EFEMP2 Monoclonal Antibody (M37), Clone 1C2

EFEMP2 monoclonal antibody (M37), clone 1C2 Catalog # : H00030008-M37 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full-length recombinant Western Blot (Recombinant protein) Description: EFEMP2. ELISA Immunogen: EFEMP2 (AAH10456.1, 26 a.a. ~ 443 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: SPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCIN HYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCV DVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRY RYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRC FNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRF SCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRCVDTN RCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQ ATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLD LEMVTMNSLMSYRASSVLRLTVFVGAYTF Host: Mouse Reactivity: Human Isotype: IgG2a Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (71.61 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: Datasheet: Download Applications Western Blot (Recombinant protein) Protocol Download ELISA Gene Information Page 1 of 2 2016/5/23 Entrez GeneID: 30008 GeneBank BC010456.1 Accession#: Protein AAH10456.1 Accession#: Gene Name: EFEMP2 Gene Alias: FBLN4,MBP1,UPH1 Gene EGF-containing fibulin-like extracellular matrix protein 2 Description: Omim ID: 219100, 604633 Gene Ontology: Hyperlink Gene Summary: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. The protein encoded by this gene contains four EGF2 domains and six calcium-binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome. [provided by RefSeq Other fibulin 4,fibulin-like extracellular matrix protein,mutant p53 binding Designations: protein 1 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2016/5/23.

Copy Link

Recommended publications

Supplemental Figure 1. Vimentin
Double mutant specific genes Transcript gene_assignment Gene Symbol RefSeq FDR Fold- FDR Fold- FDR Fold- ID (single vs. Change (double Change (double Change wt) (single vs. wt) (double vs. single) (double vs. wt) vs. wt) vs. single) 10485013 BC085239 // 1110051M20Rik // RIKEN cDNA 1110051M20 gene // 2 E1 // 228356 /// NM 1110051M20Ri BC085239 0.164013 -1.38517 0.0345128 -2.24228 0.154535 -1.61877 k 10358717 NM_197990 // 1700025G04Rik // RIKEN cDNA 1700025G04 gene // 1 G2 // 69399 /// BC 1700025G04Rik NM_197990 0.142593 -1.37878 0.0212926 -3.13385 0.093068 -2.27291 10358713 NM_197990 // 1700025G04Rik // RIKEN cDNA 1700025G04 gene // 1 G2 // 69399 1700025G04Rik NM_197990 0.0655213 -1.71563 0.0222468 -2.32498 0.166843 -1.35517 10481312 NM_027283 // 1700026L06Rik // RIKEN cDNA 1700026L06 gene // 2 A3 // 69987 /// EN 1700026L06Rik NM_027283 0.0503754 -1.46385 0.0140999 -2.19537 0.0825609 -1.49972 10351465 BC150846 // 1700084C01Rik // RIKEN cDNA 1700084C01 gene // 1 H3 // 78465 /// NM_ 1700084C01Rik BC150846 0.107391 -1.5916 0.0385418 -2.05801 0.295457 -1.29305 10569654 AK007416 // 1810010D01Rik // RIKEN cDNA 1810010D01 gene // 7 F5 // 381935 /// XR 1810010D01Rik AK007416 0.145576 1.69432 0.0476957 2.51662 0.288571 1.48533 10508883 NM_001083916 // 1810019J16Rik // RIKEN cDNA 1810019J16 gene // 4 D2.3 // 69073 / 1810019J16Rik NM_001083916 0.0533206 1.57139 0.0145433 2.56417 0.0836674 1.63179 10585282 ENSMUST00000050829 // 2010007H06Rik // RIKEN cDNA 2010007H06 gene // --- // 6984 2010007H06Rik ENSMUST00000050829 0.129914 -1.71998 0.0434862 -2.51672
[Show full text]
Supplemental Material Annexin A2-S100A10 Represents the Regulatory Component of Maxi-Cl Channel Dependent on Protein Tyrosine De
Supplemental Material Annexin A2-S100A10 Represents the Regulatory Component of Maxi-Cl Channel Dependent on Protein Tyrosine Dephosphorylation and Intracellular Ca2+ Md. Rafiqul Islama Toshiaki Okadaa Petr G. Merzlyaka,b Abduqodir H. Toychieva,c Yuhko Ando-Akatsukad Ravshan Z. Sabirova,b Yasunobu Okadaa,e aDivision of Cell Signaling, National Institute for Physiological Sciences (NIPS), Okazaki, Japan, bInstitute of Biophysics and Biochemistry, National University of Uzbekistan, Tashkent, Uzbekistan, cDepartment of Biological Sciences, State University of New York College of Optometry, New York, NY, USA, dDepartment of Cell Physiology, Faculty of Pharmaceutical Sciences, Suzuka University of Medical Science, Suzuka, Japan, eDepartment of Physiology, Kyoto Prefectural University of Medicine, Kyoto, Japan Supplementary Material Supplementary Fig. 1. Maxi-Cl currents in C127 cells were unaffected by siRNA- mediated silencing of three annexin family member genes, Anxa1, Anxa3 and Anxa11. Effects of knockdown mediated by Anxa1-specific siRNA (A), Anxa3-specific siRNA (B) and Anxa11-specific siRNA (C). Top panels: The effects on expression of ANXA mRNAs in C127 cells treated with non-targeting siRNA (cnt) or Anxa1/3/11-specific siRNA (si) detected by RT-PCR using Gapdh as a control. M: molecular size markers (100-bp ladder). These data represent triplicate experiments. Upper-middle panels: Representative time courses of Maxi-Cl current activation recorded at +25 mV after patch excision from C127 cells transfected with Anxa1/3/11-specific siRNA. Lower-middle panels: Voltage- dependent inactivation pattern of Maxi-Cl currents elicited by applying single voltage step pulses from 0 to 25 and 50 mV. Bottom panels: Summary of the effects of non-targeting siRNA (Control) and Anxa1/3/11-specific siRNA on the mean Maxi-Cl currents recorded at +25 mV.
[Show full text]
Original Article EFEMP2 Is Upregulated in Gliomas and Promotes Glioma Cell Proliferation and Invasion
Int J Clin Exp Pathol 2015;8(9):10385-10393 www.ijcep.com /ISSN:1936-2625/IJCEP0013127 Original Article EFEMP2 is upregulated in gliomas and promotes glioma cell proliferation and invasion Long Wang, Qianxue Chen, Zhibiao Chen, Daofeng Tian, Haitao Xu, Qiang Cai, Baohui Liu, Gang Deng Department of Neurosurgery, Renmin Hospital of Wuhan University, Wuhan, China Received July 19, 2015; Accepted August 25, 2015; Epub September 1, 2015; Published September 15, 2015 Abstract: Gliomas are the most common and aggressive form of primary brain tumor. Although EGF-containing fibulin-like extracellular matrix protein 2 (EFEMP2), an extracellular matrix (ECM) glycoprotein, is regarded as a candidate oncogene, little is known about the association of EFEMP2 and gliomas. Here, the expression of EFEMP2 was significantly increased in glioma tissues (n=60) compared to non-tumorous brain tissues (n=25). Silencing of EFEMP2 expression through RNA interference in two glioma cell lines (U87 and U373) remarkably inhibited cell proliferation and G1/S transition. More importantly, EFEMP2 silencing significantly induced cell apoptosis via increasing the ratio of Bax and Bcl-2. Additionally, knockdown of EFEMP2 significantly inhibited the invasive ability of both glioma cells, which was associated with the downregulated expression of metalloproteinase-2 (MMP-2) and MMP-9. In conclusion, expression of EFEMP2 was associated with the oncogenic potential of gliomas and silenc- ing of its expression can suppress cancer cell growth and metastasis. Inhibition of EFEMP2 may be a therapeutic strategy for gliomas. Keywords: Apoptosis, EFEMP2, G1/S transition, gliomas, metalloproteinase Introduction ing-EGF-like domains and a unique fibulin C-terminal domain [5].
[Show full text]
Colon Cancer Recurrence‑Associated Genes Revealed by WGCNA Co‑Expression Network Analysis
MOLECULAR MEDICINE REPORTS 16: 6499-6505, 2017 Colon cancer recurrence‑associated genes revealed by WGCNA co‑expression network analysis XIAOFENG ZHAI1,2*, QINGFENG XUE3*, QUN LIU1,2, YUYU GUO1,2 and ZHE CHEN1,2 1Department of Integrative Oncology, Changhai Hospital of Traditional Chinese Medicine, Second Military Medical University; 2Department of Integrative Oncology, Changhai Hospital, Shanghai 200433; 3Department of Anesthesiology, 264 Hospital of The People's Liberation Army, Taiyuan, Shanxi 030001, P.R. China Received March 31, 2016; Accepted March 20, 2017 DOI: 10.3892/mmr.2017.7412 Abstract. The present study aimed to identify the revealed that the function of cell adhesion, biological adhe- recurrence-associated genes in colon cancer, which may sion, extracellular matrix (ECM) organization, pathways of provide theoretical evidence for the development of novel ECM‑receptor interaction and focal adhesion were the signifi- methods to prevent tumor recurrence. Colon cancer and cantly changed terms in colon cancer. In conclusion, SERP2, matched normal samples microarray data (E-GEOD-39582) EFEMP2, FBN1, SPARC, and LINC0219 were revealed to be were downloaded from ArrayExpress. Genes with signifi- the recurrence-associated molecular and prognostic indicators cant variation were identified, followed by the screening of in colon cancer by WGCNA co‑expression network analysis. differentially expressed genes (DEGs). Subsequently, the co-expression network of DEGs was constructed using the Introduction weighted correlation network analysis (WGCNA) method, which was verified using the validation dataset. The signifi- Colon cancer is one of the most common malignant tumors, cant modules associated with recurrence in the network were with a high incident rate in the 40-50 age group.
[Show full text]
EFEMP2 Suppresses the Invasion of Lung Cancer Cells by Inhibiting Epithelial-Mesenchymal Transition (EMT) and Down-Regulating Mmps
OncoTargets and Therapy Dovepress open access to scientific and medical research Open Access Full Text Article ORIGINAL RESEARCH EFEMP2 Suppresses the Invasion of Lung Cancer Cells by Inhibiting Epithelial-Mesenchymal Transition (EMT) and Down-Regulating MMPs This article was published in the following Dove Press journal: OncoTargets and Therapy Liang Song1,* Background: Epidermal growth factor-containing fibulin-like extracellular matrix protein 2 Xiang-Xin Li2,* (EFEMP2), also known as fibulin-4, MBP1 and UPH1, is an extracellular matrix protein Xiang-Yan Liu1 associated with a variety of tumors. The purpose of this study was to investigate the Zhou Wang1 prognostic value and the function of EFEMP2 in lung cancer. Yang Yu 1 Methods: The mRNA and protein expression of EFEMP2 in lung normal and cancer tissues, lung cancer cell lines (A549, H460, H1299 and H1650) and normal epithelial cell Mo Shi1 line BEAS-2B were evaluated by immunohistochemistry, RT-qPCR and Western blotting. Bin Jiang1 1 The Public databases (Oncomine and Kaplan-Meier plotter) were used to investigate the Xiao-Peng He prognostic value of EFEMP2 in lung cancer. RNA interference (RNAi) and overexpression 1Department of Thoracic Surgery, transfection were performed to detect the effects of EFEMP2 up- or down-regulation on lung fi Shandong Provincial Hospital Af liated to normal and cancer cell proliferation, invasion and metastasis in vitro and in vivo. Shandong University, Jinan, Shandong, People’s Republic of China; 2Department Results: EFEMP2 was lowly expressed in lung cancer tissues and cells, and its low of Hematology, Qilu Hospital of expression was associated with malignant phenotype and poor prognosis of lung cancer.
[Show full text]
Large-Scale Assessment of the Gliomasphere Model System
Neuro-OncologyNeuro-Oncology Advance Access published April 25, 2016 Neuro-Oncology 2016; 0, 1–12, doi:10.1093/neuonc/now045 Large-scale assessment of the gliomasphere model system Dan R. Laks, Thomas J. Crisman, Michelle Y. S. Shih, Jack Mottahedeh, Fuying Gao, Jantzen Sperry, Matthew C. Garrett, William H. Yong, Timothy F. Cloughesy, Linda M. Liau, Albert Lai, Giovanni Coppola, and Harley I. Kornblum Department of Biological Chemistry, University of California, Los Angeles, California (D.R.L.); Department of Psychiatry and Downloaded from Biobehavioral Sciences and Semel Institute for Neuroscience & Human Behavior, University of California, Los Angeles, California (T.J.C., M.Y.S.S., J.M., F.G., M.C.G., G.C., H.I.K.); Department of Pharmacology, University of California, Los Angeles, California (J.S.); Department of Pathology, University of California, Los Angeles, California (W.H.Y.); Department of Neurology, University of California, Los Angeles, California (T.F.C., A.L., G.C.); Department of Neurosurgery, University of California, Los Angeles, California (L.M.L.); Eli and Edythe Broad Center of Regenerative Medicine and Stem Cell Research, University of California, Los Angeles, California (H.I.K.); The Jonsson Comprehensive Cancer Center, University of California, Los Angeles, California (W.H.Y., T.F.C., L.M.L., A.L., H.I.K.) http://neuro-oncology.oxfordjournals.org/ Corresponding Authors: Harley I. Kornblum, MD, PhD, Room 379 Neuroscience Research Building, 635 Charles E. Young Dr. South, Los Angeles, CA 90095 ([email protected]); Giovanni Coppola, MD, 695 Charles E. Young Dr. South, Los Angeles CA 90095 ([email protected]).
[Show full text]
Fibroblasts from the Human Skin Dermo-Hypodermal Junction Are
cells Article Fibroblasts from the Human Skin Dermo-Hypodermal Junction are Distinct from Dermal Papillary and Reticular Fibroblasts and from Mesenchymal Stem Cells and Exhibit a Specific Molecular Profile Related to Extracellular Matrix Organization and Modeling Valérie Haydont 1,*, Véronique Neiveyans 1, Philippe Perez 1, Élodie Busson 2, 2 1, 3,4,5,6, , Jean-Jacques Lataillade , Daniel Asselineau y and Nicolas O. Fortunel y * 1 Advanced Research, L’Oréal Research and Innovation, 93600 Aulnay-sous-Bois, France; [email protected] (V.N.); [email protected] (P.P.); [email protected] (D.A.) 2 Department of Medical and Surgical Assistance to the Armed Forces, French Forces Biomedical Research Institute (IRBA), 91223 CEDEX Brétigny sur Orge, France; [email protected] (É.B.); [email protected] (J.-J.L.) 3 Laboratoire de Génomique et Radiobiologie de la Kératinopoïèse, Institut de Biologie François Jacob, CEA/DRF/IRCM, 91000 Evry, France 4 INSERM U967, 92260 Fontenay-aux-Roses, France 5 Université Paris-Diderot, 75013 Paris 7, France 6 Université Paris-Saclay, 78140 Paris 11, France * Correspondence: [email protected] (V.H.); [email protected] (N.O.F.); Tel.: +33-1-48-68-96-00 (V.H.); +33-1-60-87-34-92 or +33-1-60-87-34-98 (N.O.F.) These authors contributed equally to the work. y Received: 15 December 2019; Accepted: 24 January 2020; Published: 5 February 2020 Abstract: Human skin dermis contains fibroblast subpopulations in which characterization is crucial due to their roles in extracellular matrix (ECM) biology.
[Show full text]
Integrin Alpha5 in Human Breast Cancer Is a Mediator of Bone Metastasis and a Therapeutic Target for the Treatment of Osteolytic Lesions
Oncogene (2021) 40:1284–1299 https://doi.org/10.1038/s41388-020-01603-6 ARTICLE Integrin alpha5 in human breast cancer is a mediator of bone metastasis and a therapeutic target for the treatment of osteolytic lesions 1,2,3 1,2 4 5,6 3 Francesco Pantano ● Martine Croset ● Keltouma Driouch ● Natalia Bednarz-Knoll ● Michele Iuliani ● 3 1,2 5 1,2 4 3 Giulia Ribelli ● Edith Bonnelye ● Harriet Wikman ● Sandra Geraci ● Florian Bonin ● Sonia Simonetti ● 3 2,7 1,2 5 3 3 Bruno Vincenzi ● Saw See Hong ● Soﬁa Sousa ● Klaus Pantel ● Giuseppe Tonini ● Daniele Santini ● Philippe Clézardin 1,2,8 Received: 10 May 2020 / Revised: 26 November 2020 / Accepted: 3 December 2020 / Published online: 8 January 2021 © The Author(s) 2021. This article is published with open access Abstract Bone metastasis remains a major cause of mortality and morbidity in breast cancer. Therefore, there is an urgent need to better select high-risk patients in order to adapt patient’s treatment and prevent bone recurrence. Here, we found that integrin alpha5 (ITGA5) was highly expressed in bone metastases, compared to lung, liver, or brain metastases. High ITGA5 1234567890();,: 1234567890();,: expression in primary tumors correlated with the presence of disseminated tumor cells in bone marrow aspirates from early stage breast cancer patients (n = 268; p = 0.039). ITGA5 was also predictive of poor bone metastasis-free survival in two separate clinical data sets (n = 855, HR = 1.36, p = 0.018 and n = 427, HR = 1.62, p = 0.024). This prognostic value remained signiﬁcant in multivariate analysis (p = 0.028).
[Show full text]
Integration of Molecular Interactome and Targeted Interaction Analysis To
www.nature.com/scientificreports OPEN Integration of Molecular Interactome and Targeted Interaction Analysis to Identify a Received: 2 November 2017 Accepted: 20 August 2018 COPD Disease Network Module Published: xx xx xxxx Amitabh Sharma1,3,4,5, Maksim Kitsak4, Michael H. Cho 1,2,3, Asher Ameli1,10, Xiaobo Zhou1,3, Zhiqiang Jiang1, James D. Crapo6, Terri H. Beaty 7, Jörg Menche8, Per S. Bakke9, Marc Santolini 1,4,5 & Edwin K. Silverman1,2,3 The polygenic nature of complex diseases ofers potential opportunities to utilize network-based approaches that leverage the comprehensive set of protein-protein interactions (the human interactome) to identify new genes of interest and relevant biological pathways. However, the incompleteness of the current human interactome prevents it from reaching its full potential to extract network-based knowledge from gene discovery eforts, such as genome-wide association studies, for complex diseases like chronic obstructive pulmonary disease (COPD). Here, we provide a framework that integrates the existing human interactome information with experimental protein- protein interaction data for FAM13A, one of the most highly associated genetic loci to COPD, to fnd a more comprehensive disease network module. We identifed an initial disease network neighborhood by applying a random-walk method. Next, we developed a network-based closeness approach (CAB) that revealed 9 out of 96 FAM13A interacting partners identifed by afnity purifcation assays were signifcantly close to the initial network neighborhood. Moreover, compared to a similar method (local radiality), the CAB approach predicts low-degree genes as potential candidates. The candidates identifed by the network-based closeness approach were combined with the initial network neighborhood to build a comprehensive disease network module (163 genes) that was enriched with genes diferentially expressed between controls and COPD subjects in alveolar macrophages, lung tissue, sputum, blood, and bronchial brushing datasets.
[Show full text]
Extracellular Interactions Between Fibulins and Transforming Growth Factor (TGF)-Β in Physiological and Pathological Conditions
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Jefferson Digital Commons Thomas Jefferson University Jefferson Digital Commons Department of Pediatrics Faculty Papers Department of Pediatrics 9-17-2018 Extracellular Interactions between Fibulins and Transforming Growth Factor (TGF)-β in Physiological and Pathological Conditions. Takeshi Tsuda Thomas Jefferson University, [email protected] Let us know how access to this document benefits ouy Follow this and additional works at: https://jdc.jefferson.edu/pedsfp Part of the Medical Molecular Biology Commons Recommended Citation Tsuda, Takeshi, "Extracellular Interactions between Fibulins and Transforming Growth Factor (TGF)-β in Physiological and Pathological Conditions." (2018). Department of Pediatrics Faculty Papers. Paper 80. https://jdc.jefferson.edu/pedsfp/80 This Article is brought to you for free and open access by the Jefferson Digital Commons. The effeJ rson Digital Commons is a service of Thomas Jefferson University's Center for Teaching and Learning (CTL). The ommonC s is a showcase for Jefferson books and journals, peer-reviewed scholarly publications, unique historical collections from the University archives, and teaching tools. The effeJ rson Digital Commons allows researchers and interested readers anywhere in the world to learn about and keep up to date with Jefferson scholarship. This article has been accepted for inclusion in Department of Pediatrics Faculty Papers by an authorized administrator of the Jefferson Digital Commons. For more information, please contact: [email protected]. International Journal of Molecular Sciences Review Extracellular Interactions between Fibulins and Transforming Growth Factor (TGF)-β in Physiological and Pathological Conditions Takeshi Tsuda 1,2 1 Nemours Cardiac Center, Nemours/Alfred I.
[Show full text]
Integrative Systems Biology Investigation of Fabry Disease
diseases Article Integrative Systems Biology Investigation of Fabry Disease Marco Fernandes and Holger Husi * Institute of Cardiovascular and Medical Sciences, BHF Glasgow Cardiovascular Research Centre, University of Glasgow, 126 University Place, Glasgow, G12 8TA, UK; [email protected] * Correspondence: [email protected]; Tel.: +44-141-330-6210 Academic Editor: Jose A. Sanchez-Alcazar Received: 1 September 2016; Accepted: 10 November 2016; Published: 15 November 2016 Abstract: Fabry disease (FD) is a rare X-linked recessive genetic disorder caused by a deﬁcient activity of the lysosomal enzyme alpha-galactosidase A (GLA) and is characterised by intra-lysosomal accumulation of globotriaosylceramide (Gb3). We performed a meta-analysis of peer-reviewed publications including high-throughput omics technologies including naïve patients and those undergoing enzyme replacement therapy (ERT). This study describes FD on a systems level using a systems biology approach, in which molecular data sourced from multi-omics studies is extracted from the literature and integrated as a whole in order to reveal the biochemical processes and molecular pathways potentially affected by the dysregulation of differentially expressed molecules. In this way new insights are provided that describe the pathophysiology of this rare disease. Using gene ontology and pathway term clustering, FD displays the involvement of major biological processes such as the acute inﬂammatory response, regulation of wound healing, extracellular matrix (ECM) remodelling, regulation of peptidase activity, and cellular response to reactive oxygen species (ROS). Differential expression of acute-phase response proteins in the groups of naïve (up-regulation of ORM1, ORM2, ITIH4, SERPINA3 and FGA) and ERT (down-regulation of FGA, ORM1 and ORM2) patients could be potential hallmarks for distinction of these two patient groups.
[Show full text]
Probe Set Name Symbol 1598 G at Growth Arres
Supplementary Table 2. List of stroma related genes (i.e. probe sets overexpressed in core relative to FNA biopsies of the same cancer) Probe set Name Symbol 1598_g_at growth arrest-specific 6 GAS6 200048_s_at jumping translocation breakpoint JTB 200054_at zinc finger protein 259 ZNF259 200055_at TAF10 RNA polymerase II, TATA box binding protein (TBP)-associatedTAF10 factor, 30kDa 200059_s_at ras homolog gene family, member A RHOA 200060_s_at RNA binding protein S1, serine-rich domain RNPS1 200070_at chromosome 2 open reading frame 24 C2orf24 200613_at adaptor-related protein complex 2, mu 1 subunit AP2M1 200663_at CD63 molecule CD63 200665_s_at secreted protein, acidic, cysteine-rich (osteonectin) SPARC 200671_s_at spectrin, beta, non-erythrocytic 1 SPTBN1 200696_s_at gelsolin (amyloidosis, Finnish type) GSN 200704_at lipopolysaccharide-induced TNF factor LITAF 200738_s_at phosphoglycerate kinase 1 PGK1 200760_s_at ADP-ribosylation-like factor 6 interacting protein 5 ARL6IP5 200762_at dihydropyrimidinase-like 2 DPYSL2 200770_s_at laminin, gamma 1 (formerly LAMB2) LAMC1 200771_at laminin, gamma 1 (formerly LAMB2) LAMC1 200772_x_at prothymosin, alpha PTMA 200778_s_at septin 2 2-Sep 200782_at annexin A5 ANXA5 200784_s_at low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor)LRP1 200785_s_at low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor)LRP1 200795_at SPARC-like 1 (hevin) SPARCL1 200799_at heat shock 70kDa protein 1A HSPA1A 200807_s_at heat shock 60kDa protein 1 (chaperonin) HSPD1 200811_at
[Show full text]