial origin [9, 10]. There are few
3
70 known exceptions to the highly conserved setup of FeS assembly machineries, and all these
71 exceptions concern protists adapted to anaerobic or microaerobic conditions with modified
72 mitochondria. Archamoebae replaced the ISC pathway with two components of a nitrogen-
73 fixing (NIF) machinery that were acquired by lateral gene transfer (LGT) from ɛ-
74 proteobacteria[11]. The NIF system operates in the cytosol of Entamoeba histolytica or in the
75 cytosol and hydrogenosomes of Mastigamoeba balamuthi [12]. Similarly, the breviate
76 Pygsuia biforma apparently replaced the ISC system with an archeal SUF system [13, 14].
77 Finally, three SUF components (SufC, SufB, and fused protein SufDSU) of bacterial origin
78 were found in the cytosol of the oxymonad Monocercomonoides sp., which lost its
79 mitochondria [15].
80 The only proteins that are common to the CIA, ISC, and SUF pathways are P-loop
81 NTPases with the ParA domain: Nbp35/Cfd1, Ind1, and high chlorophyll fluorescence 101
82 (HCF101), respectively (hereafter Nbp35-like proteins). In CIA, Nbp35/Cfd proteins serve in
83 the initial phase of FeS assembly as a [4Fe-4S] scaffold using sulfur and iron that are exported
84 from mitochondria [16]. The FeS cluster is then transferred via Nar1 and the
85 Cia1/Cia2/MMS19 targeting complex to apo-proteins. Ind1 serves as a scaffold in later stages
86 of FeS assembly to deliver [4Fe-4S] clusters specifically to the apo-subunits of mitochondrial
87 respiratory complex I, and thus, the presence of Ind1 closely matches the complex I
88 distribution [17]. Its necessity for complex I maturation underlines the presence of Ind1 in
89 hydrogenosomes, in which complex I is reduced to only two FeS subunits [14, 18]. HCF101
90 was shown to transport [4Fe-4S] clusters to photosystem I subunits and heterodimeric
91 ferredoxin-thioredoxin reductase complexes in plastids of Arabidopsis thaliana [19, 20].
92 It is believed that the cannonical distribution of FeS cluster assembly machineries and
93 thus that of machinery-specific Nbp35-like proteins is highly conserved in eukaryotes,
94 including protists with primary or complex plastids. The latter organelles evolved in
4
95 eukaryotic hosts from eukaryotic symbionts with green (Euglenozoa and
96 Chlorarachniophyceae) or red (Stramenopila, Alveolata, Haptophytes, and Cryptophytes)
97 plastids [21, 22]. These complex plastids are surrounded by three or more membranes and
98 characterized by the presence of a periplastidal compartment, the extremely reduced cytosol
99 of the endosymbiont and, in the case of cryptophytes and chlorarachniophytes, of a remnant
100 nucleus (nucleomorph). Interestingly, the presence of nucleomorph, which is likely dependent
101 on activities of FeS proteins, correlates with the presence of the endosymbiotic CIA,
102 including Nbp35 that is retained in the periplastidial compartment [7] in addition to CIA in
103 the host cytosol. This curious finding further exemplifies the conserved topology of Nbp35
104 and other CIA components.
105 The localization of HCF101 has not been experimentally studied in most eukaryotic
106 lineages. Moreover, because HCF101 is essential for photosystem I and consequently
107 photosynthesis, it could be particularly interesting to investigate its presence and cellular
108 localization in organisms that possess non-photosynthesizing plastids such as the apicoplast in
109 apicomplexans. The genes for HCF101 have been noticed in several apicomplexan genomes
110 such as Toxoplasma gondii and Plasmodium falciparum, and their possible localization in the
111 apicoplast has been suggested [23, 24]. However, these HCF101 homologs lack the targeting
112 signals one would expect for proteins localized to the apicoplast [23, 24]. Even more puzzling
113 is the identification of HCF101 in the genome of Cryptosporidium parvum, which has lost its
114 plastid [24]. Therefore, we decided to search for Nbp35-like genes across eukaryotic genomes
115 and to predict their cellular localization based on their organellar targeting presequences. In
116 selected protists, we verified the localization of Nbp35-like proteins experimentally. The most
117 surprising result is the identification of the mitochondrial form of HCF101in protists with
118 complex plastids.
119
5
120 Results
121 Distribution of Nbp35-like proteins in eukaryotes
122 We searched for Nbp35, Cfd1, Ind1, and HCF101 in genomes and transcriptomes across the
123 main eukaryotic lineages, and for each protein we predicted its putative cellular localization
124 (Table 1, Table S1). While Nbp35 was found ubiquitously in all lineages as reported
125 previously [10], Cfd1 was generally present in Ophistokonta, Amoebozoa, Cryptista,
126 Glaucophypta, and Excavata (Metamonada, Discoba) supergroups but absent in the remaining
127 groups of Archaeplastida, SAR, and Haptista. Diplomonads such as Giardia intestinalis and
128 Spironucleus salmonicida represent the only exception within excavates as they lack Cfd1
129 (Table 1)[25]. Nbp35 homologs were not identified in only four organisms, most likely due to
130 the incompleteness of the available sequencing data (Table 1). Curiously, in Mastigamoeba
131 balamuthi, there are three Nbp35 paralogs, of which one was predicted to possess N-terminal
132 hydrogenosomal targeting presequences (Table 1). Furthermore, we also predicted a
133 mitochondrial targeting signal for Nbp35 proteins in Apicomplexa and Chromerids.
134 As expected, Ind1 was predicted to be present in the mitochondria of Ophistokonta,
135 Amoebozoa, Archaeplastida, and Excavata groups except for organisms that lack complex I
136 (Table 1). Interestingly, we did not identify Ind1 in any organism with complex plastids.
137 While this is not surprising for apicomplexans that lack complex I such as Toxoplasma gondii
138 and Plasmodium falciparum and evolutionarily related chromerids Chromera vellia and
139 Vitrella brassica, Ind1 was also absent in all other lineages of the SAR, Haptista and
140 Cryptista groups, despite the presence of genes for the FeS subunits of Complex I in these
141 organisms [17].
142 Finally, we searched for genes encoding the HCF101 protein. This protein could be
143 easily distinguished from other Nbp35-like proteins based on the presence of two extra
6
144 domains, an N-terminal FeS assembly P domain (FSCA, previously domain of unknown
145 function DUF59) and a C-terminal DUF971 [20]. Surprisingly, the distribution of HCF101
146 was limited not only to lineages harboring primary plastids (Viridiplantae, Rhodophyta,
147 Glaucophyta) or complex plastids of red (SAR, Cryptophyta, Haptophyta) or green
148 (chlororachniophytes, euglenids and some dinoflagellates) origin, but the gene was also
149 present in the remaining nonphotosynthetic members of SAR, Haptista, and Cryptista. Every
150 photosynthetically active eukaryote possesses a gene that encodes HCF101 with either an N-
151 terminal primary plastid targeting signal (Archaeplastida) or a bipartite signal, which targets
152 the protein to complex plastids (chHCF101) (Fig. 1). Strikingly, in all members of SAR,
153 Haptista, and Cryptista (formerly referred to as Chromalveolata), we found a second HCF101
154 paralog, with predicted mitochondrial localization (mHCF101). The only unexpected
155 variation of this cellular localization was found in Alveolata. In apicomplexans that harbor a
156 nonphotosynthetic apicoplast, HCF101 was predicted to reside in the cytosol, while Nbp35
157 possesses an N-terminal extension, which may target the protein to the mitochondria. The
158 same cytosolic distribution of HCF101 and possibly mitochondrial Nbp35 we predicted also
159 for evolutionarily related Chromerids that possess photosynthetic plastids, and therefore also
160 chHCF101. In other Alveolates, such as Perkinsus marinus, that possesses cryptic
161 nonphotosynthetic plastids and in ciliates that lack plastids, we predicted standard cytosolic
162 localization for Nbp35 and mitochondrial localization of putative mHCF101, whereas
163 chHCF101 is absent. The distribution of Nbp35, mHCF101, and chHCF101 in dinoflagellates
164 is likely similar to that in Stramenopila and Rhizaria; however, predictions of protein
165 localization in some dinoflagellates had low confidence.
166
167 Experimental localization of selected Nbp35-like proteins
7
168 The identification of mHCF101 and the unexpected localization predicted for Nbp35 in
169 apicomplexans prompted us to select three protists that are amenable for cell transformation
170 and investigate the localization of Nbp35-like proteins using protein tagging. First, we tested
171 genes from the diatoms Phaeodactylum tricornutum and Thalassiosira pseudonana that
172 possess secondary plastids. P. tricornutum cells were transformed to express homologous
173 eGFP-tagged mHCF101, chHCF101, and Nbp35 as well as heterologous genes from T.
174 pseudonana. Fluorescence microscopy revealed that both mHCF101 proteins labeled
175 structures corresponding to mitochondria as indicated by colabeling with MitoTracker. These
176 structures were clearly distinct from plastids, in which we observed labeling with chHCF101
177 (Fig. 2). As expected, Nbp35 labeling corresponded to the cytosol. Next, we tested
178 localization of putative mHCF101 and Nbp35 in the ciliate Tetrahymena thermophila, which
179 lacks plastids. HA-tagged mHCF101 appeared in numerous round mitochondria organized in
180 longitudinal arrays that were again also labeled with MitoTracker (Fig. 3). Nbp35 appeared as
181 a diffuse signal within the cell corresponding to the cytosol. Finally, we expressed HCF101
182 and Nbp35 in T. gondii (Fig. 3). This organism lacks mitochondrial Ind1 and possesses a
183 reduced nonphotosynthetic plastid, the apicoplast. Nbp35 clearly colocalized in tubular
184 structures with the mitochondrial marker F1-ATPase. Putative HCF101 appeared within the
185 cell as a cytosolic protein. No localization of HCF101 to the apicoplast was observed using
186 the antibody against plastidial CPN60. These experimental data confirmed the predicted
187 localization of mHCF101 in diatoms and the ciliate and mitochondrial localization of Nbp35
188 in Toxoplasma.
189
190 Phylogeny of HCF101
8
191 To learn about the evolutionary history of chHCF101 and mHCF101 and to obtain further
192 support for predictions of their cellular localization, we performed phylogenetic analysis. In
193 the first step, we were interested in the relationship between HCF101 and other members of
194 the Nbp35-like protein family. We analyzed a large dataset of 8440 amino acid sequences
195 including mHCF101, chHCF101, Nbp35, Cfd1, and Ind1 as well as prokaryotic homologs of
196 ApbC proteins with the ParA domain. We expected that chHCF101 originated from a
197 cyanobacterial endosymbiont that evolved to a plastid, similar to Ind1, which was acquired
198 with the α-proteobacterial ancestor of mitochondria [9]. However, chHCF101 and mHCF101
199 formed a common clade with various lineages of bacteria that appeared at the base of the
200 HCF101 subtree, including proteobacteria, the PVC group, and Bacteroidetes. There is no
201 obvious support for the cyanobacterial ancestry of HCF101 and thus for endosymbiotic gene
202 transfer (EGT), although the overall resolution of the tree is low. As expected, Ind1 formed a
203 clade with the majority of eukaryotic sequences and α-proteobacteria at a basal position that is
204 consistent with EGT origin of the protein (Fig. 4). Interestingly, Ind1 of kinetoplastids
205 appeared at a separate position in the Ind1/α-proteobacterial subtree than the rest of the
206 eukaryotic sequences, suggesting its specific phylogenetic history. It is possible that hand in
207 hand with the presence of an atypical Complex I in kinetoplastids, Ind1 protein also
208 underwent dramatic evolutional reshaping [26]. Finally, Nbp35/Cfd1 clustered together with
209 various eubacterial and archaebacterial sequences as observed previously [9, 10].
210 Because the statistical support was moderate throughout the phylogenetic tree, we also
211 performed prediction of protein domains with a focus on the presence of the HCF101 marker
212 domains FSCA and DUF951 to obtain more information to estimate a possible HCF101
213 origin (Additional file 1, Table S2). This analysis showed that the majority of bacterial
214 sequences have a FSCA-ParA structure (3420), or contain the ParA domain only (2762), and
215 there are also various other domain combinations. Of note, 18 sequences obtained from
9
216 proteobacteria, PVC group members, and Bacteroidetes clustered with eukaryotic HCF101
217 and shared the characteristic FSCA-ParA-DUF951 domains structure of HCF101.
218 In the second step, we focused on more detailed phylogenetic analysis of chHCF101
219 and mHCF101 (Fig. 5). The phylogenetic tree revealed that chHCF101 and mHCF101 are
220 paralogs that evolved from a common HCF101 ancestor, possibly by duplication events.
221 ChHCF101 and mHCF101 formed two monophyletic groups albeit with low support. The
222 chHCF101 tree is by-and-large consistent with the current concept of eukaryotic phylogeny.
223 There are three well-supported clades of Archaeplastida with primary plastids for
224 Viridiplantae, Glaucophyta, and Rhodophyta together with protists that harbor corresponding
225 secondary plastids. Thus, chHCF101 in Viridiplantae clusters together with Euglenozoa that
226 possesses secondary plastids of green origin. ChHCF101 of Rhodophyta is at the base of
227 Stramenopila, Chromerida, Cryptophytes, and Haptophytes, which contain Rhodophyta-
228 derived red secondary plastids. However, there are some exceptions. Some dinoflagellates
229 such Alexandrium and Symbiodinium that have secondary plastids of red origin yet seem to
230 possess chHCF101 related to the green plastid lineage. Conversely, although
231 chlorarachniophytes acquired secondary plastids of green ancestry, their chHCF101 clustered
232 within orthologs of red plastids. Interestingly, this single gene phylogeny supports the close
233 relationship between plastids of Haptophytes and Cryptophytes. Branching of the main groups
234 was further supported by a comparison of six conserved amino acid residues (AA 461-466
235 according to Arabidopsis thaliana) in the DUF971 domain. The common motive for
236 Viridiplantae, Euglenozoa and Dinophyta was D[K,R,Q,T][G,S]Ax[G,S], chHCF101 of
237 Glaucophyta, Rhodophyta, Stramenophila, and Chromerida possess the highly conserved
238 motif C[R,S]CAxC, and Chlorarachniophyta, Cryptophytes and Haptophytes possess
239 CRSP[A,T,S]N.
10
240 The observed branching order of mHCF101 is poorly supported (Fig. 5); nevertheless,
241 separation of the chHCF101 and mHCF101 groups provides a tool for our prediction of cell
242 localization, as several sequences included in Table 1 were incomplete and thus preclude
243 confident predictions based on the identification of N-terminal targeting motifs. For example,
244 in dinoflagellates, we found complete sequences of two HCF101 paralogs only for A.
245 tamarense. Sequences of all other dinoflagellates were incomplete; however, phylogenetic
246 analysis clearly separated group mHCF101 including A. tamarense HCF101 with
247 mitochondrial targeting presequence and formed a subtree of dinoflagellates with high
248 statistical support. The other HCF101 dinoflagellate paralogs appeared within the chloroplast
249 group. We were particularly interested in the origin of HCF101 of apicomplexans that lack N-
250 terminal targeting sequences, and in T. gondii, we demonstrated its cytosolic localization.
251 HCF101 proteins of T. gondii and other related apicomplexans including Cystoisospora suis
252 clearly appeared within the mHCF101 group, at the base of a well-supported subtree of
253 apicomplexans, chromerids, and dinoflagellates. Therefore, apicomplexan HCF101s seem not
254 to be derived from plastids (apicoplast), contrary to previous assumptions [23, 24]. Another
255 interesting question was the origin of HCF101 in ciliates which lack plastids. Phylogeny of
256 HCF101 showed that HCF101 in ciliates is not related to chHCF101 but clustered within
257 mHCF101s.
258 Several members of the PVC group such as Kiritimatiellaceae bacterium and
259 Verrucomicrobia bacterium are at the base of the HCF101tree. Although this tree is poorly
260 resolved, it is noteworthy that the bacterial conserved motif of DUF971
261 C[A,R,N,H]CA[A,L]C is similar to the motifs in chHCF101 as well as most mHCF101 (Fig.
262 5). Interestingly, the verrucomicrobial HCF101 clustered with the orthologs of the
263 glaucophyta group, which is considered to possess the most primitive plastid. Thus, based on
264 the phylogeny analysis, the presence of bacterial HCF101-like proteins with specific domain
11
265 structures, and the conserved DUF971 motif, the subset of PVC group members represents
266 the best candidates for the origin of eukaryotic HCF101.
267
268 Discussion
269 In this work, we screened Nbp35-like homologs across eukaryotes and predicted their cellular
270 localization. This analysis discovered the existence of a mitochondrial HCF101 homolog that
271 is common to all tested members of SAR, Haptophytes, and Cryptophytes. Localization of
272 mHCF101 was predicted based on the identification of N-terminal mitochondrial targeting
273 sequences and supported by a phylogenetic analysis that separated mHCF101 from the
274 chHCF101 paralog. Moreover, mitochondrial localization of mHCF101 was experimentally
275 verified for mHCF101 encoded in the genomes of two diatoms (T. pseudonana, P.
276 tricornutum) and the ciliate T. thermophila. Curiously, but consistently with the in silico
277 predictions, we found mHCF101 in the cytosol of T. gondii, while Nbp35 was localized to the
278 mitochondrion. Evolutionary analysis of HCF101 proteins and their specific distribution
279 suggested that HCF101 was gained potentionally via LGT from bacteria of the PVC lineage
280 either by a common ancestor of Archaeplastida to serve in the chloroplast (plastid-first
281 hypothesis) or by a common ancestor of Archeaplastida SAR, Haptista and Cryptista to serve
282 first in mitochondria.
283 The presence of mHCF101 is coincident with the absence of Ind1, which is involved
284 in the maturation of complex I FeS subunits. This specific distribution suggests that
285 mHCF101 may act as a functional homolog of Ind1. Both proteins share conserved
286 nucleotide-binding domain characteristics of the Mrp (MetG-related protein)/Nbp35 subclass
287 of ParA P-loop NTPases [27], which includes the conserved CxxC motif. This motif is
288 essential to bind the transient [4Fe4S] cluster that is transferred to the target FeS proteins [20,
12
289 28]. It is evident that chHCF101 in chloroplasts and Ind1in mitochondria transfers labile FeS
290 clusters to different targets. However, both proteins are able to deliver the labile cluster to the
291 S. cerevisiae model [4Fe4S] acceptor protein, isopropyl malate isomerase, in vitro [20,
292 28].Thus, the function of HCF101 proteins and Ind1 might be interchangeable. The major
293 difference between HCF101 and Ind1 is the presence of N- and C-terminal domains in the
294 former protein. The FSCA domain is present at the N-terminus of HCF101 (just after the N-
295 terminal targeting sequence) and in a few other eukaryotic proteins involved in FeS assembly
296 such as Cia2 of CIA machinery [29] and asymmetric leaves1/2 enhancer7 (AE7), which is a
297 Cia2 homolog in A. thaliana [30]. The FSCA domain in combination with ParA was
298 identified in a large number of bacterial and some archeal FeS cluster carrier proteins (this
299 work). Importantly, in Staphylococcus aureus, the FSCA domain is composed solely of the
300 SufT subunit of SUF machinery and acts as an auxiliary FeS cluster maturation factor [31].
301 Therefore, the fusion of FSCA and Nbp35-like protein might be beneficial for more efficient
302 transfer of FeS centers to target proteins. The function of C-terminal DUF971 of HCF101 is
303 currently elusive. However, we noticed that DUF971 present at the C-termini of most
304 chHCF101 and mHCF101 proteins contains a highly conserved CxCxxC motif that may have
305 the capacity to bind divalent metals [32]. Further studies are required to clarify a function of
306 mHCF101 and DUF971 in particular.
307 The evolutionary journey taken by mHCF101 to arrive in the mitochondria of SAR,
308 Haptista, and Cryptista is a puzzle, but multiple evolutionary scenarios could potentially
309 explain the origin of this gene. Our phylogenetic and domain analysis of HCF101 proteins
310 together with their distribution in eukaryotes suggested that ancestral HCF101 was not
311 acquired via EGT from cyanobacteria that possess simple ParA domain-containing proteins
312 without FCSA and DUF971. Rather, it was gained via LGT from bacteria of the PVC lineage
313 that possessed an HCF101-like protein of the FSCA-ParA-DUF971 domain structure and
13
314 cluster (although with weak support) with chHCF101 of glaucophytes. The key question is
315 whether HCF101 was first targeted to chloroplasts or to mitochondria. Considering the
316 chloroplast-first scenario (Fig. 6A), we can hypothesize that HCF101 was acquired by a
317 common ancestor of Archaeplastida, targeted to chloroplasts, and evolved independently in
318 glaucophytes, green algae/land plants, and red algae. Then, HCF101 was transferred via
319 secondary endosymbiosis of green plastids to Euglenozoa and by transfer of red plastids to a
320 putative common ancestor of SAR, Haptista and Cryptista. In this hypothetical ancestor, the
321 HCF101 was duplicated, and one of the paralogs was targeted to mitochondria (mHCF101),
322 where it functionally replaced Ind1. Alternatively (mitochondria-first), we can hypothesize
323 that HCF101 was first present in the mitochondria of a common ancestor of Archeplastida,
324 SAR, Haptistae and Cryptista [33, 34] and functioned in parallel with Ind1 (Fig. 6B). HCF101
325 in Archaeplastida was then retargeted from mitochondria to the plastid (chHCF101), while
326 Ind1 was lost at least twice independently in a common ancestor of Cryptophytes and of
327 Haptophytes plus SAR.
328 The proposed plastid-first scenario for HCF101 evolution is consistent with the
329 “chromalveolate” hypothesis that is based on the idea that all lineages with a red secondary
330 plastid are monophyletic [35]. In support of this hypothesis, it has been proposed that all
331 members of chromalveolates share unique SELMA (symbiont-derived ERAD-like machinery)
332 to target proteins into secondary plastids via the endoplasmic reticulum [36, 37]. Furthermore,
333 remnant plastids of some seemingly aplastidal-like members of chromalveolates such as
334 Perkinsus marinus were discovered [38]. In ciliates that lack plastid, several proteins of algal
335 origin were previously identified including a MinD-like hypothetical protein in T.
336 thermophila [39]. In our analysis, we identify this protein as mHCF101, and its mitochondrial
337 localization was experimentally confirmed in Tetrahymena. Thus, in addition to SELMA, the
14
338 presence of mHCF101 in mitochondria together with the absence of Ind1 is another feature
339 that is common to chromalveolates.
340 However, an increasing number of phylogenetic studies favor multiple secondary (or
341 serial) endosymbioses in these lineages [33, 40][41]. They refute the chromalveolate
342 hypothesis by placing Cryptophytes within Archeplastida and through the discovery of novel
343 groups such as katablepharids (Cryptista) [42] and centrohelids (Haptista), in which so far no
344 evolutionary traces of plastids have been found. Thus, their lack of plastids could reflect the
345 primary absence of plastids rather than secondary loss [33]. Interestingly, even these lineages
346 contain mHCF101 instead of Ind1, supporting the idea of multiple independent losses of Ind1.
347 Tertiary endosymbiosis is another facet that complicates tracing HCF101 evolution,
348 particularly in dinoflagellates. Our phylogenetic analyses revealed that chHCF101 of Karenia
349 clustered within the Haptophytes subtree. This is fully consistent with previous inferences that
350 Karenia and related genera of dinoflagellates with the fucoxanthin-containing plastids [43,
351 44] lost the ancestral secondary plastid, which was replaced by a new plastid from
352 Haptophytes via tertiary endosymbiosis [45–48]. Interestingly, another group of
353 dinoflagellates including Alexandrium and Symbiodinium with peridin-containing plastids of
354 red origin appeared at the base of Viridiplantae in the chHCF101 subtree, which may suggest
355 experience with a green plastid before acquiring the red plastid, as suggested in several
356 studies [40, 48–50]. In contrast to chHCF101 phylogenies, the monophyletic origin of
357 mHCF101 was observed for both groups of dinoflagellates regardless of the
358 multiendosymbiotic events, which clearly reflected different evolutionary histories for
359 mHCF101 and chHCF101.
360 Another example of the complex evolution of chHCF101 is found in
361 Chlorarachniophytes, which possess a complex plastid of green origin [51]. Perplexingly, the
15
362 phylogeny of chHCF101 suggested a red origin for this protein, which clustered with
363 Haptophytes and Cryptophytes and shared the unique CRSP[T,A,S]N motif of DUF971.
364 However, this finding may not be so surprising. Previous analyses of the chlorarachniophyte
365 Bigellowiella natans classified several genes of likely algal origin to be potentially acquired
366 from the red lineage [52]. These ‘red’ genes are rather puzzling, but might have originated
367 from cryptic endosymbioses involving red algae prior to the more recent acquisition of a
368 green lineage endosymbiont [53, 54].
369 Based on our and previous analyses [10], Nbp35 seems to be the only essential FeS
370 cluster assembling P-loop ATPase present in all eukaryotic cells. Typically Nbp35 is a
371 cytosolic member of the CIA machinery; however, there are multiple examples of
372 mitochondrial localization. In this work, we demonstrated targeting of a single Nbp35 to the
373 T. gondii mitochondrion, and we similarly predicted mitochondrial localization for other
374 apicomplexans and chromerids based on their targeting signals. Three Nbp35 genes were
375 observed in the unrelated free-living archamoebae M. balamuthi, from which a single Nbp35
376 paralog possesses the mitochondrial/hydrogenosomal targeting sequence, and its
377 hydrogenosomal localization was supported by previous proteomic data [55]. Dual
378 mitosomal/cytoplasmic localization of two out of three Nbp35 paralogs was observed in
379 metamonad G. intestinalis [25]. A common property shared by these organisms with
380 mitochondrion-associated Nbp35 is that they lack Complex I and Ind1. It is tempting to
381 speculate that mitochondrial Nbp35 replaces Ind1 and serves in the delivery of [4Fe4S]
382 clusters to proteins other than Complex I subunits. However, Ind1 is highly specific for
383 Complex I, and its involvement in the maturation of other FeS proteins was not observed [17,
384 28].
385 Conclusions
16
386 The searches for Nbp35-like proteins across eukaryotic lineages revealed mitochondrial HCF-
387 101 homologs that are present exclusively in SAR, Haptista, and Cryptista. Thus, the presence
388 of mHCF101 and lack of Ind1 are the first nonplastidial common features of these lineages
389 formerly grouped under chromalveolates. Phylogeny of the HCF101 protein suggested that
390 both mHCF101 and chHCF101 are paralogs and that an ancestral HCF101 more likely was
391 gained by LGT from bacteria than via EGT.
392
393 Methods
394 Toxoplasma gondii cultivation, genetic manipulation, and microscopy.
395 Tachyzoites of T. gondii derived from strain RH were cultivated and genetically manipulated
396 as described previously [56]. HCF101 (TGME49_318590) and Nbp35 (TGME49_280730)
397 coding sequences were amplified from T. gondii cDNA and cloned in frame with a triple
398 hemagglutinin (HA) epitope tag at the 3’ end into plasmid pDt7s4HA. The constructs were
399 transiently transfected into the T. gondii Δku80/TATi strain [57] using a BTX ECM 630
400 electroporator (Harward Apparatus). Confluent human foreskin fibroblasts (HFF) were
401 infected with transfected parasites and fixed after 24 hours of infection with 4% formaldehyde
402 and permeabilized with 0.2% Triton X-100. Immunofluorescence microscopy was performed
403 using the primary antibodies anti-HA (Roche), mouse anti- T. gondii mitochondrial F1-
404 ATPase [58], and rabbit anti-apicoplast HSP60 [59]. Secondary antibodies used were goat
405 anti-rat Alexa Fluor 488, goat anti-mouse Alexa Fluor 546, and goat anti-rabbit Alexa Fluor
406 546. Images were obtained on an Applied Precision Delta Vision microscope and were
407 deconvolved and adjusted using Softworx software (GE Healthcare).
408 Tetrahymena thermophila cultivation, genetic manipulation, and microscopy.
17
409 T. thermophila CU428 strain was cultivated axenically in SPP medium (1% proteose-peptone,
410 0.2% glucose, 0.1% yeast extract, and 0.003% ferric-sodium: EDTA supplied with an
411 antibiotic-antimycotic mix (Invitrogen, Carlsbad, CA)[60]. The insertion of transgenes into
412 the T. thermophila macronucleus was performed as described previously [61]. Genes coding
413 for Nbp35 (XP_001033404, TTHERM 0312220) and mHCF101 (XP_001007903, TTHERM
414 00538790) were amplified from genomic DNA and inserted into the pFAP44-3HA vector
415 [62], which allows the expression of C-terminal-3HAtagged protein under its native promoter
416 [63]. Transfected cells were selected under an increasing concentration of paromomycin (100
417 µg-1000 µg per ml) and decreasing concentration of CdCl2.
418 Living cells of T. thermophila were stained by Mitotracker Red CMXRos (Molecular
419 Probes, Invitrogen) following the manufacturer’s protocol. Then, the cells were spread on
420 polylysine-coated slides and immediately fixed using methanol, permeabilized with acetone,
421 and immunostained by a α-HA tag rat monoclonal antibody (Roche) andAlexa Fluor 488
422 (green) donkey α-rat antibody (Invitrogen). Nuclei were stained with 4',6-diamidin-2-
423 fenylindol (DAPI). The slides were examined using an Olympus IX81 microscope equipped
424 with an MT20 illumination system.
425
426 Phaeodactylum tricornutum and Thalassiosira_pseudonana cultivation, genetic manipulation,
427 and microscopy
428 P. tricornutum (Bohlin, University of Texas Culture Collection, strain 646) and
429 Thalassiosira_pseudonana Hasle et Heimdal CCMP1335 were axenically grown in artificial
430 seawater medium, made by dissolving “Tropic marine” salt (Wartenberg, Germany) to obtain
431 35 units of practical salinity and enriched by Guillard’s (F/2) Marine Water Enrichment
432 Solution. The cells were cultivated at 22°C under continuous illumination (80 mmol photons
18
433 per m2 per s) with agitation (150 rpm) in 250 mL Erlenmeyer flasks to a density of
434 approximately 7x106 cells/ml.
435 P. tricornutum genes for Nbp35 (XP_002179311), mHCF101 (Joint Genome Institute,
436 JGI portal ID 49356), and chHCF101 (JGI portal ID 1865) and T. pseudonana genes for
437 Nbp35 (XP_002289427), mHCF101 (XP_002290238), and chHCF101 (XP_002293925)
438 were amplified from corresponding cDNA and cloned for expression in P. tricornutum with C
439 terminal e-GFP in vector pPHA-NR4 [36]. Biolistic transfection was carried out as described
440 previously [64] using M10 tungsten particles and 1350 psi rupture discs together with the Bio-
441 Rad Biolistic PDS-1000/He particle delivery system. Transfected cells were grown at 22°C
442 under continuous illumination (80 mmol photons per m2 per s) on plates containing solid f/2-
+ 443 medium with 1.3% agar, 1.5 mM NH4 as the sole nitrogen source and 75 µg/mlZeocin™ as a
444 selection marker. Protein expression under the control of the nitrate reductase promoter
445 (pPha-NR vector) was induced by cultivation on 0.9 mM NO3 for 2 days.
446 Transformants were analyzed with a Leica TCSSP2 confocal laser scanning
447 microscope. Mitochondrial localization was verified with MitoTracker® Orange CMTMRos
448 (Life Technologies). The fluorescence of enhanced green fluorescent protein (eGFP) and
449 chlorophyll was excited with an argon laser (65 mW) at 488 nm and detected with two
450 photomultiplier tubes at bandwidths of 500 to 520 nm and 625 to 720 nm for eGFP and
451 chlorophyll fluorescence, respectively. MitoTracker® Orange CMTMRos was excited with a
452 HeNe(1.2 mW) laser at 543 nm, and emission was detected at 560-590 nm. Pictures were
453 assembled in ImageJ (http://imagej.nih.gov/ij/index.html) using the Loci Bio-Formats plug-in
454 (http://www.openmicroscopy.org/site/products/bio-formats).
455
456 Searches for protein sequences and targeting predictions
19
457 Homologs of Ind1, Nbp35, Cfd1, and Hcf101 proteins were retrieved using the BLAST
458 algorithm [65] from the NCBI nr database (https://www.ncbi.nlm.nih.gov/), JGI genome
459 (https://genome.jgi.doe.gov/portal/), iMicrobe (https://www.imicrobe.us/), and Uniprot
460 (https://www.uniprot.org/). Genes for Cyanophora paradoxa were obtained from the database
461 at http://cyanophora.rutgers.edu/cyanophora/home.php. Protein sequences for Eutreptiella
462 gymnastica and Pyramimonas parkeae were kindly provided by Vladimír Hampl (Charles
463 University, Prague, Czech Republic), Euglena gracilis sequences by Marek Eliáš (University
464 of Ostrava, Czech Republic), and Chromera velia and Vitrella brassicaformis by Miroslav
465 Oborník (Biology center AS, Czech Budweis, Czech Republic). For each retrieved protein
466 sequence, a given database, dataset, and gene number is indicated in supplementary Table S1.
467 Protein sequences of four Nbp35-like protein categories were aligned using the
468 MUSCLE algorithm [66] in Geneious® 11.1.5 software with default settings. Protein
469 sequences with incomplete N- terminal parts were excluded from further protein localization
470 analysis. In a minority of cases, when N-terminal methionine was absent, but we identified
471 methionine within the first 10 amino acids of the N-terminus, we shortened the sequence, and
472 localization prediction was carried with lower confidence as indicated in Table 1. Subcellular
473 targeting of proteins was predicted using TargetP-1.1 ([67],
474 http://www.cbs.dtu.dk/services/TargetP-1.1/index.php); TargetP- 2.0
475 ([68],http://www.cbs.dtu.dk/services/TargetP/); DeepLoc-1.0
476 ([69],http://www.cbs.dtu.dk/services/DeepLoc/, accurate Profiles protein model); MitoFates
477 ([70], http://mitf.cbrc.jp/MitoFates/cgi-bin/top.cgi); MitoProt ([71],
478 https://ihg.gsf.de/ihg/mitoprot.html); SignalP 4.1 ([72],
479 http://www.cbs.dtu.dk/services/SignalP-4.1/); SignalP 5 ([73],
480 http://www.cbs.dtu.dk/services/SignalP/); Phobius ([74], http://phobius.sbc.su.se/); PSORT II
481 ([75], https://psort.hgc.jp/form2.html); ChloroP ([76],
20
482 http://www.cbs.dtu.dk/services/ChloroP/); Hectarv1.3 ([77], https://webtools.sb-roscoff.fr/);
483 Multiloc ([78], https://omictools.com/multiloc-tool); and PlasmoAP ([79];
484 https://plasmodb.org/plasmo/plasmoap.jsp). Furthermore, proteins with detected signal
485 peptides were shortened according to the predicted cleavage site of signal peptidase (SignalP
486 5, HECTAR, and TargetP 2 programs), and the presence of subsequent putative transit
487 peptide was detected with the MitoFates, TargetP2, and ChloroP algorithms. A search for the
488 motif of transit peptide cleavage by stromal processing peptidase was carried as described
489 [80–82].
490
491 Phylogenetic analysis
492 For the initial analysis of Nbp-35-like proteins (Fig. 4), homologs of the ParA domain
493 (PF10609) from the Pfam database were searched in the Uniprot database using HMMER
494 (version 3). A total of 22328 sequences with e-values below the 1e-50 cutoff were selected.
495 Selected sequences were grouped into groups that share 90% sequence identity using CD-
496 HIT, and for each such group, one sequence was selected to reduce redundancy, resulting in a
497 dataset of 9139 sequences. Sequences were then aligned using MAFFT [83] with default
498 settings, and the multiple sequence alignment was trimmed using BMGE [84] with the
499 BLOSUM30 matrix and a block size of one, resulting in an alignment with 189 aligned amino
500 acid positions. Sequences that were aligned at less than 126 positions (more than 63 gaps)
501 were removed from the dataset, resulting in 8440 sequences. These were again realigned and
502 trimmed resulting in an alignment with 185 aligned amino acid positions. A phylogenetic tree
503 was then inferred using FastTree [85] with default settings.
504 For detailed HCF101 analysis (Fig. 5), a dataset of 107 HCF101 proteins and their
505 homologs was manually assembled. The sequences were aligned using MAFFT [83] with “–
21
506 maxiterate 1000” and “–local pair” parameters. The alignment was trimmed using BMGE
507 [84] with the BLOSUM30 matrix and a block size of one, which resulted in 311 aligned
508 amino acid positions. A maximum likelihood phylogenetic tree was inferred using IQ-Tree
509 (version 1.6) [86] with the best selected mixture model LG+C60+G, and the topology was
510 tested using 10 000 ultrafast bootstraps. A Bayesian phylogenetic tree was inferred using
511 PhyloBayes (ver. 3) [87] and the CAT-Poisson model, running two chains for 20 000
512 generations. The first 2 000 generations were discarded (burnin), and every tenth generation
513 was sampled. The chains converged, with the maxdiff value 0.076.
514 Domain searches
515 Conserved protein domains were detected by searching sequences against the Pfam database
516 (ver. 32) using HMMER (ver. 3)[88]. Hits with e-values below 1e-5 were considered.
517
518 Table 1. Identification of Nbp35-like proteins in selected representatives of eukaryotic
519 lineages and prediction of their cellular localization.
520
Supergroup Group/Species Cytosol Mitochondria Chloroplast Green Red Ophistokonta Metazoa Homo sapiens Nbp35, Cfd1 Ind1 Drosophila melanogaster Nbp35, Cfd1 Ind1 Fungi Saccharomyces cerevisiae Nbp35, Cfd1 Yarrowia lipolytica Nbp35, Cfd1 Ind1 Amoebozoa Lobosa Acanthamoeba castelanii Nbp35, Cfd1 Ind1 Conosa Dictyostelium discoideum Nbp35, Cfd1 Ind1 Mastigamoeba balamuthi Nbp35, Cfd1 Entamoeba histolytica Nbp35, Cfd1
22
Archaeplastida Viridiplantae Arabidopsis thaliana Nbp35 Ind1 chHCF101 Chlorella variabilis Nbp35 Ind1 chHCF101 Nbp35, Coccomyxa subellipsoidea chHCF101 Ind1# Micromonas pusilla Nbp35 Ind1 chHCF101 Oryza sativa Nbp35 Ind1 chHCF101 Nbp35, Ostreococcus tauri chHCF101 Ind1 Physcomitrella patens Nbp35 Ind1 chHCF101 Pyramimonas parkeae Nbp35 Ind1* chHCF101 Selaginella moellendorffii Nbp35 Ind1# chHCF101# Glaucophyta Glaucocystis sp. Nbp35 Ind1 chHCF101* Gloeochaete wittrockiana Nbp35*, Cfd1* Ind1* chHCF101 Rhodophyta Chondrus crispus Nbp35 na chHCF101 Cyanidioschyzon merolae Nbp35 Ind1 chHCF101 Erythrolobus madagascarensis Nbp35* Ind1* chHCF101* Galdieria sulphuraria Nbp35 Ind1 chHCF101 Madagascaria erythrocladiodes Nbp35* na chHCF101 Porphyridium aerugineum Nbp35 Ind1 chHCF101* Rhodosorus marinus Nbp35* Ind1* chHCF101* Timspurckia oligopyrenoides na Ind1 chHCF101* SARCH Alveolata Apicomplexa Babesia bovis mHCF101* Nbp35# Cryptosporidium muris mHCF101 Nbp35# Toxoplasma gondii mHCF101 Nbp35 Plasmodium falciparum mHCF101 Nbp35# Plasmodium yoelii mHCF101 Nbp35# Chromerida Chromera vellia mHCF101 Nbp35# chHCF101 Vitrella brassica mHCF101 Nbp35# chHCF101 Perkinsus marinus Nbp35# mHCF101# Dinoflagellata Alexandrium monilatum Nbp35* mHCF101* chHCF101* Alexandrium tamarense Nbp35* mHCF101 chHCF101 Durinskia baltica Nbp35 na chHCF101* Dinophysis acuminata Nbp35* mHCF101* chHCF101* Karenia brevis Nbp35* mHCF101 chHCF101 Oxyrrhis marina Nbp35* mHCF101* na Symbiodinium sp. Nbp35# mHCF101* chHCF101 Cilliata Tetrahymena thermophila Nbp35 mHCF101
23
Oxytricha trifallax Nbp35 mHCF101 Paramecium tetraurelia Nbp35 mHCF101 Stylonychia sp. Nbp35 mHCF101 Rhizaria Rhizaria Ammonia sp. Nbp35 mHCF101* Elphidium margaritaceum Nbp35 mHCF101* Reticulomyxa filosa Nbp35 mHCF101 Paulinella chromatophora na na Bacterial HCF101-like Chlorarachniophyta Bigelowiella longifila Nbp35 mHCF101* chHCF101* Bigelowiella natans Nbp35* mHCF101* chHCF101 Lotharella globosa Nbp35* mHCF101* chHCF101* Stramenopila Oomycota Albugo candidagi Nbp35 mHCF101# Albugo laibachii Nbp35 mHCF101# Aphanomyces astaci Nbp35 mHCF101 Aphanomyces invadans Nbp35 mHCF101 Phytophthora infestans Nbp35 mHCF101* Phytophthora parasitica Nbp35 mHCF101 Saprolegnia diclina Nbp35 mHCF101 Ochrophyta Aureococcus anophagefferens Nbp35 mHCF101* chHCF101* Ectocarpus siliculosus Nbp35# mHCF101 chHCF101 Phaeodactylum tricornutum Nbp35 mHCF101 chHCF101 Nannochloropsis gaditana Nbp35 mHCF101 chHCF101 Schizochytrium aggregatum Nbp35 mHCF101 na Thalassiosira oceanica Nbp35 mHCF101* chHCF101 Thalassiosira pseudonana Nbp35 mHCF101 chHCF101 Blastocystis hominis Nbp35 mHCF101 Haptista Haptophyta Chrysochromulina polylepis Nbp35* mHCF101* chHCF101* Emiliania huxleyi Nbp35 mHCF101 chHCF101 Exanthemachrysis gayraliae na mHCF101* chHCF101* Gephyrocapsa oceanica Nbp35 mHCF101* chHCF101 Isochrysis galbana Nbp35 mHCF101 chHCF101* Pleurochrysis carterae Nbp35 mHCF101 chHCF101* Prymnesium parvum Nbp35* mHCF101* chHCF101* Centrohelida Nbp35* mHCF101* Cryptista Cryptophyta Chroomonas mesostigmatica Nbp35*, Cfd1* mHCF101* chHCF101* Cryptomonas curvata na mHCF101 na Cryptomonas paramecium Nbp35*, Cfd1* mHCF101 na
24
Geminigera cryophila Nbp35*, Cfd1 mHCF101 chHCF101* Guillardia theta Nbp35/Cfd1 mHCF101* chHCF101# Hanusia phi Nbp35*, Cfd1* mHCF101 na Hemiselmis rufescens Nbp35, Cfd1* mHCF101* chHCF101# Proteomonas sulcata Nbp35*, Cfd1 mHCF101* na Rhodomonas sp. Nbp35, Cfd1* na chHCF101* Katablepharida Roombia truncata Nbp35*, Cfd1* mHCF101* Goniomonas Goniomonas avonlea Nbp35*, Cfd1* mHCF101 Goniomonas pacifica Nbp35, Cfd1* mHCF101* Excavata Euglenozoa Euglena gracilis Nbp35, na na chHCF101* Eutreptiella gymnastica Nbp35, Cfd1 Ind1 chHCF101 Trypanosoma brucei Nbp35, Cfd1 Ind1 Leishmania major Nbp35, Cfd1 Ind1 Metamonada Trichomonas vaginalis Nbp35, Cfd1 Ind1 Giardia intestinalis Nbp35 Nbp35 Heterolobosea Naegleria gruberi Nbp35, Cfd1 Ind1
521 Proteins with experimentally verified localization are in bold. Taxons in red indicate available
522 genome sequence, taxons in red indicate available transcriptome. * Incomplete sequence of
523 the gene, cellular localization is predicted based on the phylogenetic analysis (Fig. 5); #
524 prediction with low confidence; na, gene was not identified in available transcriptome.
525
526 References
527 1. Tachezy J, Sánchez LB, Müller M. Mitochondrial type iron-sulfur cluster assembly in the
528 amitochondriate eukaryotes Trichomonas vaginalis and Giardia intestinalis, as indicated by
529 the phylogeny of IscS. Mol Biol Evol. 2001;18:1919–28.
530 2. Lill R. Function and biogenesis of iron-sulphur proteins. Nature. 2009;460:831–8.
531 3. Sutak R, Dolezal P, Fiumera HL, Hrdy I, Dancist A, Delgadillo-Correa M, et al.
532 Mitochondrial-type assembly of FeS centers in the hydrogenosomes of the amitochondriate
25
533 eukaryote Trichomonas vaginalis. Proc Natl Acad Sci U S A. 2004;101:10368–73.
534 4. Tovar J, León-Avila G, Sánchez LB, Sutak R, Tachezy J, Van Der Giezen M, et al.
535 Mitochondrial remnant organelles of Giardia function in iron-sulphur protein maturation.
536 Nature. 2003;426:172–6.
537 5. Takahashi Y, Tokumoto U. A third bacterial system for the assembly of iron-sulfur clusters
538 with homologs in Archaea and plastids. J Biol Chem. 2002;277:28380–3.
539 6. Novák Vanclová AMG, Zoltner M, Kelly S, Soukal P, Záhonová K, Füssy Z, et al.
540 Metabolic quirks and the colourful history of the Euglena gracilis secondary plastid. New
541 Phytol. 2020;225:1578–92. doi:10.1111/nph.16237.
542 7. Grosche C, Diehl A, Rensing SA, Maier UG. Iron-sulfur cluster biosynthesis in algae with
543 complex plastids. Genome Biol Evol. 2018;10:2061–71. doi:10.1093/gbe/evy156.
544 8. Füssy Z, Oborník M. Complex endosymbioses I: From primary to complex plastids,
545 multiple independent events. In: Methods in Molecular Biology. Humana Press Inc.; 2018. p.
546 17–35. doi:10.1007/978-1-4939-8654-5_2.
547 9. Freibert SA, Goldberg A V., Hacker C, Molik S, Dean P, Williams TA, et al. Evolutionary
548 conservation and in vitro reconstitution of microsporidian iron-sulfur cluster biosynthesis. Nat
549 Commun. 2017;8:13932. doi:10.1038/ncomms13932.
550 10. Tsaousis AD, Gentekaki E, Eme L, Gaston D, Roger AJ. Evolution of the cytosolic iron-
551 sulfur cluster assembly machinery in Blastocystis species and other microbial eukaryotes.
552 Eukaryot Cell. 2014;13:143–53. doi:10.1128/EC.00158-13.
553 11. Gill EE, Diaz-Trivino S, Barbera MJ, Silberman JD, Stechmann A, Gaston D, et al. Novel
554 mitochondrion-related organelles in the anaerobic amoeba Mastigamoeba balamuthi. Mol
26
555 Microbiol. 2007;66:1306–20.
556 12. Nývltová E, Šuták R, Harant K, Šedinová M, Hrdý I, Pačes J, et al. NIF-type iron-sulfur
557 cluster assembly system is duplicated and distributed in the mitochondria and cytosol of
558 Mastigamoeba balamuthi. Proc Natl Acad Sci U S A. 2013;110:7371–6.
559 13. Stairs CW, Eme L, Brown MW, Mutsaers C, Susko E, Dellaire G, et al. A SUF Fe-S
560 cluster biogenesis system in the mitochondrion-related organelles of the anaerobic protist
561 Pygsuia. Curr Biol. 2014;24:1176–86. doi:10.1016/j.cub.2014.04.033.
562 14. Leger MM, Eme L, Hug LA, Roger AJ. Novel hydrogenosomes in the microaerophilic
563 jakobid Stygiella incarcerata. Mol Biol Evol. 2016;33:2318–36.
564 doi:10.1093/molbev/msw103.
565 15. Karnkowska A, Vacek V, Zubáčová Z, Treitli SC, Petrželková R, Eme L, et al. A
566 eukaryote without a mitochondrial organelle. Curr Biol. 2016;26:1274–84.
567 16. Pandey AK, Pain J, Dancis A, Pain D. Mitochondria export iron-sulfur and sulfur
568 intermediates to the cytoplasm for iron-sulfur cluster assembly and tRNA thiolation in yeast. J
569 Biol Chem. 2019;294:9489–502.
570 17. Bych K, Kerscher S, Netz DJ, Pierik AJ, Zwicker K, Huynen MA, et al. The iron-sulphur
571 protein Ind1 is required for effective complex I assembly. EMBO J. 2008;27:1736–46.
572 18. Hrdy I, Hirt RP, Dolezal P, Bardonová L, Foster PG, Tachezy J, et al. Trichomonas
573 hydrogenosomes contain the NADH dehydrogenase module of mitochondrial complex I.
574 Nature. 2004;432:618–22.
575 19. Lezhneva L, Amann K, Meurer J. The universally conserved HCF101 protein is involved
576 in assembly of [4Fe-4S]-cluster-containing complexes in Arabidopsis thaliana chloroplasts.
27
577 Plant J. 2004;37:174–85. doi:10.1046/j.1365-313X.2003.01952.x.
578 20. Schwenkert S, Netz DJA, Frazzon J, Pierik AJ, Bill E, Gross J, et al. Chloroplast HCF101
579 is a scaffold protein for [4Fe-4S] cluster assembly. Biochem J. 2009;425:207–14.
580 doi:10.1042/BJ20091290.
581 21. Keeling PJ. The endosymbiotic origin, diversification and fate of plastids. Philos Trans R
582 Soc Lond B Biol Sci. 2010;365:729–48. doi:10.1098/rstb.2009.0103.
583 22. Archibald JM. The puzzle of plastid evolution. Curr Biol. 2009;19:R81–8.
584 23. Pala ZR, Saxena V, Saggu GS, Garg S. Recent advances in the [Fe–S] cluster biogenesis
585 (SUF) pathway functional in the apicoplast of Plasmodium. Trends Parasitol. 2018;34:800–9.
586 doi:10.1016/j.pt.2018.05.010.
587 24. Seeber F, Soldati-Favre D. Metabolic pathways in the apicoplast of Apicomplexa. Int Rev
588 Cell Mol Biol. 2010;281:161–228. doi:10.1016/S1937-6448(10)81005-6.
589 25. Pyrih J, Pyrihová E, Kolísko M, Stojanovová D, Basu S, Harant K, et al. Minimal
590 cytosolic iron-sulfur cluster assembly machinery of Giardia intestinalis is partially associated
591 with mitosomes. Mol Microbiol. 2016;102:701–14.
592 26. Opperdoes FR, Michels PAM. Complex I of Trypanosomatidae: does it exist? Trends
593 Parasitol. 2008;24:310–7. doi:10.1016/j.pt.2008.03.013.
594 27. Leipe DD, Wolf YI, Koonin E V., Aravind L. Classification and evolution of P-loop
595 GTPases and related ATPases. J Mol Biol. 2002;317:41–72.
596 28. Sheftel AD, Stehling O, Pierik AJ, Netz DJA, Kerscher S, Elsässer H-P, et al. Human
597 Ind1, an iron-sulfur cluster assembly factor for respiratory complex I. Mol Cell Biol.
598 2009;29:6059–73.
28
599 29. Stehling O, Mascarenhas J, Vashisht AA, Sheftel AD, Niggemeyer B, Rösser R, et al.
600 Human CIA2A-FAM96A and CIA2B-FAM96B integrate iron homeostasis and maturation of
601 different subsets of cytosolic-nuclear iron-sulfur proteins. Cell Metab. 2013;18:187–98.
602 30. Luo D, Bernard DG, Balk J, Hai H, Cui X. The DUF59 family gene AE7 acts in the
603 cytosolic iron-sulfur cluster assembly pathway to maintain nuclear genome integrity in
604 Arabidopsis. Plant Cell. 2012;24:4135–48.
605 31. Mashruwala AA, Bhatt S, Poudel S, Boyd ES, Boyd JM. The DUF59 containing protein
606 SufT is involved in the maturation of iron-sulfur (FeS) proteins during conditions of high FeS
607 cofactor demand in Staphylococcus aureus. PLOS Genet. 2016;12:e1006233.
608 doi:10.1371/journal.pgen.1006233.
609 32. Mesterházy E, Lebrun C, Crouzy S, Jancsó A, Delangle P. Short oligopeptides with three
610 cysteine residues as models of sulphur-rich Cu(i)- and Hg(ii)-binding sites in proteins.
611 Metallomics. 2018;10:1232–44.
612 33. Burki F, Kaplan M, Tikhonenkov D V., Zlatogursky V, Minh BQ, Radaykina L V., et al.
613 Untangling the early diversification of eukaryotes: A phylogenomic study of the evolutionary
614 origins of centrohelida, haptophyta and cryptista. Proc R Soc B Biol Sci. 2016;283.
615 34. Burki F, Roger AJ, Brown MW, Simpson AGB. The New Tree of Eukaryotes. Trends
616 Ecol Evol. 2020;35:43–55.
617 35. Cavalier-Smith T. Principles of protein and lipid targeting in secondary symbiogenesis:
618 Euglenoid, dinoflagellate, and sporozoan plastid origins and the eukaryote family tree. J
619 Eukaryot Microbiol. 1999;46:347–66.
620 36. Stork S, Moog D, Przyborski JM, Wilhelmi I, Zauner S, Maier UG. Distribution of the
621 SELMA translocon in secondary plastids of red algal origin and predicted uncoupling of
29
622 ubiquitin-dependent translocation from degradation. Eukaryot Cell. 2012;11:1472–81.
623 doi:10.1128/EC.00183-12.
624 37. Felsner G, Sommer MS, Gruenheit N, Hempel F, Moog D, Zauner S, et al. ERAD
625 components in organisms with complex red plastids suggest recruitment of a preexisting
626 protein transport pathway for the periplastid membrane. Genome Biol Evol. 2011;3:140–50.
627 doi:10.1093/gbe/evq074.
628 38. Sakamoto H, Suzuki S, Nagamune K, Kita K, Matsuzaki M. Investigation into the
629 physiological significance of the phytohormone abscisic acid in Perkinsus marinus, an oyster
630 parasite harboring a nonphotosynthetic plastid. J Eukaryot Microbiol. 2017;64:440–6.
631 doi:10.1111/jeu.12379.
632 39. Reyes-Prieto A, Moustafa A, Bhattacharya D. Multiple genes of apparent algal origin
633 suggest ciliates may once have been photosynthetic. Curr Biol. 2008;18:956–62.
634 40. Keeling PJ. The number, speed, and impact of plastid endosymbioses in eukaryotic
635 evolution. Annu Rev Plant Biol. 2013;64:583–607.
636 41. Stiller JW, Schreiber J, Yue J, Guo H, Ding Q, Huang J. The evolution of photosynthesis
637 in chromist algae through serial endosymbioses. Nat Commun. 2014;5.
638 42. Burki F, Okamoto N, Pombert JF, Keeling PJ. The evolutionary history of haptophytes
639 and cryptophytes: Phylogenomic evidence for separate origins. Proc R Soc B Biol Sci.
640 2012;279:2246–54. doi:10.1098/rspb.2011.2301.
641 43. Kite GC, Dodge JD. Structural organization of plastid DNA in two anomalously
642 pigmented dinoflagellates. J Phycol. 1985;21:50–6. doi:10.1111/j.0022-3646.1985.00050.x.
643 44. Tengs T, Dahlberg OJ, Shalchian-Tabrizi K, Klaveness D, Rudi K, Delwiche CF, et al.
30
644 Phylogenetic analyses indicate flint the 19’hexanoyloxy-fucoxanthin- containing
645 dinoflagellates have tertiary plastids of haptophyte origin. Mol Biol Evol. 2000;17:718–29.
646 doi:10.1093/oxfordjournals.molbev.a026350.
647 45. Burki F, Imanian B, Hehenberger E, Hirakawa Y, Maruyama S, Keeling PJ.
648 Endosymbiotic gene transfer in tertiary plastid-containing dinoflagellates. Eukaryot Cell.
649 2014;13:246–55.
650 46. Kamikawa R, Yazaki E, Tahara M, Sakura T, Matsuo E, Nagamune K, et al. Fates of
651 evolutionarily distinct, plastid-type glyceraldehyde 3-phosphate dehydrogenase genes in
652 kareniacean dinoflagellates. J Eukaryot Microbiol. 2018;65:669–78.
653 47. Hwan SY, Hackett JD, Van Dolah FM, Nosenko T, Lidie KL, Bhattacharya D. Tertiary
654 endosymbiosis driven genome evolution in dinoflagellate algae. Mol Biol Evol.
655 2005;22:1299–308. doi:10.1093/molbev/msi118.
656 48. Dorrell RG, Howe CJ. Integration of plastids with their hosts: Lessons learned from
657 dinoflagellates. Proc Natl Acad Sci U S A. 2015;112:10247–54.
658 doi:10.1073/pnas.1421380112.
659 49. Hackett JD, Yoon HS, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, et al.
660 Migration of the plastid genome to the nucleus in a peridinin dinoflagellate. Curr Biol.
661 2004;14:213–8.
662 50. Frommolt R, Werner S, Paulsen H, Goss R, Wilhelm C, Zauner S, et al. Ancient
663 recruitment by chromists of green algal genes encoding enzymes for carotenoid biosynthesis.
664 Mol Biol Evol. 2008;25:2653–67. doi:10.1093/molbev/msn206.
665 51. Ishida K, Green BR, Cavalier-Smith T. Diversification of a chimaeric algal group, the
666 chlorarachniophytes: Phylogeny of nuclear and nucleomorph small-subunit rRNA genes. Mol
31
667 Biol Evol. 1999;16:321–31. doi:10.1093/oxfordjournals.molbev.a026113.
668 52. Curtis BA, Tanifuji G, Maruyama S, Gile GH, Hopkins JF, Eveleigh RJM, et al. Algal
669 genomes reveal evolutionary mosaicism and the fate of nucleomorphs. Nature. 2012;492:59–
670 65. doi:10.1038/nature11681.
671 53. Ponce-Toledo RI, Moreira D, López-García P, Deschamps P. Secondary plastids of
672 euglenids and chlorarachniophytes function with a mix of genes of red and green algal
673 ancestry. Mol Biol Evol. 2018;35:2198–204. doi:10.1093/molbev/msy121.
674 54. Archibald JM, Rogers MB, Toop M, Ishida K ichiro, Keeling PJ. Lateral gene transfer and
675 the evolution of plastid-targeted proteins in the secondary plastid-containing alga Bigelowiella
676 natans. Proc Natl Acad Sci U S A. 2003;100:7678–83. doi:10.1073/pnas.1230951100.
677 55. Le T, Žárský V, Nývltová E, Rada P, Harant K, Vancová M, et al. Anaerobic peroxisomes
678 in Mastigamoeba balamuthi. Proc Natl Acad Sci. 2020;117:2065-75.
679 doi:10.1073/pnas.1909755117.
680 56. Striepen B, Soldati D. Genetic manipulation of Toxoplasma gondii. In: Toxoplasma
681 gondii. Academic Press; 2007. p. 391–418.
682 57. Sheiner L, Demerly JL, Poulsen N, Beatty WL, Lucas O, Behnke MS, et al. A systematic
683 screen to discover and analyze apicoplast proteins identifies a conserved and essential protein
684 import factor. PLoS Pathog. 2011;7.
685 58. Chen AL, Moon AS, Bell HN, Huang AS, Vashisht AA, Toh JY, et al. Novel insights into
686 the composition and function of the Toxoplasma IMC sutures. Cell Microbiol. 2017;19.
687 doi:10.1111/cmi.12678.
688 59. Agrawal S, van Dooren GG, Beatty WL, Striepen B. Genetic evidence that an
32
689 endosymbiont-derived endoplasmic reticulum-associated protein degradation (ERAD) system
690 functions in import of apicoplast proteins. J Biol Chem. 2009;284:33683–91.
691 60. Gorovsky MA, Yao MC, Keevert JB, Pleger GL. Chapter 16 Isolation of micro- and
692 macronuclei of Tetrahymena pyriformis. Methods Cell Biol. 1975;9 C:311–27.
693 doi:10.1016/S0091-679X(08)60080-1.
694 61. Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J. Members of
695 the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Mol
696 Biol Cell. 2006;17:2799–810.
697 62. Urbanska P, Joachimiak E, Bazan R, Fu G, Poprzeczko M, Fabczak H, et al. Ciliary
698 proteins Fap43 and Fap44 interact with each other and are essential for proper cilia and
699 flagella beating. Cell Mol Life Sci. 2018;75:4479–93. doi:10.1007/s00018-018-2819-7.
700 63. Dave D, Wloga D, Gaertig J. Manipulating ciliary protein-encoding genes in Tetrahymena
701 thermophila. Methods Cell Biol. 2009;93:1–20. doi:10.1016/S0091-679X(08)93001-6.
702 64. Hempel F, Bozarth AS, Lindenkamp N, Klingl A, Zauner S, Linne U, et al. Microalgae as
703 bioreactors for bioplastic production. Microb Cell Fact. 2011;10.
704 65. Altschul SF, Madden TL, Schaffer AA, Zhang JH, Zhang Z, Miller W, et al. Gapped
705 BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic
706 Acids Res. 1997;25:3389–402. isi:A1997XU79300002.
707 66. Edgar RC. MUSCLE: multiple sequence alignment with high accuracy and high
708 throughput. Nucleic Acids Res. 2004;32:1792–7. isi:000220487200025.
709 67. Emanuelsson O, Brunak S, von Heijne G, Nielsen H. Locating proteins in the cell using
710 TargetP, SignalP and related tools. Nat Protoc. 2007;2:953–71.
33
711 68. Armenteros JJA, Salvatore M, Emanuelsson O, Winther O, Von Heijne G, Elofsson A, et
712 al. Detecting sequence signals in targeting peptides using deep learning. Life Sci Alliance.
713 2019;2. doi:10.26508/lsa.201900429.
714 69. Almagro Armenteros JJ, Sønderby CK, Sønderby SK, Nielsen H, Winther O. DeepLoc:
715 prediction of protein subcellular localization using deep learning. Bioinformatics (Oxford,
716 England). 2017;33:3387–95. doi:10.1093/bioinformatics/btx431.
717 70. Fukasawa Y, Tsuji J, Fu S-C, Tomii K, Horton P, Imai K. MitoFates: Improved prediction
718 of mitochondrial targeting sequences and their cleavage sites. Mol Cell Proteomics.
719 2015;14:1113–26.
720 71. Claros MG, Vincens P. Computational method to predict mitochondrially imported
721 proteins and their targeting sequences. Eur J Biochem. 1996;241:779–86.
722 72. Petersen TN, Brunak S, Von Heijne G, Nielsen H. SignalP 4.0: Discriminating signal
723 peptides from transmembrane regions. Nature Methods. 2011;8:785–6.
724 doi:10.1038/nmeth.1701.
725 73. Almagro Armenteros JJ, Tsirigos KD, Sønderby CK, Petersen TN, Winther O, Brunak S,
726 et al. SignalP 5.0 improves signal peptide predictions using deep neural networks. Nat
727 Biotechnol. 2019;37:420–3. doi:10.1038/s41587-019-0036-z.
728 74. Käll L, Krogh A, Sonnhammer ELL. A combined transmembrane topology and signal
729 peptide prediction method. J Mol Biol. 2004;338:1027–36.
730 75. Nakai K, Horton P. PSORT: A program for detecting sorting signals in proteins and
731 predicting their subcellular localization. Trends Biochem Sci. 1999;24:34–5.
732 doi:10.1016/S0968-0004(98)01336-X.
34
733 76. Emanuelsson O, Nielsen H, Heijne G Von. ChloroP, a neural network-based method for
734 predicting chloroplast transit peptides and their cleavage sites. Protein Sci. 1999;8:978–84.
735 doi:10.1110/ps.8.5.978.
736 77. Gschloessl B, Guermeur Y, Cock JM. HECTAR: A method to predict subcellular
737 targeting in heterokonts. BMC Bioinformatics. 2008;9:393. doi:10.1186/1471-2105-9-393.
738 78. Höglund A, Dönnes P, Blum T, Adolph HW, Kohlbacher O. MultiLoc: Prediction of
739 protein subcellular localization using N-terminal targeting sequences, sequence motifs and
740 amino acid composition. Bioinformatics. 2006;22:1158–65.
741 doi:10.1093/bioinformatics/btl002.
742 79. Foth BJ, Ralph SA, Tonkin CJ, Struck NS, Fraunholz M, Roos DS, et al. Dissecting
743 apicoplast targeting in the malaria parasite Plasmodium falciparum. Science. 2003;299:705–8.
744 doi:10.1126/science.1078599.
745 80. Apt KE, Zaslavkaia L, Lippmeier JC, Lang M, Kilian O, Wetherbee R, et al. In vivo
746 characterization of diatom multipartite plastid targeting signals. J Cell Sci. 2002;115:4061–9.
747 doi:10.1242/jcs.00092.
748 81. Woehle C, Dagan T, Martin WF, Gould SB. Red and problematic green phylogenetic
749 signals among thousands of nuclear genes from the photosynthetic and apicomplexa-related
750 Chromera velia. Genome Biol Evol. 2011;3:1220–30. doi:10.1093/gbe/evr100.
751 82. Huesgen PF, Alami M, Lange PF, Foster LJ, Schröder WP, Overall CM, et al. Proteomic
752 amino-termini profiling reveals targeting information for protein import into complex
753 plastids. PLoS One. 2013;8:e74483. doi:10.1371/journal.pone.0074483.
754 83. Katoh K, Standley DM. MAFFT Multiple sequence alignment software version 7:
755 Improvements in performance and usability. Mol Biol Evol. 2013;30:772–80.
35
756 doi:10.1093/molbev/mst010.
757 84. Criscuolo A, Gribaldo S. BMGE (Block Mapping and Gathering with Entropy): a new
758 software for selection of phylogenetic informative regions from multiple sequence
759 alignments. BMC Evol Biol. 2010;10:210. doi:10.1186/1471-2148-10-210.
760 85. Price MN, Dehal PS, Arkin AP. FastTree 2 - Approximately maximum-likelihood trees
761 for large alignments. PLoS One. 2010.
762 86. Nguyen L-T, Schmidt HA, von Haeseler A, Minh BQ. IQ-TREE: A fast and effective
763 stochastic algorithm for estimating maximum-likelihood phylogenies. Mol Biol Evol.
764 2015;32:268–74. doi:10.1093/molbev/msu300.
765 87. Lartillot N, Lepage T, Blanquart S. PhyloBayes 3: a Bayesian software package for
766 phylogenetic reconstruction and molecular dating. Bioinformatics. 2009;25:2286–8.
767 88. Finn RD, Clements J, Arndt W, Miller BL, Wheeler TJ, Schreiber F, et al. HMMER web
768 server: 2015 Update. Nucleic Acids Res. 2015;43:W30–8.
769
770 Declarations
771 Ethics approval and consent to participate
772 Not applicable
773 Consent for publication
774 Not applicable
775 Availability of data and materials
36
776 All data generated or analysed during this study are included in this published article and its
777 supplementary information files.
778 Competing interests
779 The authors declare that they have no competing interests.
780 Funding
781 Laboratory of JT was supported by NPU II (LQ1604) provided by the Ministry of Education, Youth
782 and Sport (MEYS) of the Czech Republic, CePaViP (CZ.02.1.01/0.0/0.0/16_019/0000759) provided
783 by ERD Funds, and MICOBION funded from EU H2020 (No 810224). CG and UGM were supported
784 by the LOEWE Center for Synthetic Microbiology (Synmikro).
785 Authors' contributions
786 JP and JT conceived the study. JP and VŽ performed bioinformatic analyses, JDF, BS, CG.
787 DW, UGM performed cell localization studies, JP and JT wrote the paper. All authors read
788 and approved the final manuscript.
789
790 Legends to figures
791 Figure 1. Predictions of N-terminal targeting sequences for chloroplast (chHCF101) and
792 mitochondrial versions of HCF101 (mHCF101) in selected alveolates and stramenopiles. Red
793 color highlights the mitochondrial leader sequence with cleavage sites predicted with
794 Mitofates (star), TargetP 2 (circle), and PSORT II (triangle). Yellow color indicates a signal
795 peptide, which is cleaved right before the phenylalanine residue, a typical feature for signal
796 peptide cleavage in diatoms. This cleavage site was predicted with high support by the
797 TargetP, Signal P, and HECTAR algorithms. Green represents a predicted transit peptide with
37
798 two possible cleavage sites for stromal processing peptidase, manually predicted based on
799 previous studies [82]. Gray color highlights conserved residues.
800 Figure 2. Localization of Nbp35-like proteins in diatoms. Genes for chHCF101, mHCF101,
801 and Nbp35 from P. tricornutum and T. pseudonana were expressed in P. tricornutum with C-
802 terminal e-GFP tag (green). PAF, plastid autofluorescence (red); MitoT, MitoTracker Orange
803 (blue); DIC, differential interference contrast. Scale bar 10µm.
804 Figure 3. Localization of Nbp35 and mHCF101 in T. thermophila and T. gondii. Nbp35 and
805 mHCF101 were expressed under the control of their respective native promoter with a C-
806 terminal HA tag (green). Specific polyclonal antibodies against F1-ATPase (red), and HSP60
807 (red) were used as mitochondrial and apicoplastidal markers, respectively. MitoT, Mitotracker
808 Red, (red); DIC, differential interference contrast. Scale bar 10 µm (T. thermophila) and 5 µm
809 (T. gondii).
810 Figure 4. A phylogenetic tree of the Nbp35-like proteins (the ParA family). The tree was built
811 using FastTree, and nodes with support below 0.9 were collapsed (see materials and
812 methods). The leaves are color coded to indicate taxonomy (8840 sequences), with
813 annotations of selected sequences. The scale bar represents the estimated number of amino
814 acid substitutions per site.
815 Figure 5. Phylogeny of HCF101 proteins.The tree was built using the PhyloBayes CAT-
816 Poisson mixture model. Numbers at nodes of the tree indicate statistical support in the form of
817 posterior probability of the PhyloBayes analysis and an ultrafast bootstrap of the IQ-Tree
818 analysis (see materials and methods). The scale bar represents the estimated number of amino
819 acid substitutions per site. The conserved cysteine motif in the DUF971 domain is displayed
820 for each protein sequence when available.
38
821 Figure 6. Scheme of HCF101 evolution. A. HCF101 distribution explained via the
822 Chromalveolate hypothesis. Upon the acquisition of HCF101-like protein via LGT from
823 bacteria to the ancestor of Archeplastida, chHCF101 was established in the plastid.
824 Euglenozoa gained HCF101 via secondary endosymbiosis with a donor containing green
825 plastid. A common ancestor of Chromalveolata gained red plastid via secondary
826 endosymbiosis, the gene for chHCF101 was duplicated and one copy was targeted to
827 mitochondria (mHCF101), where it replaced the Ind1 gene. mHCF101 is common to all
828 chromalveolates, while several lineages lost chHCF101 together with loss of the secondary
829 plastid (Cryptosporidium, Ciliates, Oomycota, centrohelids, catablepharids). B. HCF101
830 distribution explained via ‘multiple secondary endosymbiosis’. Mitochondrially localized
831 HCF101 together with Ind1 was present in a common ancestor of Archaeplastida, SAR,
832 Cryptista, and Haptista. Then, in (i) Cryptista and in (ii) a common ancestor of Haptista and
833 SAR, the Ind1 gene was lost, whereas the Archaeplastida gene for the Ind1 protein remained
834 in the mitochondria, and mHCF101 was retargeted to the plastid. Then, chHCF101 was
835 introduced to Cryptophytes, Haptophytes, and certain SAR groups via multiple secondary
836 endosymbiosis. chHCF101 is absent in lineages that did not experience secondary
837 endosymbiosis.
838 PR, protein retargeting; GL, gene loss; GD, gene duplication; PL, plastid loss; PES, primary
839 endosymbiosis; SES, secondary endosymbiosis; TES, tertiary endosymbiosis.
840 Additional files
841 Additional file 1, Table S1.xls
842 List of retrieved protein sequences that were used for cellular localization predictions.
843 Sequence, Nbp35-like protein category, organism, its taxonomy, and source of the sequence
844 in various databases are highlighted in columns A to L. Completeness of the sequence is
39
845 indicated in Column M. In the case that the protein sequence was manually corrected, the
846 trimmed sequence is displayed in column N. Columns O to P indicate final protein
847 localization prediction. Columns R to Z, AA to AJ, and AK to AO indicate support for the
848 presence of signal peptide, mitochondrial leader sequence, or plastid transit peptide,
849 respectively.
850 Additional file 2, Table S2.xls
851 Predictions of domain structure in Nbp35 homologs included in phylogenetic analysis (Fig.
852 4).
40
1 10 20 30 40 50 60 | | | | | | | P.tricornutum mHCF 1------MLPLVGRKPAISALPKVWASSSLRQISRCSFLEPPKLPQNSRCQGAQTQPRN -52 T.pseudonana mHCF 1- MTAYRVTSLSRRGLQSSLTNQRRGILCGTRLTDRSMVVKHNRDDGSTTIKSLRHLSTLTS -60 T.thermofila mHCF 1------MIRNTVQLFKQC -12 T.gondii mHCF 1------MSRTF -5 P.tricornutum chHCF 1------MTTTTTRWNHSTRQTLRCCMVWMCLSLSTIDAFTPPNPYRFRRGSS -46 T.pseudonana chHCF 1------MRTTLIVATLAGAASGFVLSPSRVLPMPHI -30
P.tricornutum mHCF 53- AYPPCYSRSHSKRCSSTVSSFPLAAFSRREMADLEDRVCGRVA------QKVRDPVLGQT -106 T.pseudonana mHCF 61- SRLRTSDEYVKVFQFGNTDKLSFSKLSSRQSAELEDELFSFLSNNKSNDERLVDPLLGRD -120 T.thermofila mHCF 13- ARSATILKKLNLNSQSFSNTIKIGQLTQKPTFHFSNAVQEGKAEITKKLKEITFED-GSN -73 T.gondii mHCF 6- GGRDGTVKETAGLEELSPEHTFLMSDDSHRGQRLRDEVLDQL------RTVIDPDLHKD -58 P.tricornutum chHCF 47- TLTRPFATPPLPSGGAPVLVDAVEDTLPPIPKEWQGEVLSTL------KSVIDPDLGSD -99 T.pseudonana chHCF 31- SSRTALGPSSSPLLSLKFSLISNDAPLFKYPSDWQSQILAAL------SVINDPDLNAD -83
Nbp35 Cfd1
archaea tack group Methanococcus euryarchaeota ApbC bacteria fcb group pvc group Hcf+related bacteria terrabacteria group Escherichia (without cyanobacteria) ApbC cyanobacteria proteobacteria Ind1 (without alphaproteo) Kinetoplastida Hcf101 alphaproteobacteria
sar archaeplastida excavata amorphea
0.4 unknown Ind1 0.99/99 Flammeovirgaceae_bacterium.A0A1Z9UPY0 Bacteroidetes ------0.39/83 Pelagibacteraceae_bacterium.A0A1Z8LA07 ------0.28/- Alphaproteobacteria Alphaproteobacteria_bacterium.A0A1Z8VRU4 ------1.0/100 0.99/98 Alpha_proteobacterium.J9Z1T9 ------Gammaproteobacteria_bacterium.A0A1Z9TMS2 Gammaproteobacteria ------0.34/- Gammaproteobacteria_bacterium.A0A1Z8QF18 ------1.0/100 Simkania_negevensis.F8L6N9 ------Chlamydiales_bacterium.A0A212KRA2 ------0.86/100 Kiritimatiellaceae_bacterium.A0A1Z9T7T9 C N C A L C Omnitrophica_WOR_2.A0A1G1KTB5 C R C A L C PVC group Lentisphaera_araneosa.A6DSR2 C H C A A C
C A C A L C 0.48/- Verrucomicrobia_bacterium.A0A1W9LEK0 1.0/100 Gloeochaete_wittrockiana.CAMPEP_0184660528 Glaucophyta C K C A A C Cyanophora_paradoxa.CAMPEP_0184339498 1.0/100 Symbiodinium_sp.CAMPEP_0192588340 0.43/87 Alexandrium_temarense.CAMPEP_0186194250 Dinophyta D K G A G G 0.65/98 Alexandrium_monilatum.CAMPEP_0200681622 D K G A G G 1.0/100 0.34/- Eutreptiella_gymnastica D R S A S S 1.0/100 Euglena_gracilis Euglenozoa 0.99/50
1.0/99 Pyramimonas_parkae D Q S A S S
0.85/97 Chlorella_variabilis.E1Z2D1 D Q S A A S
Coccomyxa_subellipsoidea_384249812 D T S A K S 0.99/99 0.5/- 1.0/100 Ostreococcus_tauri_308813203 D E S A R V Micromonas_pusilla.C1N868 Viridiplantae Marchantia_polymorpha.A0A176W408 D R S A Q S 0.28/- D R S A K S 0.97/100 Selaginella_moellendorffii_gi_302818061 Physcomitrella_patens_gi_168065377_ D R S A K S 0.35/- 0.54/- Klebsormidium_flaccidum.A0A1Y1HM25 D R S A K S 0.39/- Arabidopsis_thaliana_gi_21592386_ D R S A Q S 0.47/85 Cyanidioschyzon_merolae.M1UWE1 C R C A A C
Galdieria_sulphuraria_gi_452820923 C S C A S C
0.99/99 C R C A E C 0.39/- Madagascaria_erythrocladiodes.CAMPEP_0198316958 C R C A L C Chondrus_crispus.R7Q4I6 Rhodophyta C R C A L C 0.45/- Rhodosorus_marinus.CAMPEP_0113964354 chHCF
C R C A L C 0.34/91 0.79/- Porphyridium_aerugineum.CAMPEP_0184708468 0.98/98 0.99/100 Erythrolobus_madagascarensis.CAMPEP_0185850542 C R C A V C Porphyra_umbilicalis.A0A1X6NM15 C R C A Q C
Ectocarpus_siliculosus.D7FMK8 C R C A L C Stramenopila 0.36/98 Nannochloropsisgi_585111142_gb_EWM28719.1 C R C A M C
0.83/99 C R C A A C 0.83/95 Vitrella_brassicaformis.A0A0G4EPR6 Chromerida Chromera_velia.A0A0G4FIP2 C R C A L C
0.91/- Phaeodactylum_tricornutum.jgi.18654 C R C A A C
C R C A A C 0.99/100 1.0/100 Thalassiosira_pseudonana_gi_XP_002293925 Stramenopila 0.44/- Thalassiosira_oceanica.K0T9L9 C R C A S C
Fistulifera_solaris.A0A1Z5JLB2 C R C A A C
1.0/100 Bigelowiella_natans.jgi.132106 C R S P T N 0.99/98 Chlorarachniophyta 0.71/- C R S P T N 0.49/50 Lotharella_globosa.CAMPEP_0202693732 0.96/90 Guillardia_theta.L1K1Z4 C R S P A N
0.99/100 Geminigera_cryophila.CAMPEP_0179449570 C R S P A N
Rhodomonas.sp_CAMPEP_0191558832 C R S P A N 1.0/100 Cryptophyta 0.89/95 1.0/100 Hemiselmis_rufescens.CAMPEP_0173428798 C R S P A N
Chroomonas_mesostigmatica.CAMPEP_0206235050 C R S P A N
Exanthemachrysis_gayraliae.CAMPEP_0206032504 C R S P A N 0.81/94 Pleurochrysis_carterae.CAMPEP_0190758428 C R S P A N
0.99/100 C R S P S N 1.0/99 Isochrysis_galbana.CAMPEP_0193656872 0.98/99 Isochrysis_galbana.CAMPEP_0193689384 Haptophyta C R S P S N 1.0/100 Emiliania_huxleyi.gi.XP_005791179.1 C R S P A N
Gephyrocapsa_oceanica.CAMPEP_0188164842 +Dinophyta C R S P A N 0.4/- Karenia_brevis.CAMPEP_0188996838 C R S P S N
C R S P S N 0.34/- 0.99/97 Prymnesium_parvum.CAMPEP_0191228890 Chrysochromulina_polylepis.CAMPEP_0193734682 C R S P S N 0.48/- Ectocarpus_siliculosus.D8LK11 D P A T G E
Blastocystis_sp..A0A196S6Y7 C Q C S K C 0.52/- 1.0/100 Albugo_laibachiigi_325186587_emb_CCA21133.1 C R C A Q C
Albugo_candidagi_635366393_emb_CCI45349.1 C R C A Q C 0.99/100 Stramenopila 1.0/100 Saprolegnia_diclina_gi_530742964 C R C A A C 1.0/100 Aphanomyces_astaci.W4FYD1 C R C A Q C
Aphanomyces_invadansgi_673027656_ref_XP_008867789.1 C R C A Q C 0.36/- Phytophthora_parasiticagi_570969613_gb_ETP32732.1 C R C A Q C 0.97/100 Plasmopara_halstedii.A0A0N7L5Z8 C R C A Q C 0.99/100 Cryptomonas_paramecium.CAMPEP_0172166586 Cryptomonas_curvata.CAMPEP_0172166586 0.99/100 C Q A A K S 0.99/100 Hanusia_phi.CAMPEP_0169512202 Cryptophyta Geminigera_cryophila.CAMPEP_0179495378 C L S A K K 0.79/96 C R C A G C 0.57/- 1.0/100 Hemiselmis_rufescens.CAMPEP_0173429308 Chroomonas_mesostigmatica.CAMPEP_0206242118 C R C A V C
Schizochytrium_aggregatum.CAMPEP_0191599164 L R K V D D 0.12/- 1.0/100 Phaeodactylum_tricornutum.jgi.41927 Stramenopila D P K T G N Thallassiosira_pseudonana.XP_002290238 D P K T G E 0.39/- 0.81/96 0.99/100 Isochrysis_galbana.CAMPEP_0193634094 R GA E P D 0.99/100 Isochrysis_galbana.CAMPEP_0193627372 A N V E E C
1.0/100 Emiliania_huxleyi.R1EBI0 R G G A G A 0.62/- 1.0/100 0.33/- Gephyrocapsa_oceanica.CAMPEP_0188165672 Haptophyta R G G A G A 0.7/- Pleurochrysis_carterae.CAMPEP_0190804586 P G A P A G
Chrysochromulina_polylepis.CAMPEP_0193792872 E G G P G A Exanthemachrysis_gayraliae.CAMPEP_0206024806 S R D A A T
0.29/- Spongospora_subterranea.A0A0H5RAN6 C Q C A L C mHCF
Lotharella_globosa.CAMPEP_0202693732 C K S A G N Rhizaria 0.34/80 0.99/98 Reticulomyxa_filosa.X6N870 C K C A L C 1.0/100 Elphidium_margaritaceum.CAMPEP_0202707210 0.72/96 Ammonia_sp.CAMPEP_0197078946 C K C A L C
1.0/100 Stylonychiagi_678309978_emb_CDW89606.1 C K C A G C
0.97/100 Oxytricha_trifallax.J9IHW4 C K C A A C
0.99/100 Paramecium_tetraurelia_gi_145515401 C N C A L C 0.99/100 Paramecium_tetraurelia_gi_145487614 C N C A L C
Tetrahymena_thermophila.I7M713 C N C A L C
1.0/100 Karenia_brevis.CAMPEP_0189447674 C R S A K M 0.17/- Symbiodinium_sp.CAMPEP_0192603282 C R S A N M 0.85/- 0.95/94 Oxyrrhis_marina.CAMPEP_0190318896 C Q S A K M
1.0/100 Dinophysis_acuminata_DAEP01 Alveolata C R C A H C 0.51/- 0.99/100 Alexandrium_temarense.CAMPEP_0186403332 Alexandrium_monilatum.CAMPEP_0186403324 C Q C A S C 0.86/- 0.99/99 Chromera_velia.23131.t1 C R C A E C 0.99/99 Vitrella_brassicaformis.A0A0G4H493 C R C A E C Perkinsus_marinus.C5KDC8
1.0/100 Toxoplasma_gondii.gi.237841001 C Q C K S C
Cystoisospora_suis.A0A2C6LFW4 C T C K E C
0.3
Figures
Figure 1
Predictions of N-terminal targeting sequences for chloroplast (chHCF101) and mitochondrial versions of HCF101 (mHCF101) in selected alveolates and stramenopiles. Red color highlights the mitochondrial leader sequence with cleavage sites predicted with Mitofates (star), TargetP 2 (circle), and PSORT II (triangle). Yellow color indicates a signal peptide, which is cleaved right before the phenylalanine residue, a typical feature for signal peptide cleavage in diatoms. This cleavage site was predicted with high support by the TargetP, Signal P, and HECTAR algorithms. Green represents a predicted transit peptide with two possible cleavage sites for stromal processing pe ptidase, manually predicted based on previous studies [82]. Gray color highlights conserved residues. Figure 2
Localization of Nbp35-like proteins in diatoms. Genes for chHCF101, mHCF101, and Nbp35 from P. tricornutum and T. pseudonana were expressed in P. tricornutum with C terminal e-GFP tag (green). PAF, plastid auto uorescence (red); MitoT, MitoTracker Orange (blue); DIC, differential interference contrast. Scale bar 10μm. Figure 3
Localization of Nbp35 and mHCF101 in T. thermophila and T. gondii. Nbp35 and mHCF101 were expressed under the control of their respective native promoter with a C terminal HA tag (green). Speci c polyclonal antibodies against F1-ATPase (red), and HSP60 (red) were used as mitochondrial and apicoplastidal markers, respectively. MitoT, Mitotracker Red, (red); DIC, differential interference contrast. Scale bar 10 μm (T. thermophila) and 5 μm (T. gondii). Figure 4
A phylogenetic tree of the Nbp35-like proteins (the ParA family). The tree was built using FastTree, and nodes with support below 0.9 were collapsed (see materials and methods). The leaves are color coded to indicate taxonomy (8840 sequences), with annotations of selected sequences. The scale bar represents the estimated number of amino acid substitutions per site. Figure 5
Phylogeny of HCF101 proteins.The tree was built using the PhyloBayes CAT Poisson mixture model. Numbers at nodes of the tree indicate statistical support in the form of posterior probability of the PhyloBayes analysis and an ultrafast bootstrap of the IQ-Tree analysis (see materials and methods). The scale bar represents the estimated number of amino acid substitutions per site. The conserved cysteine motif in the DUF971 domain is displayed for each protein sequence when available. Figure 6
Scheme of HCF101 evolution. A. HCF101 distribution explained via the Chromalveolate hypothesis. Upon the acquisition of HCF101-like protein via LGT from bacteria to the ancestor of Archeplastida, chHCF101 was established in the plastid. Euglenozoa gained HCF101 via secondary endosymbiosis with a donor containing green plastid. A common ancestor of Chromalveolata gained red plastid via secondary endosymbiosis, the gene for chHCF101 was duplicated and one copy was targeted to mitochondria (mHCF101), where it replaced the Ind1 gene. mHCF101 is common to all chromalveolates, while several lineages lost chHCF101 together with loss of the secondary plastid (Cryptosporidium, Ciliates, Oomycota, centrohelids, catablepharids). B. HCF101 distribution explained via ‘multiple secondary endosymbiosis’. Mitochondrially localized HCF101 together with Ind1 was present in a common ancestor of Archaeplastida, SAR, Cryptista, and Haptista. Then, in (i) Cryptista and in (ii) a common ancestor of Haptista and SAR, the Ind1 gene was lost, whereas the Archaeplastida gene for the Ind1 protein remained in the mitochondria, and mHCF101 was retargeted to the plastid. Then, chHCF101 was introduced to Cryptophytes, Haptophytes, and certain SAR groups via multiple secondary endosymbiosis. chHCF101 is absent in lineages that did not experience secondary endosymbiosis. PR, protein retargeting; GL, gene loss; GD, gene duplication; PL, plastid loss; PES, primary endosymbiosis; SES, secondary endosymbiosis; TES, tertiary endosymbiosis.
Supplementary Files
This is a list of supplementary les associated with this preprint. Click to download.
TableS1JT.xlsx TableS2domainpredictions.xlsx