DOCSLIB.ORG

ABCDEF Supplementary Figure S1

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
ABCDEF Supplementary Figure S1 01-Tube-A2 : P1 01-Tube-A3 : P1 50 50 Count Count P2(0.03%) P2(9.91%) 0 0 10 2 10 3 10 4 10 5 10 6 10 2 10 3 10 4 10 5 10 6 A FITC-A B FITC-A 01-Tube-A4 : P1 01-Tube-A5 : P1 60 50 40 Count Count 20 P2(9.44%) P2(9.73%) 0 0 10 2 10 3 10 4 10 5 10 6 10 2 10 3 10 4 10 5 10 6 C FITC-A D FITC-A 01-Tube-A8 : P1 01-Tube-A10 : P1 50 50 Count Count P2(9.80%) P2(9.22%) 0 0 10 2 10 3 10 4 10 5 10 6 10 2 10 3 10 4 10 5 10 6 E FITC-A F FITC-A Supplementary figure S1: Rate of infection of PBMC with Ab4-wt and mutant viruses. PBMC were infected with Ab4-wt or mutant viruses at an MOI of 0.1 for 24 h. Infected PBMC were sorted based on egfp expression using FACSAria (BD Bioscience) and used for transwell co-cultivation and flow chamber experiments. (A) mock infected (B) Ab4-wt, (C) Ab4∆ORF1 (D) Ab4∆ORF2 (E) Ab4∆ORF17) and (F) Ab4∆/ORF1/ORF2/ORF17 infected PBMC at 24 hrs post infection. P2 indicates percentage of egfp positive PBMC. (n=4) Pathways upregulated Pathways downregulated Infected Pathways Genes Pathways Genes population Lysosome ATPase H+ transporting V0 subunit d1 Herpesvirus CD58 molecule Adaptor related protein complex 3 mu 1 infection Proteasome 26S subunit, non-ATPase 2 subunit recombination signal binding protein for Adaptor related protein complex 3 mu 2 immunoglobulin kappa J region like subunit recombination signal binding protein for Scavenger receptor class B member 2 immunoglobulin kappa J region Ras signaling RAP1A, member of RAS oncogene family pathway Phosphoinositide-3-kinase regulatory subunit 1 Ras-related protein Rap-1A Endocytosis EH domain containing 1 Spliceosome LSM6 homolog, U6 small nuclear RNA and PBMC EH domain containing 3 mRNA degradation associated Vs RAB35, member RAS oncogene family RNA binding motif protein 22 Ab4-wt RAB5A, member RAS oncogene family Cell division cycle 40 Platelet RAP1A, member of RAS oncogene family Squamous cell carcinoma antigen recognized by activation Phosphoinositide-3-kinase regulatory T-cells 1 Leukocyte subunit 1 Chemokine RAP1A, member of RAS oncogene family transendothelial Ras-related protein Rap-1A signaling Mitogen-activated protein kinase kinase 1 migration pathway Stress induced phosphoprotein 1 Oxidative ATP synthase, H+ transporting, RNA TNFRSF1A associated via death domain phosphorylation mitochondrial F1 complex, alpha subunit 1 degradation Chromodomain helicase DNA binding protein 4 ATPase H+ transporting V0 subunit d1 LSM6 homolog, U6 small nuclear RNA and NADH:ubiquinone oxidoreductase core mRNA degradation associated subunit V1 RNA binding motif protein 22 Fatty acid Hydroxysteroid 17-beta dehydrogenase 12 Apoptosis Apoptosis inducing factor, mitochondria elongation Mitochondrial trans-2-enoyl-CoA reductase associated 1 Caspase 1, apoptosis-related cysteine peptidase Caspase 10 MALT1 paracaspase Herpesvirus CD58 molecule Chemokine RAP1A, member of RAS oncogene family infection TNFRSF1A associated via death domain signaling Mitogen-activated protein kinase kinase 1 Proteasome 26S subunit, non-ATPase 12 pathway Ras-related protein Rap-1A Recombination signal binding protein for Stress induced phosphoprotein 1 immunoglobulin kappa J region like Recombination signal binding protein for PBMC immunoglobulin kappa J region l Vs Lysosome ATPase H+ transporting V0 subunit d1 MAPK Protein phosphatase 5 catalytic subunit Ab4∆ORF17 Adaptor related protein complex 3 mu 1 signaling RAP1A, member of RAS oncogene family subunit pathway Mitogen-activated protein kinase kinase 1 Adaptor related protein complex 3 mu 2 Ras-related protein Rap-1A subunit Scavenger receptor class B member 2 Oxidative ATP synthase, H+ transporting, phosphorylation mitochondrial F1 complex, alpha subunit 1 RNA transport RNA binding motif protein 22 ATPase H+ transporting V0 subunit d1 Pre-mRNA processing factor 3 NADH:ubiquinone oxidoreductase core NOP2/Sun RNA methyltransferase family subunit V1 member 2 Protein ER membrane protein complex subunit 1 Ribosomal RNA processing 1B processing in Endoplasmic reticulum lectin 1 Spliceosome LSM6 homolog, U6 small nuclear RNA and endoplasmic Serine/threonine-protein phosphatise 6 mRNA degradation associated reticulum and Fc catalytic subunit RNA binding motif protein 22 epsilon RI Receptor-type tyrosine-protein phosphatase Cell division cycle 40 signaling epsilon Squamous cell carcinoma antigen recognized by T-cells 1 Metabolic 24-dehydrocholesterol reductase pathways T-cell immune regulator 1, ATPase H+ transporting V0 subunit a3 Acetyl-CoA acetyltransferase 2 Acyl-CoA synthetase long-chain family member 3 Adenosylhomocysteinase like 1 Adenosylhomocysteinase like 2 Branched chain amino acid transaminase 2 Ceramide synthase 2 Inositol polyphosphate-1-phosphatase Methylcrotonoyl-CoA carboxylase 1 Methylcrotonoyl-CoA carboxylase 2 Phosphatidylinositol glycan anchor biosynthesis class U Phospholipase B1 Pyruvate dehydrogenase complex component mTOR signaling 3-phosphoinositide dependent protein Metabolic ATP synthase, H+ transporting, mitochondrial F1 pathway kinase 1 pathways complex, epsilon subunit (ATP5E) Ras related GTP binding C ATPase H+ transporting V0 subunit a1 Ras related GTP binding D NADH:ubiquinone oxidoreductase core subunit Phosphatidylinositol-4,5-bisphosphate 3- V1 kinase catalytic subunit gamma Aconitase 1 PBMC Herpesvirus CD58 molecule Fucokinase Vs infection Phosphatidylinositol-4,5-bisphosphate 3- Galactosidase beta 1 Ab4∆ORF1 kinase catalytic subunit gamma Hydroxysteroid 17-beta dehydrogenase 12 Proteasome 26S subunit, non-ATPase 12 Mannosidase alpha class 2A member 1 Lysosome ATPase H+ transporting V0 subunit d1 Thymidine phosphorylase Adaptor related protein complex 3 mu 1 subunit Adaptor related protein complex 3 mu 2 subunit Scavenger receptor class B member 2 Chemokine RAP1A, member of RAS oncogene family Spliceosome LSM6 homolog, U6 small nuclear RNA and signaling Mitogen-activated protein kinase kinase 1 mRNA degradation associated pathway Ras-related protein Rap-1A RNA binding motif protein 22 Stress induced phosphoprotein 1 Cell division cycle 40 Squamous cell carcinoma antigen recognized by T-cells 1 Platelet RAP1A, member of RAS oncogene family RNA TNFRSF1A associated via death domain activation Phosphoinositide-3-kinase regulatory degradation Chromodomain helicase DNA binding protein 4 Leukocyte subunit 1 LSM6 homolog, U6 small nuclear RNA and transendothelial Ras-related protein Rap-1A mRNA degradation associated migration CD58 molecule RNA binding motif protein 22 Focal adhesion RAP1A, member of RAS oncogene family Aminoacyl- Histidyl-tRNA synthetase 2, mitochondrial and Ras signaling Phosphoinositide-3-kinase regulatory tRNA Histidyl-tRNA synthetase pathway subunit 1 biosynthesis phenylalanyl-tRNA synthetase beta subunit Ras-related protein Rap-1A Endocytosis EH domain containing 1 EH domain containing 3 RAB35, member RAS oncogene family Herpesvirus CD58 molecule Spliceosome LSM6 homolog, U6 small nuclear RNA and infection proteasome 26S subunit, non-ATPase 12 mRNA degradation associated proteasome 26S subunit, non-ATPase 2 RNA binding motif protein 22 mTOR signaling 3-phosphoinositide dependent protein Cell division cycle 40 kinase 1 Squamous cell carcinoma antigen recognized by Ras related GTP binding C T-cells 1 Ras related GTP binding D Phosphatidylinositol-4,5-bisphosphate 3- kinase catalytic subunit gamma PBMC Regulation of FYVE, RhoGEF and PH domain containing 3 RNA TNFRSF1A associated via death domain Vs actin Integrin subunit beta degradation Chromodomain helicase DNA binding protein 4 Ab4∆ORF2 cytoskeleton Phosphatidylinositol-4,5-bisphosphate 3- LSM6 homolog, U6 small nuclear RNA and kinase catalytic subunit gamma mRNA degradation associated Phosphatidylinositol-5-phosphate 4-kinase RNA binding motif protein 22 type 2 gamma Protein phosphatase 1 regulatory subunit 12A Chemokine RAP1A, member of RAS oncogene family MAPK RAP1A, member of RAS oncogene family signaling Mitogen-activated protein kinase kinase 1 signaling Interleukin 1 alpha pathway Ras-related protein Rap-1A pathway Protein phosphatase 5 catalytic subunit Stress induced phosphoprotein 1 Ras-related protein Rap-1A Ribosomal protein S6 kinase A5 Endocytosis EH domain containing 1 Spliceosome LSM6 homolog, U6 small nuclear RNA and EH domain containing 3 mRNA degradation associated RAB35, member RAS oncogene family RNA binding motif protein 22 RAB5A, member RAS oncogene family Cell division cycle 40 Herpesvirus CD58 molecule Squamous cell carcinoma antigen recognized by infection proteasome 26S subunit, non-ATPase 12 T-cells 1 proteasome 26S subunit, non-ATPase 2 Lysosome ATPase H+ transporting V0 subunit d1 MAPK RAP1A, member of RAS oncogene family Adaptor related protein complex 3 mu 1 signaling Interleukin 1 alpha subunit pathway Protein phosphatase 5 catalytic subunit Adaptor related protein complex 3 mu 2 Ras-related protein Rap-1A PBMC subunit Ribosomal protein S6 kinase A5 Vs Scavenger receptor class B member 2 Ab4∆ORF1/ Chemokine RAP1A, member of RAS oncogene family ORF2/ORF17 signaling Mitogen-activated protein kinase kinase 1 TNFRSF1A associated via death domain pathway Ras-related protein Rap-1A RNA Chromodomain helicase DNA binding protein 4 Stress induced phosphoprotein 1 degradation LSM6 homolog, U6 small nuclear RNA and T cell signaling T-cell immune regulator 1, ATPase H+ mRNA degradation associated transporting V0 subunit a3 RNA binding motif protein 22 Squamous cell carcinoma antigen recognized by T-cells 1 Phosphatidylinositol-4,5-bisphosphate 3- kinase catalytic subunit gamma Phosphatidylinositol-5-phosphate 4-kinase type 2 gamma
Load more

Recommended publications
  • Fluorinated Mannosides Inhibit Cellular Fucosylation
    Fluorinated mannosides inhibit cellular fucosylation. Johan F.A. Pijnenborg[a],†, Emiel Rossing[a],†, Marek Noga[b], Willem Titulaer[a], Raisa Veizaj[c], Dirk J. Lefeber[b,c] and Thomas J. Boltje*[a] [a] J.F.A. Pijnenborg, E. Rossing, W. Titulaer, Dr. T.J. Boltje Department of Synthetic Organic Chemistry Institute for Molecules and Materials, Radboud University Heyendaalseweg 135, 6525AJ, Nijmegen, The Netherlands [email protected] [b] Dr. M. Noga, Prof. D.J. Lefeber Department of Laboratory Medicine, Translational Metabolic Laboratory Radboud Institute for Molecular Life Sciences, Radboud University Medical Center Geert Grooteplein Zuid 10, 6525GA, Nijmegen, The Netherlands [c] R. Veizaj, Prof. D.J. Lefeber Department of Neurology Donders Institute for Brain, Cognition and Behavior, Radboud University Medical Center Geert Grooteplein Zuid 10, 6525GA, Nijmegen, The Netherlands [†] These authors contributed equally to this work. Supporting information for this article is given via a link at the end of the document. Abstract: Fucose sugars are expressed on mammalian cell L-Fucose (Fuc) is a 6-deoxyhexose expressed at the termini of glycan membranes as part of glycoconjugates and mediates essential chains that decorate cell surface proteins and lipids.1 The fucose physiological processes. The aberrant expression of fucosylated residues on glycoconjugates are essential mediators of physiological glycans has been linked to pathologies such as cancer, inflammation, processes. For example, the fucose moiety in the tetrasaccharide infection, and genetic disorders. Tools to modulate fucose expression sialyl Lewisx (sLex) expressed on leukocytes is recognized by selectin on living cells are needed to elucidate the biological role of fucose receptors that regulate leukocyte recruitment and extravasation.
    [Show full text]
  • An Atpase Domain Common to Prokaryotic Cell Cycle Proteins
    Proc. Natl. Acad. Sci. USA Vol. 89, pp. 7290-7294, August 1992 Biochemistry An ATPase domain common to prokaryotic cell cycle proteins, sugar kinases, actin, and hsp7O heat shock proteins (structural comparison/property pattern/remote homology) PEER BORK, CHRIS SANDER, AND ALFONSO VALENCIA European Molecular Biology Laboratory, D-6900 Heidelberg, Federal Republic of Germany Communicated by Russell F. Doolittle, March 6, 1992 ABSTRACT The functionally diverse actin, hexokinase, and hsp7O protein families have in common an ATPase domain of known three-dimensional structure. Optimal superposition ofthe three structures and alignment ofmany sequences in each of the three families has revealed a set of common conserved residues, distributed in five sequence motifs, which are in- volved in ATP binding and in a putative interdomain hinge. From the multiple sequence aliment in these motifs a pattern of amino acid properties required at each position is defined. The discriminatory power of the pattern is in part due to the use of several known three-dimensional structures and many sequences and in part to the "property" method ofgeneralizing from observed amino acid frequencies to amino acid fitness at each sequence position. A sequence data base search with the pattern significantly matches sugar kinases, such as fuco-, glucono-, xylulo-, ribulo-, and glycerokinase, as well as the prokaryotic cell cycle proteins MreB, FtsA, and StbA. These are predicted to have subdomains with the same tertiary structure as the ATPase subdomains Ia and Ha of hexokinase, actin, and Hsc7O, a very similar ATP binding pocket, and the capacity for interdomain hinge motion accompanying func- tional state changes.
    [Show full text]
  • Molecular Basis for the Distinct Cellular Functions of the Lsm1-7 and Lsm2-8 Complexes
    bioRxiv preprint doi: https://doi.org/10.1101/2020.04.22.055376; this version posted April 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes Eric J. Montemayor1,2, Johanna M. Virta1, Samuel M. Hayes1, Yuichiro Nomura1, David A. Brow2, Samuel E. Butcher1 1Department of Biochemistry, University of Wisconsin-Madison, Madison, WI, USA. 2Department of Biomolecular Chemistry, University of Wisconsin School of Medicine and Public Health, Madison, WI, USA. Correspondence should be addressed to E.J.M. ([email protected]) and S.E.B. ([email protected]). Abstract Eukaryotes possess eight highly conserved Lsm (like Sm) proteins that assemble into circular, heteroheptameric complexes, bind RNA, and direct a diverse range of biological processes. Among the many essential functions of Lsm proteins, the cytoplasmic Lsm1-7 complex initiates mRNA decay, while the nuclear Lsm2-8 complex acts as a chaperone for U6 spliceosomal RNA. It has been unclear how these complexes perform their distinct functions while differing by only one out of seven subunits. Here, we elucidate the molecular basis for Lsm-RNA recognition and present four high-resolution structures of Lsm complexes bound to RNAs. The structures of Lsm2-8 bound to RNA identify the unique 2′,3′ cyclic phosphate end of U6 as a prime determinant of specificity. In contrast, the Lsm1-7 complex strongly discriminates against cyclic phosphates and tightly binds to oligouridylate tracts with terminal purines.
    [Show full text]
  • Supplementary Material Gram-Scale Production of Sugar Nucleotides And
    Electronic Supplementary Material (ESI) for Green Chemistry. This journal is © The Royal Society of Chemistry 2021 Supplementary Material Gram-scale production of sugar nucleotides and their derivatives Shuang Li[a]#, Shuaishuai Wang[b]#, Yaqian Wang[a], Jingyao Qu[c], Xian-wei Liu[a], Peng George Wang[d], and Junqiang Fang*[a] [a] Junqiang Fang, Shuang Li, Yaqian Wang, Xian-wei Liu National Glycoengineering Research Center, Shandong Provincial Key Laboratory of Glycochemistry and Glycobiology, Shandong University, Qingdao, Shandong 266237, People’s Republic of China *Email: [email protected] [b] Shuaishuai Wang Department of Chemistry, George State University, Atlanta, GA, 30302-4098, US [c] Jingyao Qu State Key Laboratory of Microbial Technology, Shandong University, Qingdao, Shandong 266237, People’s Republic of China [d] Peng George Wang School of Medicine, Southern University of Science and Technology, Shenzhen, Guangdong 518055, People’s Republic of China # These authors contributed equally to this paper. I. Supplementary Figures..................................................................................................................................1 Figure S1. Effects of GlcNAc substrate concentration on conversion rate of UDP-GlcNAc......................1 Figure S2. Effect of buffer sytem on enzymatic conversion rate of UDP-GlcNAc.....................................1 Figure S3. Evaluation of recovery and recyclability of enzymes for UDP-GlcNAc...................................1 Table S1. Enzymes used in this work
    [Show full text]
  • Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice
    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • The Role of the Salvage Pathway in Nucleotide Sugar Biosynthesis
    THE ROLE OF THE SALVAGE PATHWAY IN NUCLEOTIDE SUGAR BIOSYNTHESIS: IDENTIFICATION OF SUGAR KINASES AND NDP-SUGAR PYROPHOSPHORYLASES by TING YANG (Under the Direction of Maor Bar-Peled) ABSTRACT The synthesis of polysaccharides, glycoproteins, glycolipids, glycosylated secondary metabolites and hormones requires a large number of glycosyltransferases and a constant supply of nucleotide sugars. In plants, photosynthesis and the NDP-sugar inter-conversion pathway are the major entry points to form NDP-sugars. In addition to these pathways is the salvage pathway, a less understood metabolism that provides the flux of NDP-sugars. This latter pathway involves the hydrolysis of glycans to free sugars, sugar transport, sugar phosphorylation and nucleotidylation. The balance between glycan synthesis and recycling as well as its regulation at various plant developmental stages remains elusive as many of the molecular components are unknown. To understand how the salvage pathway contributes to the sugar flux and cell wall biosynthesis, my research focused on the functional identification of salvage pathway sugar kinases and NDP-sugar pyrophosphorylases. This research led to the first identification and enzymatic characterization of galacturonic acid kinase (GalA kinase), galactokinase (GalK), a broad UDP-sugar pyrophosphorylase (sloppy), two promiscuous UDP-GlcNAc pyrophosphorylases (GlcNAc-1-P uridylyltransferases), as well as UDP-sugar pyrophosphorylase paralogs from Trypanosoma cruzi and Leishmania major. To evaluate the salvage pathway in plant biology, we further investigated a sugar kinase mutant: galacturonic acid kinase mutant (galak) and determined if and how galak KO mutant affects the synthesis of glycans in Arabidopsis. Feeding galacturonic acid to the seedlings exhibited a 40-fold accumulation of free GalA in galak mutant, while the wild type (WT) plant readily metabolizes the fed-sugar.
    [Show full text]
  • Role and Regulation of the P53-Homolog P73 in the Transformation of Normal Human Fibroblasts
    Role and regulation of the p53-homolog p73 in the transformation of normal human fibroblasts Dissertation zur Erlangung des naturwissenschaftlichen Doktorgrades der Bayerischen Julius-Maximilians-Universität Würzburg vorgelegt von Lars Hofmann aus Aschaffenburg Würzburg 2007 Eingereicht am Mitglieder der Promotionskommission: Vorsitzender: Prof. Dr. Dr. Martin J. Müller Gutachter: Prof. Dr. Michael P. Schön Gutachter : Prof. Dr. Georg Krohne Tag des Promotionskolloquiums: Doktorurkunde ausgehändigt am Erklärung Hiermit erkläre ich, dass ich die vorliegende Arbeit selbständig angefertigt und keine anderen als die angegebenen Hilfsmittel und Quellen verwendet habe. Diese Arbeit wurde weder in gleicher noch in ähnlicher Form in einem anderen Prüfungsverfahren vorgelegt. Ich habe früher, außer den mit dem Zulassungsgesuch urkundlichen Graden, keine weiteren akademischen Grade erworben und zu erwerben gesucht. Würzburg, Lars Hofmann Content SUMMARY ................................................................................................................ IV ZUSAMMENFASSUNG ............................................................................................. V 1. INTRODUCTION ................................................................................................. 1 1.1. Molecular basics of cancer .......................................................................................... 1 1.2. Early research on tumorigenesis ................................................................................. 3 1.3. Developing
    [Show full text]
  • Trna Into a Serine-Inserting Trna
    Proc. Natl. Acad. Sci. USA Vol. 89, pp. 5680-5684, June 1992 Biochemistry Eight base changes are sufficient to convert a leucine-inserting tRNA into a serine-inserting tRNA JENNIFER NORMANLY*, TRACY OLLICKt, AND JOHN ABELSON Division of Biology, California Institute of Technology, Pasadena, CA 91125 Contributed by John Abelson, February 26, 1992 ABSTRACT Each aminoacyl-tRNA synthetase must func- retrospect, this should have been clear early on when it was tionally dtgh its cognate tRNAs from all others. We have discovered that the amber suppressor allele ofa tRNATrP gene determined the minimum number of changes required to inserts glutamine (22). Recently, we have synthesized amber transform a leucine amber suppressor tRNA to serine identity. suppressor tRNA genes for all 20 isoaccepting groups in E. coli Eight changes are required. These are located in the acceptor (23, 24). Five ofthese tRNAs (Ile-1, Gly-2, Metf, Glu, and Trp) stem and in the D stem. insert glutamine and six others (Ile-2, Arg, Metm, Asp, Thr, and Val) insert lysine (25). This result confirms Kisselev and Correct recognition of tRNAs by aminoacyl-tRNA syn- Frolova's (26) and Schulman and Goddard's (27) long-held thetases (AASs) is a prerequisite for accurate protein synthesis conviction that AASs recognize anticodon nucleotides, and in the cell. Each of the 20 AASs must recognize and ami- there is now much additional evidence to support that notion noacylate its own set of isoaccepting tRNAs and reject all (2). Recently, Schulman and coworkers (28, 29) have inserted others. Elements that facilitate the aminoacylation ofa tRNA different anticodons into the E.
    [Show full text]
  • LSM6 Rabbit Polyclonal Antibody – TA343774 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA343774 LSM6 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the N terminal of human LSM6. Synthetic peptide located within the following region: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 9 kDa Gene Name: LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated Database Link: NP_009011 Entrez Gene 11157 Human P62312 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 LSM6 Rabbit Polyclonal Antibody – TA343774 Background: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061).
    [Show full text]
  • Genetic Networks Required to Coordinate Chromosome Replication by DNA Polymerases A, D, and E in Saccharomyces Cerevisiae
    INVESTIGATION Genetic Networks Required to Coordinate Chromosome Replication by DNA Polymerases a, d, and e in Saccharomyces cerevisiae Marion Dubarry,* Conor Lawless,* A. Peter Banks,† Simon Cockell,‡ and David Lydall*,1 *Institute for Cell and Molecular Biosciences, Faculty of Medical Sciences, †High Throughput Screening Facility, Newcastle Biomedicine, and ‡Bioinformatics Support Unit, Faculty of Medical Sciences, Newcastle University, Newcastle upon Tyne, NE2 4HH, United Kingdom ORCID IDs: 0000-0002-4186-8506 (C.L.); 0000-0003-2478-085X (D.L.) ABSTRACT Three major DNA polymerases replicate the linear eukaryotic chromosomes. DNA polymerase KEYWORDS a-primase (Pol a) and DNA polymerase d (Pol d) replicate the lagging-strand and Pol a and DNA polymerase e DNA replication (Pol e) the leading-strand. To identify factors affecting coordination of DNA replication, we have performed DNA polymerase genome-wide quantitative fitness analyses of budding yeast cells containing defective polymerases. We Profilyzer combined temperature-sensitive mutations affecting the three replicative polymerases, Pol a,Pold,and DIXY Pol e with genome-wide collections of null and reduced function mutations. We identify large numbers of quantitative genetic interactions that inform about the roles that specific genes play to help Pol a,Pold, and Pol e function. fitness analyses Surprisingly, the overlap between the genetic networks affecting the three DNA polymerases does not (QFA) represent the majority of the genetic interactions identified. Instead our data support a model for division of Saccharomyces labor between the different DNA polymerases during DNA replication. For example, our genetic interaction cerevisiae data are consistent with biochemical data showing that Pol e is more important to the Pre-Loading complex than either Pol a or Pol d.
    [Show full text]
  • Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation
    BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
    [Show full text]