Summer 2021 Summer Shopping Spree: Win $4,200 in local gift cards $ IN GIFT CERTIFICATES Spree ($400 VALUE) Shopping S and a $400 Bradley Smoker PLUS A BRADLEY SMOKER

Monday, August 9, 2021 • Volume 137 Number 45 • Moosomin, Saskatchewan

CHEV•GMC•BUICK UNIVERSE SATELLITE SALES 211 Smith Dorrien St. SUV Universe Satellite is your new Esterhazy, SK 0% FINANCING MLS# SK865873 ROXOR DEALER 3 Bedrooms • 2 Bathroom UP TO in Rocanville! 72 MONTHS $149,999 On select instock SUV’s EVENT LIVING SKIES REALTY LTD. BRADLEY’S GM Amy K. Hudacek Realtor® MOOSOMIN, SK | 1-800-209-4628 | WWW.BRADLEYGM.COM WWW.UNIVERSESATELLITE.COM • 1-306-645-2669 • 1-306-435-8018 306-740-6100 | [email protected]

Publications Mail Agreement 40011909 Saskatchewan’s first community newspaper • Published weekly since 1884

From left, Zaidey Crowell, Alexis Hayden and Athena Mokelki creating aquariums as part of the Moosomin Family Resource’s summer program on Wednesday. The program has been keeping kids busy this summer with various crafts and activities each day. 21 teams here this weekend: Moosomin’s biggest ball weekend ever BY KEVIN WEEDMARK teams in the 15U, and nine teams in the We have a lot of Saskatoon teams, a lot of three age groups at a time. Obviously the Moosomin’s biggest ball weekend ever 18U. Regina teams, but teams from all over the biggest issue is hotel rooms because even is coming up this weekend, with 21 teams, “Our peewee, 13U will be playing on province. with those three big hotels on the highway 300 competitors, and 1,200 to 1,500 people Elks Field and Kinsmen Field. Our 15U “We have Moose Jaw, Saskatoon, Lums- we don’t have enough.” in total descending on the town this week- will be on Guinness Field, our bantam, den, Regina. A lot of city teams which is Why are the three provincials being held end. and our midgets are on Home Hardware good, I know they enjoy coming out here, together? “This is going to be by far the biggest Field and Co-op Field. and it’ll be good ball, it should be a great “Because of Covid, they’re trying to ball weekend Moosomin has ever seen,” “The teams will arrive Thursday night, weekend.” keep things more in one area rather than said recreation director Mike Schwean. and they’ll start games either Friday Schwean says the weekend will be far spreading them out. We’re fortunate facil- “We have 21 teams. We have 13U, 15U, morning or Friday early afternoon and bigger than any ball weekend Moosomin ity-wise, we were fortunate to have facili- and 18U baseball provincials. We have then they’ll play til Sunday. has ever hosted. ties that can accommodate them, so that’s Moosomin teams in each division. “It’s free admission to the public so they “This is bigger than anything we’ve ever a big part of it.” ´:H KDYH QLQH WHDPV LQ WKH 8 ÀYH can come out and check out the games. had. It’s unusual for them to let us host Continued on page 3 

3.5L 10 SPEED 2017 F150 KING RANCH CELEBRATION LOCAL TRADE Guy Wall: –FORD SALES– $49,900 (306) 435-0215 $199 WEEKLY Eli Tremblay (306) 434-9101 1-800-880-4533 • 306-435-3313 Check out celebrationford.com for all the amazing inventory! 2 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

Pavement on Broadway Avenue in Moosomin was sealed last week to help extend the life of the pavement. Southwest Paving is doing the slurry sealing. The town did some sealing on Park Avenue and Broadway last year, and additional sections this year. Curbing crews will soon be in Moo- somin in advance of paving crews in early September. About $800,000 is being spent on paving and curbing in Moosomin this year. Maguire furious with government’s attempt to delay Bill C-208 BY SPENCER KEMP KDYHLQ&DQDGDDQGÀVKHUVRQWKHFRDVWWKH\UHSUHVHQW gency meeting they were holding the next day that they LOCAL JOURNALISM INITIATIVE REPORTER about 3-4 per cent of all small businesses in Canada. The suddenly had this great love for small business and that Brandon-Souris MP Larry Maguire is furious that the government tried to get a motion through the Senate to they were going to implement it, that it was law and that federal government attempted to delay the implemen- JRDKHDGZLWKÀVKHUVDQGIDUPHUVEXWWDNHRXWDOORWKHU they weren’t going to go back and retroactively tax peo- tation of Bill C-208, his Private Members Bill that has small businesses in Canada. ple who have done this already, even though they do still amended the Income Tax Act to stop it from penalizing ´7KHJRYHUQPHQWUHDOO\GLGDÁLSÁRSRQWKLVRQHDQG have the right if they form a government this fall to retro- families transferring shares of small businesses or family decided that there were too many small businesses out actively tax people who were to sell their small businesses farms to their children. The government has now backed there in every one of their ridings that would be impacted to their children in the meantime. RͿWKHDWWHPSWDQGFRQFHGHGWKDWWKHDPHQGPHQWLVLQ if there was an election going on. It’s disheartening to “They have said they won’t, so we take them at their HͿHFW WKLQNWKH\KDGWRJRRXWDQGQRWVXSSRUWWKLVLQWKHÀUVW word,” said Maguire. The Bill passed the House of Commons and the Senate, place.” ´,WZDVTXLWHDÀDVFRWRKDYHWKHJRYHUQPHQWJRRXW and was granted Royal Assent on June 29. Bills without a 2Q-XO\WKHIHGHUDOJRYHUQPHQWFRQFHGHGWKDWWKH and mislead Canadians by putting out a release that says VSHFLÀHGLPSOHPHQWDWLRQGDWHZLWKLQWKHOHJLVODWLRQEH- Bill became law upon receiving Royal Assent, and re- the Bill doesn’t have an implementation date so we’ll come law the day they receive Royal Assent, but in a press tracted the previous statement claiming it would not be make one up, when they knew full well that the witnesses release the Finance Ministry attempted to delay the bill, implemented until 2022. who came forward were the former speaker of the house VD\LQJLWZRXOGQRWWDNHHͿHFWXQWLO-DQXDU\ ´$IWHUÀJKWLQJWKH%LOOIRUGD\VLQWKH+RXVHDQG and the former Liberal House Leader that indicated that “The Department of Finance put out a statement on DQRWKHULQ-XO\WKHJRYHUQPHQWÀQDOO\FDPHRXWDW the government was wrong and the Bill, once it got Royal June 30 right after the Bill became law, receiving Royal pm the day before while I was on my way to the emer- Assent, was law.” Assent on the night of the 29th. The government didn’t like this Bill for some reason even though every small EXVLQHVVKDVJLYHQDFFRODGHVIRULWDQGRIWKHLURZQ Liberal members voted for it and the Senate passed it. We had to call an emergency meeting to deal with the govern- ment’s misinformation, they tried to make people believe WKDWWKLV%LOOZDVJRLQJWRWDNHHͿHFWRQ-DQXDU\ because it didn’t have an implementation date in the Bill. Bills that don’t have an implementation date are done ȞɃȲȿȵȦɁȶȿȺȿȸ that way on purpose as this one was because the minute they get Royal Assent they become law that way,” said Maguire. “The government was misleading in its statement and they backed down from the meeting that was called by the chair of the Finance Committee, Wayne Easter, who is a Liberal himself. We were able to determine through WKH ZLWQHVVHV EHLQJ WKH GHSDUWPHQW RI ÀQDQFH SHRSOH that it was actually the Minister who made the choice, but they didn’t specify if it was Minister Freeland or the Prime Minister. They wouldn’t say which one it was in follow-up questions but they did say the directive to put $@MDO1?/1:@;@18? 13-/E:: and 1>5@-31;99A:5@E5B5:3 family businesses. As many small business farms that we Wednesday,Wednesday, AAugustugust 11 DarylDaryl Harrison Harrison 33-10pm-10pm ToursTours MemberMember of ofthe the Legislative Legislative Assembly Assembly for for anningtonCannington Constituency Constituency 5-7pm5-7pm BBQBBQ PrimePrime RibRib (Complimentary)(Complimentary) 1-833-670-44001-833-670-44001 833 670 4400 [email protected] 800 Ennis Ave. Grenfell, SK 1-639-683-0107 #220 Centre St. / P.O. Box 130 / Alida, SK. / S0C 0B0 8:tfc Amazon Fire TV Stick Glasser’s STARTING AT TV SERVICE $ 99 www.facebook.com/glasserstv 49 Monday - Saturday: 9 a.m. - 5:30 p.m. Moosomin, SK | (306) 435-3040 | www.glasserstv.com Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 3 Paving completed on Moosomin Lake Road Two miles of paving was completed by the RM of Moosomin on the road to Moosomin Lake from Highway 8 last week. The two miles of paving was completed at a cost of $620,000. The RM was starting to see some failures in the pavement and planned to recap one mile of road in 2021, saw some additional failures on the next mile of road and didn’t want to see the invest- ment in that road lost, so decided to repave a second mile with a two-inch lift to handle the heavier loads on the lake road. 21 teams here this weekend: Moosomin’s biggest ball weekend ever Continued from front this year with COVID, but I think going forward gener- “When I came here we didn’t have the facilities or the “Another big part of it is hotels, we’re fortunate to have ally these get announced in spring and we could use our hotels. The rink needed a bit of repair and we didn’t have as many hotels as we do, but we didn’t have enough so RECC committee (Reccreation, Economic Development WKHFRQYHQWLRQFHQWUHIRUHQWHUWDLQPHQWRUWKH6SRUWVSOH[ there will be teams probably in Virden. They might be as and Chamber of Commerce) to look for volunteers. We really only had one nice ball diamond and one nice far away as Esterhazy or Whitewood, so it helps the sur- “We would like more volunteers, if someone wants to fastball diamond. And there was a lack of hotel space. No rounding communities as well. scorekeep or pitch count.” one wanted to come for tournaments because the accom- “Our hotels are full. We couldn’t block rooms because Schwean said he is looking forward to the weekend. modations weren’t there. Now we have the facilities, we we didn’t know how many teams were coming until July. “We’ve never hosted three before,” he said. “It’s AA, so have the hotels, and certainly it’s easier to host tourna- “I think we’re fortunate to have this many teams, we a pretty good level of ball. People around town will enjoy ments now with what we have in town.” have 21 teams. We estimate there are 14 people on a team coming out. There will also be refreshments and a beer so that’s well over 300 athletes, probably 1,200 to 1,500 garden at RE/MAX Court. It’ll be really good.” people in town, so the campgrounds are busy too. I know Schwean says he sees a lot of potential for more tourna- we’re fully booked in the campground at Bradley Park ments like this in the future. and I know some teams are staying at the lake, and I think “I know our council, when they did their community Fieldstone as well.” plan, it was their intention that we would be a host com- What’s been the biggest job in bringing together a munity, whether its ball or hockey, curling, or whatever, weekend like this? our intention is to be a host community. I think we’re in “Getting volunteers is always a big thing,” says that population range where a lot of towns can’t match KARI’S KLOSET Schwean. “Deanna McDonald has been helping with this us for hotels and facilities and shops, so we have lots of one, but it’s a lot of work for volunteers. Getting our dia- potential for hosting.” FASHIONS FOR ALL WOMEN monds ready is a lot of work, and those are the two big- Schwean said because of changing Covid restrictions, gest things. planning for the provincial weekend was very last min- “This is something we want to do more of moving ute, but normally provincial events are planned far in ad- forward, and volunteers are key to that. We did our eco- vance. COMING nomic study showing the economic impact of recreation, “With things going back to normal I think generally and I assume this weekend will put a couple hundred they take applications in spring and they generally would thousand dollars back into the town. I know the council announce them around March, and then you can book appreciates us putting things on so it’s worth the time, as hotels from April to June. We’re busy planning our hock- long as we can get the volunteers to continue to do this. ey tournaments, so we’re always a season ahead. We’re “I know the men’s baseball went over really well, they DOVR EXV\ SODQQLQJ WKH QDWLRQDO ÀUHPHQ·V FXUOLQJ ERQ- ORYHGWKHIDFLOLWLHV,IWKH\GRQ·WÀQGDQRWKHUKRVWIRUQH[W spiel. That will be another big event for the town. There year in short order they are more than happy to come will probably be teams from each province, each territory. SHACKETS back. And I think this will be the same.” We’re going to have it at the curling rink with socials and What kind of comments does he usually hear after events at the convention centre. events like this? Schwean says the improvement in facilities over the “With the men’s baseball there were a lot of good com- years has made it easier to plan events like the provincial ments, they were pretty happy. A lot of them had never ball weekend. been here before and they were somewhat shocked at what we have here. I know a lot of them commented that they didn’t have facilities like this in their towns. We’re Steven Bonk, MLA fortunate enough to have 50 acres of land. Cities often for Moosomin Constituency GRQ·WKDYHWKDWDPRXQWRIVSDFHVRWKH\WXFNVWXͿLQD little tighter. They spoke very highly of our facilities. I’m 622 Main St., Moosomin, SK FRQÀGHQWDIWHUWKHVHRQHVEDVHEDOOZLOOFRPHEDFN:H·UH Phone 306-435-4005 LQOLQHIRUPXOWLSOHSURYLQFLDOVQH[W\HDUµ Fax: 306-435-4008 How much work is there to do on the actual weekend? “You need rules committees, so you need to have three Offi ce Hours: Main St. • Moosomin, SK • 306.435.2738 people there at all times. You need scorekeeprers, pitch Monday thru Thursday Monday - Saturday: 10 a.m. - 5:30 p.m. counters, concession. It’s a lot of volunteers and it’s 9 a.m. - 12 noon tough, I understand that, because the shop owners are 1 p.m. - 4 p.m. karisklosetonline.com Follow us on Facebook or Instagram for more outfi t ideas! busy that weekend too, keeping their stores operating as well, so sometimes it’s tough. Everything was so hard 6:tfc

Customer Appreciation EVENT Wellness & ONE DAY ONLY Mobility Centre % Your Locally Owned Hometown Pharmacy 20 OFF 630 Main Street 624 Main Street Your purchase at the Wellness Store & the Pharmacy Moosomin, SK Moosomin, SK Tuesday, August 10, 2021 306-435-3345 306-435-4330 Open 9:00 a.m. - 6:00 p.m. pharmasave.com/moosomin Discounts apply to regular prices on all merchandise. Some restrictions apply. See in-store for details. Monday - Saturday 9 a.m. - 6 p.m. 4 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 Moosomin RCMP Report

BY SGT. DALLYN HOLMSTROM and never sent any money to the have seen this occur and we are cluded lots of underage drinking. The male was then released with scammer. The male also smartly hoping someone will be respon- Members ensured everyone was charges for possession of metham- Holmstrom’s Notes deleted his Facebook account. It is sible and come forward. RND\DQGGLGQRWÀQGDQ\HYLGHQFH phetamine. In recent weeks I wrote about never a smart idea to pay money to of assaults taking place. If youth in break and enters in garages as well any scammer no matter how dif- Second complaint the area continue to be inconsider- Scam of the week as several incidents involving bro- ÀFXOWRIDVLWXDWLRQ\RXWKLQN\RX of a tube being ate and disrespectful to their sur- Saskatchewan RCMP and Live- ken windows around Moosomin. are in. Please do not hesitate to call roundings, I have instructed all the stock Services Saskatchewan have I am happy to report that with as- the RCMP, even if only to ask for stolen and truck 5&03 R΀FHUV LQ WKH DUHD WR VWDUW become aware of several produc- sistance from multiple businesses advice in these situations. damaged HGXFDWLQJWKHPZLWKDOFRKROÀQHV ers in Saskatchewan who have and civilians in Moosomin, we On August 1, RCMP received a been the victim of fraud while at- have been able to identify the indi- Truck speeding in second complaint regarding the Complaint from tempting to purchase hay. vidual responsible. The RCMP re- Rocanville close to stolen water tube which had been concerned farmer Producers in Saskatchewan FHLYHGYLGHRVXUYHLOODQFHIURPÀYH hitting children tied around a parked truck’s tire in Moosomin who are looking to purchase hay separate businesses and one civil- and axel. The unsuspecting truck should use caution when it is from LDQ ZKLFK DLGHG LQ LGHQWLÀFDWLRQ On July 29, RCMP got a com- owner got into his truck and drove On August 2, RCMP received a anyone or a business they do not At this time, we have been able to plaint of a dark colored Dodge away. Unexpectedly, this caused complaint from a concerned farmer know. Ads placed on social media charge him with three counts of Truck with licence plate number WKH URSH WR ULS WKH EUDNH OLQHV RͿ from Moosomin who advised that and other buy/sell platforms have break and enter and commit theft, 042 FML that was speeding in Ro- KLV WUXFN DQG FDXVH VLJQLÀFDQW someone is continuously opening been posted by fraudsters who are three counts of mischief as well as canville when it hit a bump and damage. the gates to their pasture allowing requesting immediate payment two counts of breaching conditions lost control. When the truck lost Moosomin RCMP is requesting their cows to get out. They advised prior to the buyer seeing the hay he is currently on. This male will be control it nearly hit some children anyone with information about this that they have cameras up now or being in a position to take de- appearing in Moosomin Provincial playing. incident to contact the Moosomin to catch the culprits responsible. I livery. Court to answer for his charges on RCMP attended the scene and RCMP by calling 306-435-3361. In- truly hope that no one is purposely Several producers sent funds September 21, 2021. made patrols and unfortunately formation can be submitted anony- opening someone’s gates, and if and then learned the seller was the licence plate obtained did not mously through CrimeStoppers it is the case they will be charged a scammer and did not have the match a vehicle. Moosomin RCMP by calling 1-800-222-TIPS (8477) criminally. This is a very serious hay. is requesting anyone with informa- or submitting a tip online at www. and disrespectful act that no one When purchasing online or over tion about this incident to contact saskcrimestoppers.com. deserves. That being said, I really buy/sell platforms, please en- the Moosomin RCMP by calling hope this isn’t “the cows” back up sure you are taking the necessary 306-435-3361. Information can be Complaint of to their old tricks trying to start steps to ensure transactions are submitted anonymously through beef by steering our investigation conducted in a safe manner. The CrimeStoppers by calling 1-800- people drinking of them. best way to do this is to not send 222-TIPS (8477) or submitting a tip and tossing beer funds until you are in a position online at www.saskcrimestoppers. WRFRQÀUPWKHSURGXFWLWHPVDUH com. cans into the lake legitimate and delivery has been On August 1, RCMP received a established. Complaint of large complaint of people drinking and Please contact your local RCMP tossing their beer cans into the wa- or police detachment if you or any- party at the lake ter while on the water trampoline one you know have been a victim On July 30, RCMP received a at the Moosomin Regional Park. of this type of scam. If you have complaint of a large party tak- RCMP attended and located the information related to this advi- ing place at the ball diamonds persons responsible. The subjects sory, please call your local RCMP in the Moosomin Regional Park. were issued a $250 ticket for hav- detachment or Livestock Services The caller advised that the party ing, giving, or consuming alcohol Saskatchewan at 306-546-5086. had over 100 youths drinking and LQ D SXEOLF SODFH DV ZHOO DV D ÀQH playing loud music. The caller also of $360 for a minor possessing or Police Joke said they heard lots of yelling and consuming alcohol. I hope this will screaming and thought the party be a good lesson to those involved. A man one day accidently spilled was getting completely out of JDVRQKLVVKLUWVOHHYHZKLOHÀOOLQJ hand. Another complaint his car up with gas. RCMP attended the large party Disturbance by Unaware that he had gas on his DQG FRQÀUPHG WKDW LW ZDV RXW of a large party sleeve the man got in his vehicle of control with lots of underage at the lake intoxicated male and drove away. The man lit a ciga- drinking. Members shut the par- at a residence UHWWHDQGFDXJKWKLVVOHHYHRQÀUH On August 2 at 1 am, RCMP re- ,Q DQ HͿRUW WR SXW WKH ÁDPHV RXW ty down and poured out a large ceived yet another party complaint On August 5, RCMP received a amount of alcohol from under age call of a disturbance at a residence he began waving his arm up and taking place at the ball diamonds in down. drinkers. the Moosomin Regional Park. The in Moosomin. When RCMP ar- rived they arrested an intoxicated The man then looked in his rear FDOOHU UHSRUWHG WKDW VHYHUDO ÀJKWV view mirror and saw red and blue Complaint of were breaking out at the party and adult male. Once arrested RCMP also seized just over 14 grams of OLJKWV ÁDVKLQJ DQG KHDUG D SROLFH assault after that all the yelling and screaming siren. The policeman got the male were keeping people awake at the methamphetamine. The male was cabaret at lake lodged at the infamous RCMP bed out of the car and arrested him for park. Members attended and again KDYLQJDQLOOHJDOÀUHDUP On August 1, RCMP received a shut down a large party which in- and breakfast until he was sober. complaint of an as- Have a great week and stay safe! sault following the cabaret and beer gar- dens at Moosomin Regional Park. The Assault took place when two intoxicated males got into an ar- gument when they Traffic charges were leaving. The 7UD΀F (QIRUFHPHQW ZDV EXV\ adult males were get- DJDLQWKLVZHHNOD\LQJÀQHVIRU ting a ride home in On Friday, July 23rd, I was asked to attend an various charges including no driv- the same vehicle. The annual awards night for volunteers who have ers licence, unregistered vehicles, ÀUVW PDOH UHTXHVWHG not wearing seatbelts and of course the second male to get helped our community for lengthly periods everyone’s favorite, speeding. The in the middle of the of time. I didn’t know what to expect but my KLJKHVW ÀQH ODLG WKLV ZHHN ZHQW back seat and when family and I went and we had a great supper to a driver traveling 51 km above he didn’t he punched with a hall full of happy people. the speed limit which resulted in a him in the face. The ÀQH,ZDQWWRUHPLQGHYHU\- victim’s lip was cut as I would like to thank the R.M. of Moosomin for one that the speed limit is 60 km/ a result of the punch. nominating me for this award, The Town of hr in construction zones as well as Moosomin, Mayor, Councillors and Mike passing emergency vehicles. Complaint R.M. Award of Distinction – Schwean for hosting this event annually. Another of tube Sport/Culture/Parks/Recreation – It was so nice to hear Mike’s wonderful positive ‘sextortion’ being stolen Don Ferguson – Moosomin Senior Rangers notes he had about myself and everyone else at the lake in the hall. complaint I expect him to become our mayor in the future years as he constantly works towards making our On July 29, RCMP received an- On August 1, other “sextortion” complaint. This RCMP received a community a better place to live. He gives a lot of credit to all volunteers. occurred when a male from the complaint of a sto- As for me, now that I am in my senior years its’ a great feeling to be able to go to any rink in community thought he was video len $500 water tube from the Moosomin Saskatchewan or Manitoba and have made so many friends over my 40 plus years of hockey, and chatting with a female who lived in that they come visit me and shake my hand. Saskatchewan. The person turned Regional Park. The out to be recording the sexual tube was towed be- Not to mention the people I have met through working at the 4 livestock yards for 18 years. The video conversation. The scammer hind a vehicle around Gymkana racing events, horse sales, cattle sales and rodeos, it adds a lot of friends to the hockey list. the campgrounds. threatened to share the explicit This wonderful evening has made me realize we are so lucky to live in our great town in such a great content of the video with his Face- The tube was found book contact unless he paid money. and was destroyed area (With no COVID), When we live on the positive side of our world, life can still be a dream. Thank Unfortunately, police are not able and full of holes. At you for everything so far as I will still be going to hockey meetings and I will see you at the rink and to catch these scammers and hold this time, it is still un- will be helping out the best I can as we have a good team lined up for the season. them responsible. In most cases the known who was re- scammers are not in Canada. In this sponsible for destroy- case the male made the right choice ing the tube. I know BBeesst of llucckk to alll off yoouu! - DDoonnnniiee Feerrggussoon lots of people would Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 5

Above, the elevators and a street scene from Fleming, and below a photo of the former United Church. August 5-7, 2022 set for reunion Fleming planning reunion for 2022 BY KEVIN WEEDMARK what it’s all about events and are not email Chelsey Hattum at 306-434-6833 or The community of Fleming is starting to and this is why tied up with volun- email [email protected] noting prepare for a massive reunion in the sum- this time around, teer duties, organiz- the funds are for the Fleming Reunion or mer of 2022. last time I have ers are hopeful that FDQGURSFKHTXHVRͿDW2.7LUHLQ0RRVR- The reunion is open to anyone to attend, a couple regrets, organizations and min made out to the Fleming Community and will be held August 5-7, 2022. I didn’t take the caterers can take on Organization. The reunion will bring old friends to- time, I was too the meals over the gether to share their stories and visit, and busy with running course of the week- the weekend will include entertainment, things. I didn’t end. Big crowd expected beer gardens, supper and a dance, activi- take the time to en- “We have some Organizers are expecting large crowds ties for kids, a ball game or two, a parade, joy it. This time I’m very small volun- for the reunion. They say previous re- a church service, a pancake breakfast and going to make sure teer jobs that we unions have been well attended and they more. I enjoy it, too.” need people for, expect this one to draw an especially large The organizers believe that this is a good The reunion won’t be a fundraiser, but over short periods of time so you’re not crowd. time to be planning a reunion. organizers hope to break even. tying people up with that,” said Hamm. “There haven’t been as many chances for “I think it’s important for older people “We just want to cover our costs,” says “And even when people come in and vol- people to get out, and I know people are to get together and share their stories, and Hamm. “We’re not looking to make mon- unteer, they’ll have a little bit of a visit. If really taking advantage of every opportu- for younger people whose parents lived in H\RͿRILWRUDQ\WKLQJOLNHWKDW:HMXVW they’re working the registration desk they nity right now because they’re so hungry Fleming, and for the people who did live want to have a good time, show people a can have a little visit with whoever is reg- for things to do, but some people are still in the town who want to come back and good time.” istering as well. worried about Covid,” said Hamm. see the town and their old friends again,” People can pre-register for the reunion “We’re hoping the meals and the pan- “I think it will be calmer next year with said Chelsey Hattum, a member of the or- so that organizers have an idea of how cake breakfast can be taken care of by the DOO WKH &RYLG VWXͿ DQG SHRSOH ZLOO IHHO ganizing committee. “Sometimes people many people to plan for. Firemen or 4-H groups or youth groups or more comfortable. I think we’ll have lots need and excuse or a reason, they don’t People can pre-register by checking out any groups that are interested.” of people come down for it, and that’s just think ‘let’s go to Fleming and see what the Fleming Community page on face- Anyone interested in donating to help good because the more we get the more it’s all about.’ This is a reason for them to book, which has the reunion as an event. JHWWKHUHXQLRQRͿWKHJURXQGFDQWH[WRU fun it will be for everyone.” come back and to talk to all the people that 7RUHJLVWHUÀQGRXWPRUHRUHQWHUWKHSD- used to live there, all the people that heard rade, people can contact Chelsea Hattum stories about there and maybe meet some at 306-434-6833 or Phil Hamm at 306-435- of the people they’ve heard stories about. 4140. Kids, grandparents, this is for everyone. “That is something really key, for peo- “I want to help put this on for people ple to let us know if they’re planning to it matters to, because I live there and I come,” said Hattum. Borderland love Fleming and I’ll do whatever I can to “It’d be a big help to us if people pre- help.” register, that’s really important. ´:KHQ3KLO +DPP ÀUVWWROGPHDERXW “In the event you can click ‘going’ or ‘in- Melon Mania! this reunion, he mentioned it and I said terested.’ I know not everybody has Face- that’s nice,” said Ted Frape. “On the way book or one person might be going and home my wife mentioned, you know, they have two kids and a husband or wife. Phillip wouldn’t have said anything if he So I will take that number and estimate the wasn’t looking for a little assistance. My total so we can give the caterers the range watermelWatermel on eatingeating wife said, if your mother and dad were we’re expecting.” still here, they’d be in there helping, so I’m There will also be a costume contest on here doing what I can do to help, I guess I the Saturday of the reunion, for which contestcontest was talked into it! people are asked to dress for a particular “It’s always great to have everyone to- decade from the 1920s to the 1970s, and gether. I know we had a lot of people back parade entries can be in that theme as well. WAS JUST THE in Fleming in the Jubilee year, 1955, and we had a big parade, and we want to do a big parade for this one. Old photos START OF THE FUN! “It’ll just be nice for everyone together, and for some of the older folks this might of Fleming wanted The committee is also looking for old be the chance to see everyone one more photos of Fleming, both for a calendar, time.” and to have on display at Fleming’s com- “It’s important to me just because it’s PXQLW\FRͿHHKDOO my home town and I love the place, I love “We’ve got more pictures than we’ve the people,” says Phil Hamm. “Well most JRWURRPWRSXWRQWKHZDOOVRIWKHFRͿHH of them, there’s a couple of them that I shop,” says Hamm. don’t,” he adds with a laugh. “There are a lot of pictures of the eleva- “A lot of people who have moved away WRU DQG GLͿHUHQW EXLOGLQJV LQ WRZQ DQG have a lot of good memories and I’d like to organizations and people, but we thought see those folks again. we’d do the walls of the community hall. “I’m really looking forward to sitting They can be pictures of sports teams and down with some of these people and remi- pictures of businesses and whatever. We’d niscing and having fun. You can be here like to also get this put together, electroni- today and gone tomorrow and it doesn’t Tune into Facebook to see all the other cally saved somehow so people have ac- matter what age you are. So if you’re go- cess to it, and do up a calendar, too.” melon themed events ing to have it, why wait for something and “I have a photo section on the Fleming then say, oh shoot we could have had this Community page,” adds Hattum. “People Such as watermelon carving one and that one and maybe a couple of can bring me pictures and I’ll scan them them could have been there, but we wait- and melon trivia! and put them up. Or they can email them ed and now it’s too late for them. or put them on there themselves.” “I’m looking forward to it, I think it’s going to be good. Really, really good. It’s the people and the visiting. We’re going to Organizations, have the parade and we’re going to have a caterers to handle meals ball game or two and we’re going to have The reunion organizers are looking for DOOWKLVVWXͿEXWWKHLPSRUWDQWWKLQJLVWKH a few volunteers for some small jobs like visiting and talking to people you maybe VWD΀QJWKHUHJLVWUDWLRQGHVNEXWLQRUGHU haven’t talked to for a while. to make sure as many Fleming residents as “I’m looking forward to this. That’s possible can fully take part in the reunion borderlandco-op.crs 6 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

Above and right, recent bear photos taken by Alvin Nixon in the Wapel- la-Rocanville area and in the Qu’Appelle Valley. At far right, a photo of a bear at Moosomin Regional Park in 2020. Bear sightings on the rise in SE Sask COMING TO MOOSOMIN BY SPENCER KEMP Part of the reason for the increase in bear LOCAL JOURNALISM INITIATIVE REPORTER sightings may be black bears seeking food NOVEMBER Bear sightings are on the rise in South- and other environmental factors at play. Creative Vision east Saskatchewan and some have report- “Poor weather conditions, localized Productions 14 & 15, 2021 ed seeing more wildlife this year when food shortages, and especially decreases Moosomin, SK compared to past years. in berry crop can create situations where Katherine Conkin, a wildlife biologist black bears need to travel further in search with the Saskatchewan Ministry of Envi- of food,” Conkin said. ronment, says some areas are seeing an “It’s not easy to tell, but theoretically the increase in wildlife populations. drought may have an impact on the berry Bear reports tracked by the ministry population. Berries come out in waves, range from concerned hikers reporting saskatoon berries are out now, blueberries The revue features songs from 15 Broadway musicals such as: sick bears to simple bear sightings that are will be out in a bit, and so forth. It may Beauty and the Beast, Guys and Dolls, Mamma Mia, called in to the Ministry of Environment. KDYHDQLPSDFWRQWKRVHEXWLW·VGLIÀFXOW Rent, My Fair Lady, and Hairspray! “The current population of black bears to say.” in Saskatchewan is about 43,000 and that When encountering a bear, Conkin says MTI is promoting this concert for local theatres. “All Together Now” is about bringing is determined based on a habitat-based that it is best to keep your distance. population model,” she said. “If you encounter a bear keep your dis- the theatre community together and helping theatres jumpstart their seasons after the ´3RSXODWLRQVGRÁXFWXDWHDQGWKHUHDUH tance, don’t try to scare the animal away devastating year of 2020 and COVID-19. reports of localized population increases or deal with it yourself. in some areas of the province.” “Most often animals will move without Anyone interested in being a part of the production in any intervention. They’re more scared of you than you are of them typically. A lot cast, crew, or chorus can text/phone Sherrie at 306-434-7533 Moose numbers down of bear encounters happen when there is Moose numbers are down, meanwhile. a food source with humans and one of the Auditions are only required for those interested “Moose populations vary across the vari- biggest things that we tell people is that ous habitat types across the province. The they’re intelligent animals and they’re in solo or small ensemble parts. boreal forest moose numbers are down ruled by their stomachs so if there isn’t and we are going to have a bulls-only sea- food then they will leave an area. Just be Auditions can be booked by contacting Sherrie and she will make son to promote recovery of these popu- aware of your waste, with your cabins and arrangements for providing audition packages to interested participants. lations in the coming hunting season. In campers keep your food properly secured. the forest fringe they appear to be stable, That will limit encounters.” She says the there are some localized areas in the park- same method should be used when en- AUDITIONS: BETHEL UNITED CHURCH land and grassland where numbers have countering moose as well. declined but hunter success has remained “Keep your distance if you encounter Wednesday, August 11, 2021: 5 pm - 9 pm high in those areas. It’s just a mixed bag.” one. Just mind your own business and they’re more likely to leave you alone if Thursday, August 12, 2021: 5 pm - 9 pm you’re not in their space.” If keeping distance is not enough, Conk- WE’RE LOOKING FOR: Bear sightings up in says it is best to make oneself appear as Conkin said bear sightings are up. large as possible and make noise to scare • Actors • Set Builders/ • Light Crew “We have had an increase in call volume the black bear away. • Singers Props • Publicity Team to the Ministry in regards to bears. Those She says encounters are not uncommon calls can range from people asking ques- • Dancers • Painters • Front of House in Saskatchewan, noting that it is some- tions about bears all the way to having an • Musicians • Backstage Crew Team thing everyone needs to be aware of. encounter with one. We have been mak- “Saskatchewan is bear country and • Sound Crew • Costuming ing a concerted effort in the past year to black bears are a natural part of our land- increase education awareness on bears in scape and it’s important for people to just [email protected] the province and provide advice on what take the necessary precautions to avoid to do if an individual encounters one.” https://sites.google.com/site/creativevisionmoosomin/ bear encounters,” said Conkin.

Kevin Weedmark Editor and Publisher • Kara Kinna Associate Editor Brooke Klinger Editorial Assistant • Alyssa Rasmuson Sales Assistant Spencer Kemp • Shayna Zubko • Ed James Reporters Jennifer McMillan • Jacqui Harrison • Samantha McGonigal Design and Layout Kim Poole • Josh Deramas Photographers • Cassidy Griemann Student employee

Postage paid at Moosomin World-Spectator, we offer display advertising in the re- terial intended for publication in the World-Spectator Publications Mail Agreement Number 40011909. gional Plain and Valley, career advertising across Sas- issued on the following Monday. Deadline for the Plain Return undeliverable items to McKay Publications katchewan, and blanket classified advertising across and Valley is 5 p.m. Wednesday for the following week’s Ltd., Box 250, Moosomin SK S0G 3N0. Canada. issue. Contact us Printing services Subscribe now We want to hear from you! Email world_spectator@ The World-Spectator is your full service printer. From Subscriptions are $45 for one year (A $33 saving sasktel.net, call (306) 435-2445, fax (306) 435-3969, or business cards and brochures to hockey programs, we from the cover price), $80 for two years, $105 for three write to us at Box 250, Moosomin, Sask, S0G 3N0. can print it all! years, and $160 for five years. Go to www.world-spec- tator.com to subscribe! Advertising options Deadlines In addition to classified and display advertising in the The regular deadline is 12 noon Thursday for all ma- Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 7

A rendering showing the new pool building and entrance. A rendering of the new lifeguard desk, pool deck area and waterslide. Rocanville Town Council Town approves design concept for pool upgrades

BY KARA KINNA At their regular meeting on Wednesday, Rocanville town council passed a motion to approve the design concept presented to them by MPE engineering for the structural rehabilitation of the Rocanville Aquatic Cen- tre, and to move forward into the detailed design phase of the project. After decades of struggling with expens- es and how to tackle major repairs that are needed at the pool—the only public indoor pool in the area—the town found out in May that it was receiving a $1.27 million grant for the pool through the federal-provincial Investing in Canada Infrastructure Program (ICIP). With the pool closing for the season this fall, the town is hoping for the rehabilitation project to be shovel ready by October, so that the work can be done over the fall, winter and early spring in time to open the newly rehabilitated building to the public in the spring of 2022. After going over the design concept pre- sented by MEP Engineering at their meet- ing on Wednesday, along with Rec Director Andrea Logan, the town will be requesting a few small changes to the design, but for the most part, the rehabilitation project will con- sist of the following major changes: • The current foundations will be replaced with new piles and grade beams to support a new pre-engineered steel building structure A rendering showing the new pool deck area and steel building structure. over the pool. The existing building will be will be fully demolished. Existing mechani- signs of water damage, rot and mold. The area. demolished. The new building envelope will cal distribution piping in the pool deck area PH]]DQLQHÁRRULQJZLOOEHDQHZFRPSRVLWH • Town Administrator Monica Pethick be structural insulated panels to address the will be assessed, then removed and replaced concrete steel deck system to replace the old told council that the federal government issues of dry and wet rot in the interior wood with new piping. A new pool deck consist- ZRRG ÁRRULQJ V\VWHP DQG ZLOO EH ÀQLVKHG would be topping up the gas tax program decking. The new building will have a larger ing of 100mm concrete slab on grade will be with epoxy coating to match the pool deck. again in 2021, with Rocanville receiving an footprint than the existing building. The new EXLOWZLWKSRROGHFNHSR[\ÁRRULQJLQVWDOOHG The existing wood stairs are to be removed extra $50,000. building will be expanded 1.2 meters to the overtop. and new replacement stairs will be con- • There will be changes to the potash tax west, 1.5 meters to the east, with the entrance • The existing pool structure will be main- VWUXFWHG RQ WKH HDVW VLGH RI WKH PH]]DQLQH VKDULQJDUHDRILQÁXHQFHWKDWZLOOEHHIIHF- being an additional 4 meters in width, and tained, however the existing pool liner will area with a small landing area to the top. tive as of 2026. Under the changes, the town the north and south sides expanded out by be removed and replaced with a new liner • Other improvements include a new of Rocanville should receive a larger share one foot. which, along with mechanical upgrades, will À[HGZDWHUVOLGHDQHZGULQNLQJIRXQWDLQWR of the potash tax while some municipalities • Architectural improvements include a address the ongoing water leakage issues replace the old one, new locker cubbies lo- that received it previously will receive less new covered canopy side main entrance on that staff have observed. cated on the pool deck along the north wall or none. The changes will be based on where WKH HDVW VLGH RI WKH EXLOGLQJ QHZ ÀUVW DLG • Building mechanical upgrades will in- of the change rooms, reclinable deck chairs the potash is brought up to the surface. DQGOLIHJXDUGEUHDNURRPUHFRQÀJXUHGOD\- clude the addition of units to handle fresh and tables with bench seating. The existing • A motion was passed to approve the out and larger men’s and women’s change DLU YHQWLODWLRQ DQG GHKXPLGLÀFDWLRQ RI WKH barrier-free access chairlift will be reinstalled engineered design for a retention pond and rooms, a new barrier free/family/gender building, among other items to provide a and the diving boards will be maintained. drainage solutions on the east side of town neutral change room, new pool storage loca- healthier environment for swimmers and • As part of the detailed design phase, a WRDOOHYLDWHJURXQGZDWHUÁRRGLQJLVVXHVRQ WLRQUHFRQÀJXUHGVWDLUORFDWLRQWRWKHPH]- staff. geotechnical site investigation shall be com- Robin Avenue. The retention pond will also ]DQLQHDUHDDQGDQH[SDQGHGSRROGHFNDUHD • Electrical system upgrades that will pleted by MPE. The objective will be to de- provide water to the golf course. The town A new L-shaped lifeguard deck will also be provide better lighting to the pool area, ad- termine the general subsurface conditions of is planning to build walking trails and a dog installed adjacent to the entrance to control dress life safety items and provide updated the current aquatic centre site. park around the pond once it’s completed. DGPLVVLRQ RI IRRW WUDIÀF LQWR WKH EXLOGLQJ communications and data servicing for the • Councillor Irene McLean announced while maintaining a view of the pool area. building. In other council news: that the Rocanville museum has set Septem- The improvements will provide better access ‡7KHPH]]DQLQHZLOOEHUHEXLOW7KHH[- • The town passed a motion to reject a mo- ber 18 as the date of Museum Day this year, to pool patrons as well as safer management LVWLQJZRRGÁRRULQJVXSSRUWV\VWHPRIWKH bile home at 215 Pitt Street, as other similar as long as there are no Covid restrictions this of the pool by lifeguard staff. PH]]DQLQH DUHD ZLOO EH UHPRYHG GXH WR types of housing have been rejected in that fall. • The existing concrete slab pool deck

A rendering showing the new mezzanine area. A rendering showing the new desk, mezzanine area, and waterslide. 8 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

Scenes from the last Spy Hill Sports Days, in 2019: The Bale Toss, above, and Barrel Racing. Event was cancelled in 2020: Carrying On A Tradition Randy Klassen – Funeral Director Spy Hill Sports Peter Carscadden Funeral Service Days this weekend How Do I Explain Death to My Child? BY KEVIN WEEDMARK pulls Saturday at 5 and Sunday at 2. Go with the adage ‘Children aren’t incapable, they’re After a year off because of Covid-19 re- There will be a pancake breakfast both inexperienced’. They have the capacity to deal with grief and strictions in 2020, the biggest weekend of days, a church service at 10 am Sunday, loss, they just have not had a lifetime of experiences to know the year in Spy Hill is back this weekend. and team roping 11:30 am to 1 pm Sunday. what it looks and feels like. You already have a way of ex- The Spy Hill Sports Days go Saturday There will also be a show and shine Sun- and Sunday, August 14 and 15 with team day. plaining life to your child that is developmentally appropriate, roping, barrel racing, kids’ rodeo, Slo- “We’re really excited about getting back so just keep doing the right thing. Pitch, an antique tractor pull, and more. to the Sports Days this year,” said orga- They may have a lot of questions, so fi rstly, make sure that Saturday kicks off with a Kids Rodeo 10 nizer Jeff Odgers. they know it’s okay to ask as many as they like. Make your am to noon, there will be barrel racing at “This is one of the longest-running 12:30 and team roping at 2 pm. sports days and rodeos in all of Saskatch- responses short, so that they can ask another question. Keep There will be an antique tractor show all ewan and we’re excited to keep this going it going until they are ready to move on to another activity. weekend, and there will be antique tractor and be a part of it.” You can explain death as the inability to do functions like breathing, moving, eating, or having a heartbeat, and that those things cannot be restarted once someone dies. Allow them their emotions, even if they are different from your own. Share your emotions with them. They will want to practice being comforting as well. You’re Invited to Using analogies or stories to describe death is likely to end in confusion, so speaking honestly about death and dying will help them understand the concept well. It is best not ST. MARY’S CATHOLIC CHURCH to equate death with sleeping, as that may make them fearful at bedtime. When they ask if they will die, it’s okay to say that all living things will eventually die, but Catechism Kickoff Celebration that most children live a long, long time. Your child’s play might include simulating death. Asking them questions about each feature will be another learning opportunity, as well as a means for you to understand Saturday, August 21, 2021 how well they are coping. 11am - 3 pm Your Questions and Comments on this and other topics are welcome. St. Mary’s Catholic Church • Moosomin Peter Carscadden BOUNCY CASTLE, WATER BALLOONS, BASKETBALL, GAMES & CRAFTS Funeral Service FREE LUNCH P.O. Box 1344 Esterhazy, Saskatchewan S0A 0X0 306-745-3304 www.pcarscaddenfs.ca professional What can we print for you today? CUSTOM iLogo Design iLetterheads iPrograms DESIGN & iBusiness Cards iForms iPosters PRINTING iEnvelopes iBooklets Call today for a Sign Design & Printing custom quote! iCoroplast Signs iVinyl Banners 306.435.2445 [email protected] iMetal Signs iWindow Clings Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 9 Farmers looking at poor yields, Ranchers thinning herds: Sask. C of C says poor harvest will affect all

BY SPENCER KEMP WKH HFRQRP\ LQ PDQ\ ZD\V DW PDQ\ OHYHOV WKH ÀUVW RI LOCAL JOURNALISM INITIATIVE REPORTER course and the biggest would be the direct impact that Producers across Saskatchewan are facing hardships the lack of revenue in some areas of the province from the brought on by the dry growing season. ag producers. Because of this, some producers are concerned about “The crops are not going to produce at the level we post-harvest bills and lack of revenue due to the dry thought they were going to in the spring and what every- weather. body hoped for, so that means less money in local com- The Saskatchewan Chamber of Commerce says that munities, fewer equipment purchases in fall, those sorts ZKHQSURGXFHUVVWUXJJOHÀQDQFLDOO\LWDͿHFWVDOORI6DV- RIWKLQJVDUHVLJQLÀFDQWµVDLG0F/HOODQ katchewan. “The other thing that’s also going to be impacted is the Chamber CEO Steve McLellan says that low-yield dur- SURYLQFLDOFRͿHUV:KHQ\RXFRQVLGHUWKHLPSDFWRQWKH ing harvest will not only impact Saskatchewan’s econo- crop insurance organizations, the impact on tax revenues my, but also provincial funds. being decreased, all of those have a long-term impact but “I think the situation in agriculture is going to impact the one that is going to be the most visible across the prov- ince is the change of attitude. ´:H ZHUH ORRNLQJ IRU D UHDO VWURQJ DJ HFRQRP\ WKLV year to get our attitude up to act as a stimulus to get the economy going. If that doesn’t happen, as ag goes in Sas- katchewan so does our attitude, so does our revenues. It’s going to be a challenging fall, but our farmers, like our SHRSOHDUHSHUVLVWHQWDQG,DPYHU\FRQÀGHQWWKDWZH·OO JHWWKURXJKWKLVDVZHKDYHLQ\HDUVJRQHE\µ McLellan explained that producers play a huge role in Saskatchewan’s economy and a poor harvest will impact Small businesses and farmers every community in the province. can’t afford more attacks “They’re huge in our economy, there’s no question. Ev- Dear Editor: ery community in our province relies on farmers for ev- Last month, the Liberal Government tried to cancel the erything from gasoline to groceries, from farm machinery implementation of a Conservative private member’s bill to supplies. Saskatchewan Chamber of Commerce passed by Parliament that would lower taxes on farmers “They rely on those communities to produce goods to CEO Steve McLellan and other small business owners who pass their business sell to the world and that money comes back in many ways to the businesses in every community in this prov- ag producers are huge businesses in Saskatchewan. There on to a family member. DUHORWVZHFDQGRRXUÀQDQFLDOVHFWRULVGRLQJDOOWKH\ On the night before the Finance Committee hearings LQFH ELJ DQG VPDOO :KHWKHU WKH\·UH ZRUNLQJ LQ R΀FH towers in Saskatoon or restaurants in small towns and vil- can to be patient in terms of loan repayments, in terms of WR H[DPLQH WKH XQSUHFHGHQWHG GHÀDQFH RI 3DUOLDPHQW FDVKÁRZWKDWVRUWRIWKLQJ%XWLQGLYLGXDOVFDQGRWKLQJV Finance Minister Chrystia Freeland claimed that she re- lages, everybody has a stake in the success of our ag com- PXQLW\:KHQRXUDJSURGXFHUVDUHGRZQHYHU\ERG\·V as well. versed her position and acknowledged that the law had “If you see ag producers going down the road in a com- come into force. feeling the pain. “Farm machinery folks will be feeling the pinch this fall. bine, or with a trailer, or with a load of bales, give them This is yet another example of the Trudeau Government room to pass. ÁLSÁRSSLQJEHIRUHDQHOHFWLRQLQDGHVSHUDWHDWWHPSWWR There are already challenges there with supply chains be- ing impacted, but we’re going to see fewer purchases and “Allow them some capacity to take control of the road JHWYRWHV:H&RQVHUYDWLYHVGRQRWEHOLHYHWKDWWKH/LEHU- DQGVWD\RXWRIWKHLUZD\:KHQ\RXGRDOOWKRVHWKLQJVDV als will ever let the bill be implemented, despite the fact that’s a challenge because those are big businesses. It’s going to impact everybody from the grocery store to the a courtesy, that makes the farmer feel a little better and he that Canadian farmers and their families would greatly may be having a lousy day, it’s important to make sure we EHQHÀWIURPLW FDUGHDOHUVWRWKHKDUGZDUHVWRUHV,W·VDVLJQLÀFDQWLPSDFW on Saskatchewan, but our ag producers and communities do all we can. Even if we’re not loaning money or equip- Canada’s Conservatives understand that farmers and ment to them, we can certainly show them a bit of a better RWKHU VPDOO EXVLQHVVHV FDQ·W DͿRUG PRUH DWWDFNV E\ WKH are resilient and we will get through the harder days and ZH·OOÀQGVXFFHVVDJDLQµ GD\µ FXUUHQW /LEHUDO *RYHUQPHQW :H ZLOO XVH HYHU\ WRRO DW Even with more hot, dry weather expected, McLellan our disposal to support small business owners across the McLellan encourages everybody to do their part in helping farmers, whether it is businesses cooperating to remains positive and says it’s not time to give up. FRXQWU\DQGÀJKWEDFNDJDLQVWWKHXQGHPRFUDWLFDFWLRQV ´7KHUH·VVWLOOWLPHLQWKLV\HDUWRVHHZKDWWKHÀQDOWDOO\ of Trudeau’s Liberals. extend loans, or drivers just taking time to give producers the right of way on roads. LVZKDWWKHFURSVFRPHRͿDWVRZH·UHQRWWKURZLQJLQWKH Dr. Robert Kitchen, M.P. WRZHOMXVW\HWµVDLG0F/HOODQ Souris – Moose Mountain ´:HQHHGWREHUHVSHFWIXORIHYHU\EXVLQHVVSHUVRQDQG COPY PAPER

8.5X11 COMPARE WAL-MART $ 00 $69 PER CASE AMAZON 59 $79 10 PACKAGES PER CASE 500 SHEETS PER PACKAGE DELIVERY WITHIN MOOSOMIN: $61

306.435.2445 714 Main Street • Moosomin, SK 10 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 Kevin 2011 Weedmark 2009 2010 CCNA 2010 WINNER CANADIAN COMMUNITY Editor NEWSPAPER AWARD 2011 and Publisher

,VVXHG HYHU\ 0RQGD\ E\ 0F.D\ 3XEOLFDWLRQV /WG D :HZHOFRPH\RXUFRPPHQWV:ULWHWR%R[0RR- Member of subsidiary of Weedmark Communications Ltd., from the VRPLQ6DVN6*1FDOO  ID[   NMC, SWNA and CMCA R΀FH0DLQ6WUHHW0RRVRPLQ6DVN RUHPDLOZRUOGBVSHFWDWRU#VDVNWHOQHW Publications Mail Agreement No. 40011909 In our opinion: Why Canada’s oil and gas sector gets so little respect Want to know why Canadian oil and gas gets so little respect from anti-oil and gas activists? It’s not because Canada’s main energy sector is somehow a miscreant on measures of carbon emissions or anything else. Instead, it is often due to three approaches: focusing only on absolute emissions and ignoring the HͿHFWRIHFRQRPLFJURZWKDQGSHUFDSLWDPHDVXUHPHQWVVNLSSLQJRYHUWKH UHDOLW\RIDFROGQRUWKHUQFRXQWU\DQGPDNLQJWKHSHUIHFW XWRSLDQHQG WKH enemy of the good. This might be why, despite considerable debate in the media and policy FLUFOHVDERXWWKHDEVROXWHJUHHQKRXVHJDV *+* HPLVVLRQVDULVLQJIURPWKH activities of Canada’s oil and gas sector, little attention has been paid to the UHGXFWLRQVLQ*+*HPLVVLRQVLQWHQVLW\WKDWKDYHRFFXUUHGZLWKLQWKHVHFWRU over the past two decades. 6RPHEDFNJURXQGDQGDQHFHVVDU\GHÀQLWLRQHPLVVLRQV´LQWHQVLW\µLVWKH HPLVVLRQVUDWHRIDJLYHQSROOXWDQWUHODWLYHWRWKHLQWHQVLW\RIDVSHFLÀFDFWLY- ity or industrial production process. Examples include grams of carbon dioxide released per megajoule of en- ergy produced, or the ratio of greenhouse gas emissions produced to gross GRPHVWLFSURGXFW *'3  In laymen’s terms, if an industry or an economy is growing, as are its emis- sions, is not immediate evidence of a negative trend. +RSLQJIRURQHIDPLO\·V ,WZRXOGEHDNLQWRORRNLQJDWDXWRPRELOHPDQXIDFWXULQJDQGDVVHUWLQJ LI WKLVZHUHKDSSHQLQJ WKDWDSHUFHQWULVHLQWKHXVHRIVWHHOLQWKHODVWGH- FDGHPXVWPHDQWKDWVHFWRULVOHVVH΀FLHQWLQLWVXVHRIVWHHO But what if that same sector was manufacturing twice as many cars, trucks safe transit to Canada and SUVs as a decade ago? Then the rise in steel use would, in fact, be evi- GHQFHRIDVHFWRUGRLQJPRUH SHUFHQWPRUHSURGXFWLRQ ZLWKOHVV RQO\ I hope that everyone in Canada remembers SHUFHQWPRUHVWHHO  every single day how fortunate they are to live This trend on carbon emissions intensity is occurring within Canada gener- here. There are people around the world who DOO\DQGLQWKHRLODQGJDVVHFWRUVSHFLÀFDOO\ $QGDJDLQZHDUHPHDVXULQJ would love to live in this beautiful, safe, friendly FDUERQHPLVVLRQVLQWHQVLW\QRWDEVROXWHHPLVVLRQV country and leave behind some very dangerous Kevin Weedmark )RUH[DPSOHSDLU&DQDGD·VHFRQRPLFJURZWKIURPWRZLWKFDU- parts of the world. bon emissions and here’s the record: carbon emissions intensity is down dra- &XUUHQWO\ D QXPEHU RI $IJKDQ LQWHUSUHWHUV matically. who worked with Canadian agencies and the %HWZHHQDQGPHDVXUHGLQZKDW·VNQRZQLQWHFKQLFDOWHUPVDV Canadian military are on their way to Canada ´PHJDWRQQHVRIFDUERQGLR[LGHHTXLYDOHQWµWKHJUHHQKRXVHJDVHPLVVLRQV and they cannot get here fast enough. LQWHQVLW\LQ&DQDGDIHOOE\SHUFHQWIRUHYHU\ELOOLRQGROODUVLQZHDOWKFUH- , VSHQW VRPH WLPH LQ $IJKDQLVWDQ LQ  ated. ZRUNLQJZLWKWKH&DQDGLDQ,QWHUQDWLRQDO'HYHO- Or consider Canada up against other countries on a similar measurement, RSPHQW$JHQF\ZULWLQJDUWLFOHVDERXW&DQDGLDQ FDUERQHPLVVLRQLQWHQVLW\SHUPLOOLRQVRI86GROODUVRI*'3%HWZHHQ 'HYHORSPHQW SURMHFWV WKDW ZHQW KDQGLQKDQG DQG&DQDGD·V*+*HPLVVLRQVLQWHQVLW\IHOOIURPWRQQHVRI&2H ZLWKWKHPLOLWDU\HͿRUW7KHDUWLFOHVDQGSKRWRV SHUPLOOLRQGROODUVRI*'3WRWRQQHVDGHFOLQHRIRYHUSHUFHQW were distributed to media across Canada, and $VRI&DQDGD·V*+*HPLVVLRQVLQWHQVLW\RQWKDWPHDVXUHPHQWZDV ZHUHRQGLVSOD\RQ3DUOLDPHQW+LOOIRU,QWHUQD- lower than many other energy-producing and energy-consuming countries, WLRQDO'HYHORSPHQW'D\ VXFKDV4DWDU WRQQHVRI&2HSHUPLOOLRQGROODUVRI*'3 WKH8QLWHG $UDE(PLUDWHV WRQQHV 6DXGL$UDELD WRQQHV &KLQD WRQQHV  ,WZDVDGDQJHURXVWLPHLQ$IJKDQLVWDQ7KH 2PDQ WRQQHV DQG5XVVLDDWQHDUO\WKUHHWLPHV&DQDGD·V´WRQQHVµ international military presence was relatively LQWHQVLW\DWWRQQHVRI&2HSHUPLOOLRQGROODUVRI*'3 new, parts of the country that I travelled to, such +HUHLVDQRWKHUFRPSDULVRQWKDWEHOLHVWKHQRWLRQ&DQDGDLVDODJJDUGLQ as Mazar-e-Sharif, had no foreign military pres- carbon emissions reductions: per capita emissions. ence and were ruled by local warlords, the infra- structure was so devastated you could not use Me in a minefield in Afghanistan in 2004. %HWZHHQDQG&DQDGD·V*+*HPLVVLRQVLQWHQVLW\RQWKDWPHD- There was a doctor and an ambulance stand- VXUHPHQW³SHUFDSLWD³IHOOE\SHUFHQW DFUHGLWFDUGWKHUHZDVQRWDQ$70RUEDQNLQ the country to withdraw cash, so every foreigner ing by while I was in there. Afghanistan was 6HOHFWHGRWKHUFRXQWULHVVKRZHGGHHSHUUHGXFWLRQV ZLWKVRPHRWKHUVLQ- dangerous for foreigners then, and is becom- FUHDVHV &DUERQHPLVVLRQVH[SUHVVHGDVWRQQHVRI&2HSHUFDSLWDIHOOE\ arrived with tens of thousands of US dollars, enough for their time in the country and enough ing dangerous now for Afghans who worked SHUFHQWLQWKH8QLWHG6WDWHVSHUFHQWLQWKH8QLWHG$UDE(PLUDWHVSHU with foreign governments. FHQWLQ4DWDUDQGSHUFHQWLQ$XVWUDOLD to get out in a hurry if need be. So the Kabul air- 0HDQZKLOHRYHUWKHVDPHSHULRGHPLVVLRQVSHUFDSLWDLQFUHDVHGE\ SRUW VWLOO ERPE GDPDJHG ZKHQ , ÁHZ LQ ZDV SHUFHQWLQ5XVVLDSHUFHQWLQ6DXGL$UDELDDQGQHDUO\SHUFHQWLQ full of foreigners carrying heaps of cash, and the WHUHVWLQ$IJKDQLVWDQKDYLQJVSHQWVRPHRIKLV Oman. 7DOLEDQKDG D VWDQGLQJ RͿHU RI  86 IRU IRUPDWLYH \HDUV LQ WKH FRXQWU\+LV IDWKHU ZDV +HUHDUHVRPHUHOHYDQWVWDWLVWLFVVSHFLÀFWRWKHRLOVDQGVDOZD\VDWRSLF any foreigner delivered to them. Canada’s military attache in Islamabad, and RIFRPPHQWDU\EHWZHHQDQGRLOVDQGVHPLVVLRQVLQWHQVLW\IHOOE\ But when you got to know the people, when ZKHQ'U.LWFKHQZDV\RXQJKHWUDYHOOHGLQ$I- QHDUO\SHUFHQW you were in their home they would defend you JKDQLVWDQH[WHQVLYHO\+HKDVEHHQWRD%X]NDVKL /RRNLQJDKHDG,+60DUNLWVSHFXODWHVWKDWLPSURYHGQHDUWHUPWHFKQROR- with their life. game, which would give him instant cred with JLHVDQGH΀FLHQFLHVFRXOGUHVXOWLQDWRSHUFHQWUHGXFWLRQLQWKH*+* I had an interpreter who worked with me for DQ\$IJKDQ LQWHQVLW\RIVWHDPDVVLVWHGJUDYLW\GUDLQDJHRSHUDWLRQV ZKLFKDFFRXQWHGIRU WKHWLPH,ZDVLQ$IJKDQLVWDQDQGIRUWKHODVW

TREE PROJECT! Games include: Set 5: August 9 to 20—2 Week Set - Public lessons We are very fortunate to have received a $10,000 grant Friday, August 13—Delbert Nixon-Guinness Field Set 3: August 2 to 6—1 Week Set - Private lessons from Family Violence Initiative. The grant is to be used 10 am Regina Expos @ Moosomin for our Tree Project in which we hope to bring families 12:45 pm Lumsden @ Regina Athletic Registration forms can be found: together with milestones and memorial plantings. 3:30 pm Saskatoon @ Regina Expos • Online at our Parks and Recreation If you and your family would like to plant a tree as a 6:15 pm Moosomin @ Lumsden home page • Online on our Borderland Co-op milestone/memorial and tend for the tree this year we Saturday, August 14—Delbert Nixon-Guinness Aquaplex Facebook page. would love to hear from you. We will supply the trees/ ‡3LFNHGXSDWWKH7RZQ2΀FH signage and you would plant and care for it. Field 9 am Regina Athletics @ Saskatoon • Watch for the form in the weekly Town If you are interested please contact us at 435-3622. of Moosomin ads in the World-Spectator 12 pm Regina Expos @ Lumsden HOME HARDWARE TREE PROJECT! 3 pm Moosomin @ Regina Athletics 6 pm Lumsden @ Saskatoon BRONZE MEDALLION AND CROSS COURSES In addition to the above project, Home Hardware Borderland Co-op Aquaplex will be hosting courses through their Tree Canada Program will be planting Sunday, August 15—Delbert Nixon-Guinness Field August 9-13. If you are interested please email the pool multiple trees at Bradley Park. The Park has come a 9 am Saskatoon @ Moosomin at [email protected] or call 306-435-2346 to long way from being virtually tree-less 20 years back! 12 pm Regina Athletics @ Regina Expos learn more and get registered! 3 pm Gold Medal Game BIG BIG SUMMER PLANNED MOOSOMIN SENIOR RANGERS FOR BRADLEY PARK! 13U PROVINCIAL BALL SCHEDULE ALUMNI ASSOCIATION Oh my, oh my, oh my, oh my. We are excited about a Nine teams registered in the 13U Tournament includ- We have a great start to the Association with 16 well huge summer planned for Bradley Park. Here is a list ing our own Moosomin Rangers. Teams have been di- of remaining summer events we have waited so long to known alumni already committed. The Executive Posi- vided into two pools for the tournament. tion include: run and are so excited to be a part of! Games include: Chairperson Mike Schwean Saskatchewan Baseball Friday, August 13—Kinsmen Field 9LFH   -HͿ&ROH Provincial 18U—August 13, 14, 15 SP0RRVRPLQ5DQJHUV#&DUQGXͿ$VWURV Treasurer Peter Nabholz Provincial 15U—August 13, 14, 15 3:30 pm Cardinal Redbirds @ Gator A’s 'LUHFWRURI3ODWHUV -HͿ&ROH Provincial 13U—August 13, 14, 15 SP&DUQGXͿ*DVKRXVH*DQJ#0RRVRPLQ5DQJHUV Blue Moose Lounge Peter Nabholz Pending teams in 18U/15U, we may not have space for both. Friday, August 13—Elks Field Members at Large: 1 pm Regina White Sox @ Royals Thunder Jason Miller, Todd Davidson, Ferell Horn, Garry Softball Saskatchewan 3:30 pm Langenburg Miners @ Moose Jaw Canucks Towler, Bob Mullett, Randy Schiller, Greg Light, John U12 Showcase—August 20, 21, 22 SP&DUQGXͿ$VWURV#5HJLQD:KLWH6R[ Glasser, Blair Hebert, Wayne McGonigal, George Hol- Includes District 1, 2, 3, 4. Up to two teams from each loway, Mark Holloway, Quinn Skulmoski Jody district. Saturday, August 14—Kinsmen Field Boutin, Brian Gabrielle, Jason Wiens, Dave Renneberg, 9 am Cardinal Redbirds @ Langenburg Miners Curtis Newton, Brian McCarthy. PROVINCIAL WEEKEND IS NEARING! 11:30 am Royals Thunder @ Cardinal Gashouse Gang There is no cost involved to join the Association and We are now just a few days from the 18U, 15U and 2 pm Gator A’s @ Langenburg Miners we would love to add more names to the above list. 13U Provincial Baseball Tournaments. Over 300 ath- SP&DUQGXͿ$VWURV#5R\DO7KXQGHU letes will arrive in town starting Thursday so expect the Also while we already have a couple fundraising town to be buzzing! Saturday, August 14—Elks Field LURQVLQWKHÀUHZHZRXOGORYHWRKHDUDQ\VXJJHVWLRQV Also keep in mind there is no gate fee for this tourna- 9 am Gator A’s @ Moose Jaw Canucks any Rangers fan might have. ment so it’s a great chance to enjoy the ball with your 11:30 am Moosomin Rangers @ Regina White Sox If you are interested in joining the Alumni Associa- family. Also note there will be a full concession at the 2 pm Moose Jaw Canucks @ Cardinal Redbirds tion or have a great fundraising thought please contact Remax Court, located by the Elks Diamond. 4:30 pm Regina White Sox @ Cardinal Gashouse Gang Mike at 435-3622 or by email at msmn.rec.brd@sasktel. Also take note we have Moosomin teams in all three net. divisions so it’s a wonderful chance to watch the home Sunday, August 15 town talent. DP3OD\RͿ*DPHIURP3RRO$RQ.LQVPHQ)LHOG SENIOR RANGERS ALUMNI PLANS 11:30 am Royal Thunder @ Moosomin Rangers on • 18U will be played on Borderland Co-op’s Murray This is a very dynamic group of former players and Kinsmen Field Newman Field and Home Hardware Field. builders. Here is a quick peek into what this group has DP&DUGLQDO*DVKRXVH*DQJ#&DUQGXͿ$VWURV • 15U will be played on Delbert Nixon-Guinness planned for the coming months: Field on Elks Field • Christmas Shoot Out Calcutta • 13U will be played on Elks Field and Kinsmen Field 2:30 pm Gold Medal Game on Kinsmen Field • Senior Rangers Alumni 2022 Spring Iron Man Tour- • Concession all weekend at Remax Court nament BEACH VOLLEYBALL COURT TAKING SHAPE! • Senior Rangers Alumni Meet and Greet Weekend MASSIVE PROVINCIAL WEEKEND! Thanks to a Saskatchewan Parks and Recreation As- • Senior Rangers Alumni Weekend August 12, 13 and 14 is shaping up to be the biggest sociation grant and donations by Gary Bonkowski and • Senior Rangers Hall of Fame Inductions/updating Provincial Baseball Weekend in Moosomin’s history as Jason Springer, our massive Beach Volleyball Court is the Sr Rangers picture board 21 teams will be in town competing for three Provincial closer and closer to being ready for Iron Man summer • League Player Draft Championships. 2021! Check it out—just south of our Main Park Con- • Operations of the Blue Moose Lounge cession! Teams and Divisions will include: MIKE SCHWEAN ARENA 18 U AA Tier 4 BORDERLAND CO-OP AQUAPLEX This might sound hard to believe but we are busy Moosomin Rangers We are now into our last two weeks for the summer booking our 2021/2022 Winter season at the arena. We Moose Jaw Canucks and it has been a great summer! If you are looking to anticipate the ice being in for Thanksgiving weekend. Parkland Expos book in for lessons or a party, please pop by the pool If you are looking to book ice please let us know at Lumsden Cubs during normal working hours or give them a call at 435-3622. Sask Five Giants 435-3622. Saskatoon A’s MOOSOMIN SENIOR RANGERS Saskatoon Cardinals BORDERLAND CO-OP AQUAPLEX We are busy preparing for another exciting year of AUGUST SCHEDULE Senior Hockey. If you are new to town and would like 15U AA Tier 3 to come out with the Rangers please give me a call at Moosomin Rangers 435-3622 and I will pass your name along with the man- Here is a listing of remaining programs and times: Regina Expos ager/coach. Regina Athletics Aquacize Lumsden Cubs PICKLE BALL Monday–Thursday 6:30-7 am Saskatoon Blue Jay Bruisers We’re started up for the season. If you are interested Lane Swims LQ SOD\LQJ FRQWDFW WKH 5HF 2΀FH DW  DQG ZH 13U AA Tier 4 will pass your name along. Moosomin Rangers Monday–Friday 7-8 am, 12(noon)-1 pm &DUQGXͿ$VWURV CAMPING SPACE Regina White Sox Public Swimming Moose Jaw Canucks Weekdays 1-5 pm, 7-8:30 pm We are excited to not only reopen our camping spac- Langenburg Miners Saturday 1-5 pm, 7-8:30 pm es on our main parking lot but 2021 sees six new sites Saskatoon Cardinals Redbirds Sunday 1-5 pm placed between the Generals Football Field and Home Saskatoon Gator A’s Hardware Field. If you are coming to town for a wed- Saskatoon Royal Thunder Family Swim Night ding, Conexus Convention centre event, ball tourna- Saskatoon Cardinal Gashouse Gang Sunday 7-8:30 pm ment, swimming lessons or family function, we would love to have you stay at our campground. They are in- 18U PROVINCIAL BALL SCHEDULE Royal Life Lessons tended as short-term stays, however they do all come Weekdays 8 am-12 pm I am sorry but as of print day the 18U Schedule has not with 30-amp power along with fresh town water. been posted. You can go to the Saskatchewan Baseball To book a site or for more information please contact Party Booking Times WKH5HFUHDWLRQ2΀FHDW $VVRFLDWLRQ ZHEVLWH ZKHUH \RX VKRXOG ÀQG WKH GUDZ Weekdays 5-7 pm XSCalgary and We need politicians and bureaucrats to share in the dif- for a backbench MP to $13,800 for Prime Minister Justin more than 34,000 employees at the city of Toronto re- ÀFXOWWLPHVDQGWDNHDFXW Trudeau. Before these pay raises, Trudeau and his minis- ceived a raise last year. How many other cities and prov- Franco Terrazzano is the Federal Director of the Canadian ters were already within the top one per cent of Canadian Taxpayers Federation. Rocanville Rec Report Andrea Logan, Recreation Director

ROCANVILLE RECREATION OFFICE Public Swim 1-7pm available. Summer Program: We are now accepting registrations Aqua Energy 7-8pm IRURXUVXPPHUSURJUDP3OHDVHFDOOWKH5HF2΀FHWRUHJ- Lane Swim 8-9pm TD Summer Reading Club ister 645-2164. Wednesday, August 11 Backyard Scavenger Hunt and Bingo!—Come on in to Roc Hard Fitness Presents—The Amazing Race: On Lane Swim 7:30-8:30am get a print out of fun items to look for in your own back- August 28, 2021. Registration at 9:30am or pre-register by AquaFit 9-10am yard! calling 306-645-0077. Adult Swim 10-11:30am Lane Swim 12-1pm If you have any questions feel free to contact the Library ROCANVILLE COMMUNITY Family Swim 1-3pm at 306-645-2088, by email [email protected] RUNNING CLUB Public Swim 3-5pm or through our Facebook page/messenger. Youth and adults welcome! Friday evenings at 7:30 pm. Water Basketball 5-6pm Please meet at the new pavement by the east portable Aqua Abs 6-7pm Hours: (school grounds). Contact Monique Campbell 728-7020 for Lane Swim 7-8pm Wednesday 9am-12p, 2-6pm more information. Thursday, Friday 2-6pm Thursday, August 12 ROCANVILLE TOWN & COUNTRY GOLF COURSE AquaFit 9-10am ROCANVILLE COMMUNITY Please see the website for tee time bookings, upcoming Adult Swim 10-11:30am THRIFT STORE events and info at www.rocanville.ca/golf. Lane Swim 12-1pm The thrift store is open Monday, Wednesday and Friday Family Swim 1-3pm from 1-4 pm and Thursday from 6-8 pm. Men’s Skins Night: Mondays—Shotgun start at 6:00. Public Swim 5-8pm Our volunteers make the thrift store what it is in our Register at the clubhouse by 5:45. 18 holes will be played Lane Swim 8-9pm community and we are always looking for new volun- on Mondays that fall on a statutory holiday. Note: Start teers. If you are interested times do vary depending on the time of year. Contact the Friday, August 13 in working a few hours a FOXEKRXVHWRFRQÀUPVWDUWWLPHV AquaFit 9-10am month, please call Marilyn Adult Swim 10-11:30am at 306-645-4553. BELOW FACTORY Ladies’ Night: Every other Wednesday starting at 6:00. Public Swim 12-3pm Public Swim 4-7pm ROCANVILLE FOOD DIRECT PRICING! Couples Golf: Fridays—One to two times per month. SHARE Just for fun! No scorekeeping! Saturday, August 14 NOW AVAILABLE Family Swim 10am-12 pm Please keep in mind the Glow Night Golf: On Friday, August 13, 2021. Registra- Public Swim 2-5pm needs of those less fortu- • Now selling tion at 8:30pm. nate and give to your local aluminum trailers Sunday, August 15 Food Bank. Monetary do- ROCANVILLE AQUATIC CENTRE Public Swim 2-5pm nations are gratefully ac- • SCREW PILES Please follow our Facebook page or our town website cepted. • 30’ Self Supporting for a schedule. 1HZSULFHVLQH;HFW Cheques made payable Note: Please phone 645-2164 to reserve spots for Public Swim to Town of Rocanville can Panels AquaFit, Lane Swim, Aqua Deep, Aqua Energy, Aqua Abs Preschool (ages two to four) $8 be mailed to Box 623, Ro- Structural Steel Dealer and Lifeguard Bootcamp as spots are limited. Student (ages seven to 17) $10 canville, SK S0A 3L0. An Adult (age 18+) $12 income tax receipt can be #1 Grade Coloured Monday, August 9 )DPLO\ PD[RIÀYH    provided for donations of $1.20/sq. ft. Lane Swim 7:30-8:30am Fitness Drop-In $7 $20 or more. B+ Grade Coloured  $TXDÀW   DP Lane Swim Drop-In $7 If you know anyone in $1.15/sq. ft. the area in need of food, B Grade Coloured Adult Swim 10-11:30am $1.05/sq. ft. Lane Swim 12-1pm please contact: B Grade Galvanized Public Swim 1-5pm ,I\RXKDYHDQ\TXHVWLRQVSOHDVHFRQWDFWWKH5HF2΀FH Darlene Williams 645- 306-645-2164. 2921 99¢/sq. ft. Water Basketball 5-6pm Multi Coloured Mill Ends Aqua Abs 6-7pm Pastor Paul Bunz 434- ROCANVILLE LIBRARY 5375 65¢/sq. ft. Lane Swim 7-8pm OSB 4’x8’ Cedar 8” oc 3/8 Tuesday, August 10 Programming: Roseanne Kelly 434-9484 $35/Sheet  $TXDÀW   DP Month of August Take ‘n’ Makes—All Natural Bug Betty Mills 645-2102 Adult Swim 10-11:30am Spray kit! And Felt Piggy WHITE PVC LINER Lane Swim 12-1pm kit! Follow us on Facebook $1.45/SQ. FT. to see when these items are BOUNDARY LANE COLONY Call us now for best selection of lengths & colors! – Graded farm fresh eggs for sale – ASK US ABOUT FUEL ALLOWANCE Logo Design – 20 sheep ready for butchering for sale – FOUILLARD STEEL WE’RE HERE TO HELP! Call Jonas at 204-851-6712 SUPPLIES LTD. 8 a.m.- 5 p.m. Open Saturdays CALL 306-435-2445 ST. LAZARE, MB Memorials for sale 1-800-510-3303 Call Dave 204-851-1968 44:7c www.fouillardsteel.com Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 13

Above and right: Kids racing to eat their mini watermelons.

Watermelon eating contest Borderland Co-op held a watermelon eating contest on Thursday with prizes for the winners in the junior and adult cat- egory who could eat the watermelon the fastest. The contest was held in front of the grocery store in Above: Keegan was the winner of the adult contest, eating half a large Moosomin. watermelon in under five minutes. Below: Jerry was the winner of the junior contest, winning a watermelon-themed floaty, towel and pass to the Borderland Co-op Aquaplex.

WE DESIGN CUSTOMCUSTOM SIGNSSIGNS VINYL BANNERS • COROPLAST • ALUMINUM COMPOSITE Reflective, Non-Reflective & Foiled Contact our talented designers to get them working on your project! 306-435-2445 [email protected]

Above: Keegan with his prize deluxe thermal cooler. 14 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

Chris Davidson Kyla Fingas E-mail: [email protected] Danny Grainger - 306-435-7914 306-434-8656 Phone: 306.435.3622 Town Foreman MOOSOMIN Ron Fisk Garry Towler 306-435-7111 (cell) Mike Schwean - Rec Director 306-435-3504 306-435-7595 306-435-7578 (cell) Mike Stein: Murray Gray Greg Nosterud: OFFICE MAYOR - Larry Tomlinson 306-435-7062 (cell) Catherine Mannle - Assistant Rec Director 306-435-9062 306-435-9406 RECREATION RECREATION 306-434-7579 (cell) 306-435-7943 COUNCILLORS PUBLIC WORKS

OCTOBER 1 - JANUARY 1 - MAY 1 - MAY 30 JUNE 1 - NOVEMBER 1 - RECYCLING CALENDAR OCTOBER 31 APRIL 30 TUES. - SAT. SEPTEMBER 30 DECEMBER 31 ROUTE A: TUES. - SAT. ROUTE B: TUES. - SAT. 12 Noon - TUES. - SAT. TUES. - SAT. 12 Noon - Homes on Broadway Homes south of LANDFILL 12 Noon - 6:45 p.m.. 12 Noon - 12 Noon - 6:45 p.m.. Avenue and North: Broadway Avenue: 3:45 p.m. 6:45 p.m. 3:45 p.m. SUN. AUGUST 16 HOURS SUN. AUGUST 23 12 Noon - 5 p.m. & AUGUST 30 SUN. & MON. SUN. & MON. 12 Noon - 5 p.m. SUN. & MON. & SEPTEMBER 6 CLOSED CLOSED CLOSED MON. CLOSED MON. CLOSED

701 MAIN ST. | BOX 730 | MOOSOMIN, SK | S0G 3N0 | E-MAIL: [email protected] | WWW.MOOSOMIN.COM | PHONE: 306-435-2988 | FAX: 306-435-3343

EMPLOYMENT OPPORTUNITY TOWN OF MOOSOMIN MATERNITY LEAVE POSITION - EXTENDED WATERING Moosomin Parks and Recreation are now accepting applications to fi ll a Maternity leave for the Position of Assistant Parks and Recreation Director. RESTRICTIONS Position to start approximately September 7 of 2021 and end October 15 of 2022. Due to the hot and dry weather that we have been experiencing the past short while, Application extension now open. the Town of Moosomin Water Plant is nearing capacity to keep up with production of potable water. Duties include: We want to ensure there is water available for human consumption and water reserve • Monday - Friday, 8 am - 4 pm in case of fi re, and therefore request that residents/businesses do not water grass be- (must be willing to work the occasional weekend and evenings) tween 8:00 a.m. and 8:00 p.m. It is during this hottest period of the day, that the water • Experience with event & facility scheduling and coordinating. evaporates and therefore needs signifi cantly more water to achieve the same results as • Profi cient with Microsoft Offi ce applications including Word and Excel. watering in the evening. • Excellent written and oral communication skills. It is expected that this daytime ban will remain in effect for the entire summer season, • Team and staff management skills. however, if it is lifted notice will be given to the public. • Effective decision making and negotiation skills. – Moosomin Town Council • Knowledge of social media 42:7c Applications can be sent to: We are very fortunate to have received a $10,000 grant Moosomin Parks and Recreation Department P.O. Box 430 • Moosomin, Saskatchewan • S0G 3N0 from the Family Violence Initiative! Applications can also be emailed to [email protected] or The grant is to be used for our Tree Project in which we hope to bring families together with milestones and memorial plantings. hand delivered to the Town Offi ce. If you and your family would like to plant a tree as a milestone or memorial If you would like further information or have questions please and tend for the tree this year we would love to hear from you. contact Mike at 306-435-3622 We would supply the tree and signage and you would plant and care for the tree. HOURS OF OPERATION If you are interested please contact us at306-435-3622 MOTOH MONDAY TO FRIDAY: 8:00 A.M.-4:30 P.M. PROJECT TREE MOOSOMIN ORGANIZATION FOR PRICES: TRANSPORTATION OF THE BUS PASS: $40 10 RIDES ONE WAY HANDICAPPED SINGLE RIDE: $5 ONE WAY RIDE BIG BORDERLAND COO-OP Provincial Baseball Borderland Co-op Aquaplex AUGUST SCHEDULE Weekend! AQUACIZE FAMILY SWIM NIGHT The largest provincial baseball Monday - Thursday Sundays: 7 pm - 8:30 pm tournament in Moosomin history takes place 6:30 am - 7 am ROYAL LIFE LESSONS LANE SWIM Weekdays: 8 am - 12 noon August 12 - 14, 2021 when we welcome Monday - Friday PARTY BOOKING TIMES 21 teams over 3 divisions to Bradley Park! 7 am - 8 am & 12 noon - 1 pm WEEKDAYS Saskatchewan Baseball PUBLIC SWIMMING 5 pm - 7 pm WEEKDAYS WEEKENDS Provincial 18U August 13, 14, 15 1 pm - 5 pm & 7 pm - 8:30 pm 11 am - 1 pm & 5 pm - 7 pm Provincial 15U August 13, 14, 15 SATURDAYS If you would like further Provincial 13U August 13, 14, 15 1 pm - 5 pm & 7 pm - 8:30 pm information or to book in please SUNDAYS contact a staff member at 3 DIVISIONS • 21 TEAMS 1 pm - 5 pm 306-435-2346. MOOSOMIN TEAMS IN EACH DIVISION REMAINING LESSON SETS FOR 2021 PUBLIC LESSONS WILL BE HELD THE WEEKS OF: NO GATE ADMISSION Set 5 August 9 to August 20 2 Week Set To register please contact a staff member at 306-435-2346 CALL FOR VOLUNTEERS! BRONZE MEDALLION AND CROSS COURSES IF YOU WOULD BE WILLING TO VOLUNTEER SOME TIME Borderland CO-OP Aquaplex will be THIS WEEKEND WE WOULD LOVE TO HEAR FROM YOU. hosting courses on August 9-13. We still require Scorekeepers and Pitch Counters! If you are interested please email the pool at If you are willing to volunteer please contact the [email protected] or call 306-435-2346 Rec Offi ce at 306-435-3622 to learn more and get registered!! Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 15 August long thank-you celebration

On atSaturday, Moosomin July 31, Moosomin Lake Regional Park hosted a day of events at the lake, including kids events and activities, a market, and a free con- cert in the evening with singer-songwriter Blake Berglund. The regional park traditionally hosts its Living Skies Come Alive Fireworks Competition on the August long weekend, but with Covid-19 mak- ing international travel and planning impossible early in 2021, the concert and day of events on July 31 took the place of the fi reworks show this year. Organizers are hoping for a return of the fi reworks show next year, and hosted the July 31 celebration this year as a way to thank everyone who has supported the Regional Park over the last few years. Clockwise from right: Oliver Slugoski en- joying one of the bounce tents; People shopping at one of the market stalls; Camryn Fingas sell- ing bath bombs and soaps at the market; The water walking roller balls on the lake were a big hit; Chelsea Sauvé and Dharma Boutin entertain- ing with their music; A child enjoying one of the bounce tents. 16 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

1SPWJODJư#Ƴ8FFLFOE The largest provincial baseball tournament in Moosomin history takes place August 12 - 14, 2021 when we welcome 21 teams over 3 divisions to Bradley Park! 3 Divisions • 21 Teams • Moosomin Teams in each division • No Gate Admission

2021 13U AA TIER  8 TEAM

CHAMPIONSHIP • AUGUST 13 - 15

+,

+,
2021 15U AA TIER 3 PROVINCIALS $ !
!"
"  
!"

"
%
$"
!$ 
"#! "


5 TEAM
 CHAMPIONSHIP!
• AUGUST 13 - 15 " # 
# !
*"
" # 
!
" $ "



#
 &

" # 
 '"
$ !
 

$
  
 
 
"
$

  

 

$
  

 
#
$
 
 
!
 


 
 
 
 
 
!
$

 

!  '(
$$"#
.0

 
 
0

 

!  '(
$$"#
.0
/)--











 "
 
+
"  
!"
!$ 
"#! "



!  '(
$$"#
.0
/)--

" 
 
+
!
" $ "

 '"
$ !
 

 

!  '(
$$"#
.0
2)--

" 
 
+

#
 &
# !
*"
 
!  '(
$$"#
.0
2)--

 "
 
+
$ !
!"
"
%
$"
!"
   
&'
(#%%


 







 # $ !  '(
$$"#
.1
4)--

 "
 
!
" $ "

"  
!"

 
  
 
 
 # $ !  '(
$$"#
.1
4)--









" 
 
 '"
$ !


!$ 
"#! "
 

$&
$# ##

 
&



 # $ !  '(
$$"#
.1
./)--

" 
 













#
 &
$ !
!"
 

$&
$% '(

 
&


 
 # $ !  '(
$$"#
.1
./)--

 "
 















# !
*"
"
%
$"
 

$&
& &#

 
&
 


 

$&
) $(

 
&


 # $ !  '(
$$"#
.1
0)--

" 
 
!$ 
"#! "
!
" $ "


 # $ !  '(
$$"#
.1
0)--

 "
 
"  
!"
 '"
$ !
 

$'

* ##

 
&

 
 
 # $ !  '(
$$"#
.1
3)--

" 
 
$ !
!"
# !
*"
 

$'
$% ##

 
&



 # $ !  '(
$$"#
.1
3)--

 "
 
"
%
$"

#
 &
 

$'
& ##

 
&


 

 

$'
) ##

 
&

 
$ '(
$$"#
.2
4)--

 "
 
+
!    !"

! $ ! 

$ '(
$$"#
.2
..)0-

 "
 
/



.


 

$(
* ##

 
&
 

$ '(
$$"#
.2
..)0-

" 
 
/



.


 

$(
$% ##

 
&

 


 

$(
& ##

 
&!

 
%

 

 
$
 

 
$ '(
$$"#
.2
/)0-

 "
 
 

 

Steven Bonk, MLA MOOSOMIN CONSTITUENCY 622 Main Street COMMERCIAL & RESIDENTIAL Moosomin, SK Quality Work at Competitive Prices FURNITURE • BEDDING • appliances OFFICE HOURS: Welcome to all the 9 a.m. - 12 Noon It’s a big 1 p.m. - 4 p.m. teams this weekend! Have a good time in Monday - Thursday weekend! Have fun, and Moosomin PHONE: Have a great good luck! 306-435-4005 STORE HOURS: ¨rœffxfc time everyone! 10 AM - 5:30 PM - MONDAY - FRIDAY OfZf¨r{{fc“„ One tournament, oZZ™f¢„–off 21 teams! Have a 815 BROADWAY AVE. • MOOSOMIN, SK fantastic Moosomin Regional weekend! Moosomin, SK 306-435-2154 Park Offi ce 306-435-2464 www.zaylie.ca 306-435-3531 Esterhazy, SK E-mail: [email protected] 306-435-3954 moosominregionalpark.com Moosomin, SK • [email protected] 306-745-3915 CALL FOR VOLUNTEERS! IF YOU WOULD BE WILLING TO VOLUNTEER SOME TIME THIS WEEKEND WE WOULD LOVE TO HEAR FROM YOU. We still require Scorekeepers and Pitch Counters! If you are willing to volunteer please contact the Rec Office at 306-435-3622 Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 17

1SPWJODJư#Ƴ8FFLFOE The largest provincial baseball tournament in Moosomin history takes place August 12 - 14, 2021 when we welcome 21 teams over 3 divisions to Bradley Park! 3 Divisions • 21 Teams • Moosomin Teams in each division • No Gate Admission

2021 18U AA TIER 4 PROVINCIALS 6 TEAM
 
CHAMPIONSHIP
• AUGUST 13 - 15




#
&
 $#
%#
%#
" 
(! #
#
'
 %#
#$
,#
# 
 "#


 
   
  
 
")*
%%#$
24
23+11


  
 



")*
%%#$
24
3+11

 "" 
 - !
%#
" 
")*
%%#$
24
3+11


 
"'"
#
'
#$
")*
%%#$
24

6+11


 "" 
 - !
 -!  
" #
")*
%%#$
24

6+41

 "" 
 - !
# 
#
&

$%")*
%%#$
25
8+11


 "" 
 - !
#$
# 
$%")*
%%#$
25
8+11


 
"'"
" 
#
'
$%")*
%%#$
25

23+11

 "" 
 - !
#
&
%#
$%")*
%%#$
25
4+11

 "" 
 - !
# 
" 

/
$%")*
%%#$
25

7+11

 "" 
 - !
%#
#$


/
$%")*
%%#$
25

7+11

 
"'"
#
'
#
&


/
 
 
 
 

 
 
 


% )*
%%#$
26
8+11


 "" 
 - !
// 
 


% )*
%%#$
26
23+11


   
 

 

4

 
3

 
% )*
%%#$
26
23+11




 
"'"
.


5
 
2
 
% )*
%%#$
26
4+11

 "" 
 - !

 

 
 
 

SAVE WAY TO GO Moosomin KARI’S KLOSET Parks and Sandal FASHIONS FOR ALL WOMEN % TEAMS! Recreation 25 OFF Go teams! HAVE A FUN the regular price of all in-stock Have a great weekend WEEKEND! SALE sandals and stop in to see us while you’re in Moosomin! WE CARRY ALL YOUR SUMMER STAPLES: • CLOTHING Welcome to • FOOTWEAR • SWIMWEAR Moosomin! Wellness & • GOLF APPAREL Have a great & MORE Mobility Centre weekend everyone! 0DLQ6W‡0RRVRPLQ6. 1004 North Front St. Main Store: 624 Main Street • Showroom: 601 Carleton St.  Moosomin, SK NDULVNORVHWRQOLQHFRP 306-435-2949 306-435-3622 306-435-4330 Follow us on Facebook www.moosominparksandrec.com Moosomin, SK • [email protected] IRUPRUHRXWÀWLGHDV CALL FOR VOLUNTEERS! IF YOU WOULD BE WILLING TO VOLUNTEER SOME TIME THIS WEEKEND WE WOULD LOVE TO HEAR FROM YOU. We still require Scorekeepers and Pitch Counters! If you are willing to volunteer please contact the Rec Office at 306-435-3622 18 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

Manitoba High School Rodeo held in Whitewood The Manitoba High School Rodeo Asso- ciation brought riders from both Saskatch- ewan and Manitoba to Whitewood over the August long weekend to compete in the 2021 Manitoba High School Rodeo. The event spanned the entire weekend and young riders competed from Saturday to Monday.

Gotcha! One young rider lassos a calf during Saturday’s calf roping event

After dismounting, a participant pursues a speedy goat during the junior goat tying event

In hot pursuit of a calf, a rider prepares to throw his lasso

A rider prepares to dismount and tie a goat dur- A participant dismounts to pursue a goat during the ing the goat tying event. junior goat tying event. A participant in the calf roping event.

A participant in the calf roping event. A participant prepares to tie a roped calf. Monday, August 9, 2021 The World—Spectator — Moosomin, Sask. 19 Olympic games generally forgettable This has not been your ordinary Olympic Games. This that undersized group, but one of them might win the year’s event in Tokyo, Japan, will go down in the annals Kentucky Derby.” of Olympic history as one the world never wants to see • Norman Chad, on Twitter: “With the USA losing to again. France in Olympic men’s basketball—due to an over- For starters, the 2020 Summer Olympics were held in looked clause in the 1886 transaction between the two na- DQGIRUWKHUHFRUGWKHQXPEHURIRIIÀHOGRUQRQ Bruce Penton tions—the USA must now return the Statue of Liberty.” athletic stories have outnumbered the normal. • Phil Mickelson, on Twitter, after Tour player Harry Thanks, coronavirus. Thanks for nothing. Higgs begged for a Tuesday practice round with him, Athletes left and right opted out of the Games for a during which some gambling dough will be at stake: variety of reasons, primarily Covid-19 concerns. Among “This will save me a trip to the ATM . . . thank you.” the best tennis players, Rafael Nadal and Roger Federer, more young people, but in general, TV ratings for the • Golf Channel broadcaster Shane Bacon, on Twitter: stayed home. Some of the world’s best golfers—Adam Games were at an all-time low—you’ve probably heard “I love that Sepp Straka’s (Olympic Games) hat says ‘golf Scott, Dustin Johnson, Bryson DeChambeau and the that young people today don’t watch as much TV as their team’ on the side in case he gets confused and wants to world No. 1, Jon Rahm—were all absent from competi- parents—and Covid-19 was the dominating theme of the try his hand at taekwondo.” tion. Thankfully, Canadian superstar swimmer Penny two-week sports festival. Reports out of Tokyo said the • Comedy writer Alex Kaseberg: “Imagine how fast Oleksiak was not. majority of citizens of Japan’s largest city were against those Olympic swimmers would be if they didn’t have to The most celebrated Games’ performer, U.S gymnast the Games altogether. tow those huge banners with their name, place and their Simone Biles, cited mental health concerns, accelerated by When it’s all over, results from the 2020 Olympic FRXQWU\·VQDPHDQGÁDJ"µ Covid-19, for pulling out of a number of events. Mental Games will be posted in the record books and the Sum- • Another one from Kaseberg:” NBC say their ratings health injuries, we’re discovering, are just as debilitating mer Olympic focus will switch to Paris, France, where the at the Tokyo Olympics are down 36 per cent from Brazil as physical ones. *DPHVDUHRQO\WKUHH\HDUVDZD\%\WKHQWKHZRUOG ÀYH\HDUVDJR2QFHDJDLQ7RN\RSXWWLQJWKHOLPSLQWKH Others, like the world’s best female tennis player, Nao- will have hopefully returned to normal and sports and Olympics.” mi Osaka, withdrew from the French Open and Wimble- athletes will take centre stage, where it belongs. And we • Jack Finarelli, at thesportscurmudgeon.com: “If I don due to mental health issues and then lost relatively add an adjective to the Tokyo Games that may last for- woke you up from a dead sleep at 2 am and asked you early in her home country’s Olympics. ever—forgettable. to give me all your free association thoughts that go with The world is different this year, as are the sports fea- • Sam Farley, on Twitter: “You really can’t beat the ‘Cleveland, would you have gotten to ‘Guardians’ any tured in the Olympics. Skateboarding, for example, was Olympics. That golden two-week period when you live time before 6 am? LQFOXGHGLQWKLV\HDU·V*DPHVIRUWKHÀUVWWLPHHYHUDQG and breathe handball, archery and gymnastics, only to • Headline at theonion.com: “Conservatives Blast Sim- two 13-year-olds and a 16-year-old were medal winners forget about it for another four years afterwards.” one Biles For Robbing Them Of Opportunity To Criticize LQ RQH RI VNDWHERDUG·V ÀUVW HYHQWV 7KHLU WRWDO DJHV  • Patti Dawn Swansson on Twitter: “Interesting that Her Win” was approximately the average age of individuals on the Elliotte Friedman regularly appears on Canadian hockey • Another one at theonion.com: “Kings concerned U.S. equestrian squad. Faster, higher, stronger, indeed. broadcasts looking like a railyard hobo, but he tidies him- about character issues after multiple prospects lie about You can also add ‘younger’. self up for American TV. I just wonder if ESPN instructed being excited to play for Sacramento” Other new sports, all obviously aimed at trying to at- him to clean up his act. If so, why doesn’t Sportsnet do • fark.com headline: “The fact that we don’t celebrate tract a younger demographic, included three on three the same?” silver and bronze is (wrong),” says some person who EDVNHWEDOO VXUÀQJ VSRUW FOLPELQJ %0; IUHHVW\OH DQG • Swansson again, on the Winnipeg Jets’ roster of small didn’t win a gold medal” karate. defencemen: “They’ll never win the Stanley Cup with Care to comment? Email [email protected] It all might work out, and the new sports might attract Jets fall to Gems in fastball fi nal BY TRAVIS LONGMAN over second base which scored Haylock to give It was a battle of the top two teams for the South the Gems a 1-0 lead. East Men’s Fastball League championship on After Haylock scored the opening run for the Tuesday in Grenfell. Gems and with Pollock on base, Nathan Bender The number one seed Grenfell Gems took on the came up to the plate. Bender smashed a two run second seeded Fleming Jets for the league cham- home run that still may not have landed. Grenfell pionship. had a 3-0 lead after three innings. Jeremy Kenny was the starting pitcher for the That was more than enough offense for Kenny Gems, Brayden Stewart got the ball for the visi- and the Gems. The Jets couldn’t muster any runs tors. They were arguably the two best pitchers in but they were able to hold the Gems off the score- the league this season. ERDUGWKHUHVWRIWKHZD\7KHÀQDOVFRUHZDV The game was a back and forth affair and the For Grenfell it is the team’s second consecutive pitching lived up to its billing. league championship and third in the last four The game was scoreless through two and a half seasons. innings when the Gems struck. The Jets got two Another exciting season of fastball is in the quick outs in the inning but then Kale Haylock hit books. Congratulations to Grenfell for winning the DVLQJOHZKLFKJRWSDVWWKHÀHOGHU+D\ORFNHQGHG championship and to Fleming as well as the rest of up on third base. the teams, umpires and fans on another great sea- The Grenfell Gems with their league championship trophy The next batter up, Pollock, hit a bloop single son of the South East Men’s Fastball League!

Making aquariums Children with the Moosomin Family Resource Centre’s summer pro- gram were busy making aquariums last Wednesday. The program has been keeping them busy with lots of activities over the summer on weekdays.

Above: Nixon Hockley and Anastasia Mokelki putting the fi nishing touches on their aquariums.

Left: MFRC summer program co-ordinators helping the children fi n- ish up their projects. 20 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 21

• Bookings 4-20 players • 50+ Discount • Speedball and Woods • Personal/Business Memberships • Action Photo Package

306-695-3764 • Indian Head, SK Teresa Minty photo www.aapaintballindianhead.ca 45:2c Kari Meyers photo Macy Minty fi shing at Round Lake. Candence Penner and Logan Bruce surfi ng (and Julie Bell photo Bretten Grose photo crashing!!) at Moosomin Lake Pepper Stuart at Welwyn Regional Carla McCall photo Navy Grose at Fieldstone Campground Park. Ten months old enjoying the Siblings Finley & Hayden McCall at the swing on a hot summer day. Grenfell swimming pool.

42:8c Welcome to BORDERLANDCOCO-O O P 415 Gertie Street &RPHDQG3OD\ THE the Market! Moosomin, SK ZLWK:RQGHUKXE Fresh Veggies 306-435-2346 RED MARKET Homemade Baking [email protected] GOLF Explore our engaging exhibits and Wholesome Preserves Scenic golf experience with lush-lined educational programs that focus BARN Handmade Fabric Goodies fairways nestled in the hills of the on STEAM! Open now for general Fridays Natural Soaps Qu’Appelle Valley. Deliciousness Handcrafted Candles admission, and birthday party bookings! is a state of mind Stop by for some fantastic fun, food & shopping! 10:00 - 12:30 And so much more! BOOK A TEE TIME BY PUBLIC SWIMMING ØĽîƪNjŃŚŚǑŰƲēŃƞČŰNJĚƖƪŰēîǑ͌ Open 7 a.m. - 10 p.m. • Live Music 4.2 kms north of Kenosee Lake on #9 Highway CALLING THE PRO SHOP: Check out our free videos and printables on Wonder World. Seven Days a week • Fresh Produce Open Sunday from Every day between 1 p.m. - 5 p.m. 10 a.m. - 4 p.m. through the summer 565-6th Ave 306.696.2507 wonderhub.ca 950 Spadina Crescent East 42:8c • Arts & Crafts and 7 p.m. - 8:30 p.m. Proudly owned and operated Saskatoon | Tue-Sun 9am-6pm • Home-Based Businesses Virden, MB by Cowessess First Nation CLUBHOUSE: 306.696.3204 404 Mountain St. | Moosomin, SK | 306-435-3266 306-577-1005

43:3c 42:4c We’re Open!

ROCANVILLE & DISTRICT MUSEUM SUMMER HOURS: MARKET WEDNESDAY - SUNDAY @ 4 P.M. AT Packages Amenities Under DINE-IN MEALS & TAKE-OUT AVAILABLE Available: Our Roof:  Steak & Lobster Special Nightly THE MUSEUM • Play & Stay Golf Package • Water’s Edge Dining Room  BBQ Pork Ribs & 5-Wing Combo Specials • Water Experience/ and Patio  World-Famous Pizza • Water Crest Café, Gift Shop Kayaking Packages  And all your favorites are back! SATURDAY, AUGUST 14, 2021 • Romance Packages • Serenity Spa, Fitness Centre prairiegatewaytourism.ca Unlimited access to Mineral water pool included with all hotel stays. Visit www.mooseheadinn.ca for full menu Bathrobes + towels provided. COME OUT AND DANCE! @prairiegatewaytourism LIVE MUSIC Across the street from Little Manitou Lake Cabaret Nightclub is now open every T ADMISSION @prairiegatewaytourism TAKE BY 302 Maclachlan Ave., Manitou Beach, SK Friday - Saturday night 9 p.m. -2 a.m. BY DONATION Ainsley Friesen [email protected] RESERVATIONS: 1-800-667-7672 KENOSEE LAKE • 306-577-2226 YOUR SUMMER Proceeds to the Rocanville BEST SH & District Museum operations Full Breakfast Menu: 8 am - 11 am Send us your photos of summer fun FUN around the region this summer for a PHOTO QHAY RIDES Full Lunch and Supper Menu chance to win $100 and have your Q VENDORS CONTEST VENDOR TABLES: $25 Supper Specials every Friday & Saturday night! photos published in the newspaper! Watch for specials other times! Q MUSEUM TOURS Granny Mo’s Fried Chicken buckets and meals, Foot Long Hot Dogs, Photos can be e-mailed to Q NEW ANTIQUE Mini Donuts, Pizza, Fresh Squeezed Lemonade, Soft Serve, [email protected] VEHICLE RIDES at Moosomin Regional Park Hard Ice Cream, Sundaes, Banana Splits, Parfaits, Appetizers BARBECUE LUNCH PROVIDED BY ROYAL CANADIAN LEGION 306-434-7693 Bait and Fishing Tackle BRANCH #020 220 Qu’Appelle Ave. [email protected] Rentals www.rocanville.ca Open 8 a.m. - 8 p.m. Rocanville, SK Canoe, Kayak, Paddleboard, 306-645-2113 Seven Days a Week! Pedal Boat and E-Bike Rentals 42:6c 22 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 SPY HILL SPORTS DAYS August 14 & 15, 2021

Kids activities and an antique tractor show will once again be part of the Spy Hill Sports Days weekend. These photos are from 2019.

Proud supporters of the Spy Hill Sports Days & Rodeo. Come on out and have a good time! It's about you, not Proud to support Spy Hill just your finances Sports Day and Rodeo! Have a Great Weekend!

Kioti Tractor supplied by Universe Satellite Sales Ltd.

PRAIRIE LIVESTOCK

#1 Highway West 1.800.667.7477 502 Railway Ave Moosomin, SK conexus.ca Rocanville, SK Rocanville, SK PHONE: 306-435-3327 306-645-2669 www.universesatellite.com 306-645-2032

Have a great time at :HOFRPHWR Spy Hill Sports Days! 6S\+LOO 6SRUWV'D\V Proud to be part of your community 2021 306-534-4724

&$7+$< :$*$17$// www.world-spectator.com Have a great 0HPEHURI3DUOLDPHQW weekend at 306-435-2445

Above: Torrie Knash tosses a bale during the 2019 bale toss. Above left, Chariot racers, and top of page, chuckwagon racers thunder around the Spy Hill Sports Days are back for 2021, and track in 2019. while the chariot and chuckwagon races won’t be a go this year, there will be a kids rodeo, barrel racing, team roping, slo pitch, an antique tractor show, and antique tractor pull, kids ac- tivities, a church service and a pancake break- fast. Shown here are some moments from the 2019 Spy Hill Sports Days event.

Left: Montana Turpie barrel racing at the 2019 Spy Hill Sports Days.

Right: Charles Apland in the mutton’ bustin’ event in 2019.

Quality HIGHWAY 8 • ROCANVILLE SK Equipment 306-645-2112 Since 1983

Proud to support Spy Hill Sports Days! Liquor Franchise & We hope you have fun at the Reverse Osmosis Bottled Water Spy Hill Sports Days and Rodeo! ,SSPJL:[YLL[9VJHU]PSSL:2   24 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

SPY HILL SPORTS DAYS August 14 & 15, 2021 ADMISSION: $10/DAY | 12 & UNDER: FREE Saturday Rodeo Sunday Rodeo Kids Rodeo: 10 a.m. - 12 Noon ³ ³ Pancake Breakfast ³ Barrel Racing: 12:30 p.m. 9 a.m. - 11 a.m. both days ³ Team Roping: 2 p.m. ³ Church Service ³ Slo-Pitch August 15 at 10 a.m. To register a slo-pitch team contact ³ Team Roping: 11:30 a.m. - 1 p.m. Corbin: 306-743-7456 ³ Show & Shine Car Show ³ Antique Tractor Show All Day Saturday & Sunday 11 a.m - 3 p.m. Antique tractors welcome to the show ³ Antique Tractor Pull ³ Kids’ Activities SUNDAY AT 2 P.M. Antique Tractor Pull Register/Weigh by noon on Sunday ³ Up to 100 hp. For inquiries or entries SATURDAY AT 5 P.M. contact Cameron Duncan: 306-745-7428 Register/Weigh by 3 p.m. on Saturday Up to 100 hp. For inquiries or entries ³ Beer Gardens both days contact Cameron Duncan: 306-745-7428 ³ Other events TBA For more information contact Jeff: 306-740-8025 Monday, August 9, 2021 World-Spectator - Moosomin, Sask. 25 Sask increases AgriStability interim payment

BY KEVIN WEEDMARK WDNHQ HVSHFLDOO\ IRU WKH VLJQLÀFDQWO\LQWKHFDOFXOD We listen to them and they that we are looking at. It’s The federal and pro- OLYHVWRFNVHFWRUµ WLRQV WR UHDOO\ EHQHÀW WKH make recommendations decisions that the ranchers vincial governments have Marit said he believe producers. I think with on things that they think ZLOO KDYH WR PDNH EDVHG agreed to increase the $JUL6WDELOLW\ LV ÁH[LEOH that and some of the other might work and we look on what their individual 2021 AgriStability interim enough to be a useful tool things we’ve done with at it as a ministry with my situations are. I know EHQHÀW SD\PHQW SHUFHQW in a drought year like 2021. crop insurance on raising R΀FLDOVDQGVD\FDQZHGR some ranchers that have age from 50 per cent to 75 “I think the biggest WKH OLPLWV RQ ZULWH RͿV LV this within the parameters WKHLUIHHGWKH\KDYHJRRG per cent for Saskatchewan WKLQJ  LQ WDONLQJ WR P\ JRLQJ WR KHOS QRW RQO\ of the programs and then ZDWHU DQG ORWV RI SDVWXUH producers. stakeholders over the past grain farmers but also cat- there is another lens to put it’s still dry but they’re 7KHLQWHULPEHQHÀWSUR \HDUWKHELJGHWHUUHQWZDV tlemen because it has to be RQ LW ZKLFK LV DͿRUGDELO doing well. Then we have vides the opportunity for the reference margin limit. used for green feed to get LW\µ some that have virtually producers who are en- That seemed to be the big- LWWRJRWR]HURµ Marit said the changes no feed left and the pas- rolled in AgriStability to gest deterrent for all sec- Marit says the changes should help producers but WXUHVDUHSUHWW\ZHOOGRQH access a portion of their WRUVERWKWKHOLYHVWRFNDQG made this summer on the department is always and then they don’t have EHQHÀW HDUO\WR KHOS VXS the grain side. We felt it farm support programs looking at additional mea- a water supply either. It’s port losses and cover costs. was important to get that come from a combina- sures. a real mixture. So you try :LWK WKLV LQFUHDVH 6DV ORRNHG DIWHU DQG ZH GLG tion of consultations with “We are always open to DQG ÀQG D PHGLXP DQG katchewan producers can Another thing we took industry groups and dis- WKH GLVFXVVLRQµ KH VDLG WU\WRZRUNDQGÀJXUHRXW apply for an interim bene- to the table was that any cussions within Saskatch- Saskatchewan “We will have another dis- what will help in all as- ÀWWRUHFHLYHSHUFHQWRI private insurance revenue ewan Agriculture. Agriculture Minister cussion next week with the SHFWVRILWµ WKHLU HVWLPDWHG ÀQDO  you got doesn’t go against “It’s a combination of stakeholders and the one In what has been a very EHQHÀWEHIRUHFRPSOHWLQJ your AgriStability. If guys working within the de- David Marit thing we have engaged in challenging year for pro- their program year. got hailed out or had a partment and working now is we are pretty well GXFHUV 0DULW VD\V KH KDV 7KH LQWHULP EHQHÀW LV livestock price insurance with producer groups to on daily calls with my had a challenge in trying calculated based on the es- payout then that didn’t ÀJXUH RXW ZKDW ZLOO KHOS put into their jurisdiction FROOHDJXHV IURP $OEHUWD to navigate through the timated margin decline or go against them as rev- producers the most. YHUVXVRWKHUSURYLQFHVµ 0DQLWRED 2QWDULR DQG crisis as agriculture min- loss for the year compared enue. Those two changes “We have a good work- Marit says 2021 is an ex- ourselves to talk about ister. to the farming operation’s ZLOOPDNHDELJGLͿHUHQFH ing relationship with our treme year. what are some things we ´,W·V D ORW GLͿHUHQW WKDQ reference margin. The de- to some AgriStability pa- stakeholders both on the “This year is a very se- FDQ GR DQG WKH IHGHUDO LWZDVD\HDUDJRµKHVDLG cline must be at least 30 WURQV DQG ZH ZLOO VHH grain and the livestock YHUH \HDU IRU DOO VHFWRUV government is going to ´:H FDPH RͿ RI D UHFRUG per cent below the refer- where that goes. I think side. for the crop guys and the have a big part to play in crop and livestock prices ence margin to access a with those changes it’s go- “We listen to what they OLYHVWRFNJX\VµKHVDLG that. We’ve all made ap- were good and rainfalls payment. If a producer LQJ WR PDNH D ELJ GLͿHU think are the concerns and ´:HMXVWJRWRͿWKHFDOOV plications for Ag Recovery were good. UHFHLYHVDQLQWHULPEHQHÀW ence to a lot of producers ZKDWWKH\ZDQWWKDW·VZK\ this morning with a pro- and we’re just waiting for “These are the challeng- SD\PHQW WKH\ PXVW VWLOO KHUHLQ6DVNDWFKHZDQµ the reference limit margin GXFHU JURXS ZH·YH EHHQ the federal government es that we always have in ÀOH DOO ÀQDO SURJUDP \HDU Marit said AgriStabil- ZDVUHPRYHGZHKHDUGLW having weekly calls with to do the assessment on WKLV SURYLQFH ZH·YH KDG forms and meet program ity has become more user- loud and clear from our producer groups. We talk that and we have asked years before where we requirements by the as- friendly. stakeholders. So we look to the crop groups for an for the tax deferral for didn’t have rain and no signed deadlines. “They just take their at that and we look at what KRXU DQG WKH OLYHVWRFN the livestock sector across UXQRͿDQGLWFDXVHGFKDO Saskatchewan Agricul- numbers to their accoun- WKH ÀQDQFLDO LPSOLFDWLRQ JURXSVIRUDQKRXUVRZH the board and looking at lenges then too. ture Minister Dave Marit tant and they can go online could be to the taxpayers have a good discussion things like that that we “So the industry and the told the World-Spectator and there is an app where and then there’s another on what the challenges can do to assist the pro- agriculture community Thursday that he hopes WKH\FDQÀOOLQWKHLUQXP partner here and that’s the are and what the concerns ducers and work with our ZLOO ÀJXUH WKLV RXW  ,W·OO WKHFKDQJHPDNHVDGLͿHU bers and it will do a quick federal government. So we are. With the severity of colleagues across western balance itself and we’ll ence for producers. calculation on what they have to be communicat- WKH FURS DQG WKH \LHOGV &DQDGDµ work with them the best “Under the program might be receiving. ing with them and if there everyone is concerned Marit said he is con- way we can to try and de- you could advance 50 per “So it’s a lot better than are changes that we’re go- DERXWWKDWDQGWKHQRQWKH cerned about a possible liver something that really cent of what your eligibil- it was a few decades ago ing to make or they want livestock side we have a VHOORͿ RQ WKH /LYHVWRFN is meaningful to them and LW\ ZDV DQG QRZ ZH·YH ZKHQ LW ÀUVW FDPH RXW to make there has to be a couple of concerns. Feed is side. to help maintain or at least raised that to 75 per cent and there were produc- working relationship there QXPEHURQHDQGZDWHULV “We are worried about it sustain a big portion of the just because we know ers scared to go and get it to say whether something becoming an issue as well. and that’s why we’re look- LQGXVWU\KHUHµ there are producers out because there were guys makes sense or doesn’t. ing at some of the options there who will be in cash that had to pay it back The provinces do have VWUDSSHG VLWXDWLRQVµ KH DQG WKLQJV OLNH WKDW VR VRPH ÁH[LELOLW\ RQ SUR told the World-Spectator the program has changed grams that they want to in an interview Thursday. “I think this is going to PDNHDGLͿHUHQFHIRUDORW LANE REALTY of people. I got a message MAKE EVERY from a farmer this morn- NEW! LQJ DQG KH VDLG ¶WKDQNV that’s going to help me.’ LANGBANK - 63535 ACRES: 492 cult., BUSHEL He knew he was going to 13,450 bu. grainainSOLD storagestorage,stora shed, TO YOUR FIELD, HOME AND YARD be in a payment situation updated home, on Hwy.H# #9, North of Langbank COUNT THIS and he could use the extra WE’RE HERE TO 25 per cent. It’ll be taken WHITEWOOD - 3 ACRES: Vacant 1¼ Storey, up by whoever feels that SERVE YOU HARVEST they’re going to be in a well, power, on Hwy. #1 payout situation. With the For all of your buying or selling needs contact: removal of the reference JASON BEUTLER (306) 735-7811 margin limit there will be a YOUR LOCAL SOURCE FOR AGRICULTURAL PARTS AND SUPPLIES few that will trigger some type of payment so hope- Saskatchewan’sLANE Farm REALTY & Ranch Specialists ™ fully this will help. It is just WITH OVER 39 YEARS IN THE BUSINESS! a measure we thought we [email protected] could take along with the Ph: (306) 569-3380 • other measures we have www.lanerealty.com 45:1c CUSTOM SILAGE HARVESTING

CHOPPING BUSHEL PLUS AND DUCKFOOT PACKING AUTHORIZED HAULING DEALER SWATHING ALFALFA • CEREALS • CORN Contact: 204-851-5679 for details and rates

VIRDEN, MB P 204-748-4469 E [email protected] VIRDENAG.CA 26 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 McNaughton High School Sports: ‘A 50 Year Replay’ A panel of three people—Terry Lynd, Margie Gibson and Barry Rambold—have researched and compiled a 50-year history of sport at McNaughton High School, which they have been sharing with World-Spectator readers over the next few months. The group has done extensive research and has touched base with some former Moosomin athletes to see where they are now, and will be recognizing some of McNaughton High School’s greatest athletes of all time. We thank them for their work and hope you enjoy the shared results. Amalgamation: 2006-2010 There was no bigger story in education in 2006 than meet at Douglas Park in Regina for years. Athletes from Field meet in 2010 as he brought home two bronze med- the amalgamation of numerous school divisions around McNaughton quickly proved that they would be a force als and two fourth place ribbons. the province. This movement in the school system had a to be reckoned with at the district level as 17 team mem- 7KHWUDFNDQGÀHOGVHDVRQZDVDWRWDOGLVDVWHUDV dramatic impact on high school sports. School divisions EHUVTXDOLÀHGWRPRYHRQWRWKH3URYLQFLDO&KDPSLRQ- weather and teachers’ withdrawal of voluntary services EHFDPHVLJQLÀFDQWO\ELJJHUDQGWUDGLWLRQDOULYDOVIRXQG ships in 2007. This was the largest contingent of Marquis shut down the season totally. themselves competing against schools they had seldom WUDFNDQGÀHOGPHPEHUVWRHYHUDWWHQGDSURYLQFLDOFRP- 8. The cross country team won a silver medal in the played in the past. petition. team competition at 2006 Provincials. This was the third The Moosomin School Division, which consisted of 0DUTXLV0RPHQWV year in a row that the cross country team picked up a 0RRVRPLQ5RFDQYLOOH0DU\ÀHOGDQG:DSHOODZDVLQWH- 1. Chelsea Hebert established three new records at medal. grated into the new South East Cornerstone School Divi- District Track and Field in 2007. Competing in the Ban- 9. Allison and Chelsea Hebert both won Athlete of the sion. This division currently covers the majority of the tam Girls category she established records in the 800m,

3URÀOH I graduated from McNaughton High School in 2008 and went on to get my Bachelor of Science in Agriculture 3URÀOH at the University of Saskatchewan. During my university Allison Hebert After I graduated from McNaughton High School, I at- years, I continued to play recreational volleyball, tried tended the University of Regina and eventually convo- and failed at curling and learned that my mom was right, cated with a Bachelor of Education. I am currently teach- a good run in the fresh air was the best way to de-stress ing at Balcarres Community School and living in Melville from a long day. with my girlfriend Katelin and our dog Molly. I convocated from the U of S in 2012 and worked in I continue to be involved in sport through coaching of Assiniboia as an Agronomist with Cargill. I eventually -XQLRUDQG6HQLRUEDVNHWEDOOWUDFNDQGÀHOGDQGVRIWEDOO moved to Lethbridge, and then on to Calgary in 2018. In My fondest Marquis memory happened in the spring November of 2019, I took a role with Yara North Ameri- of 2007 at the Regional Basketball Championships in can where I specialize in crop nutrition for not only prai- Warman. This was the closest thing to a hostile environ- rie crops, but also fruits and vegetables. ment I’ve ever been a part I don’t participate in organized sports anymore but I of. The stands were packed, have really enjoyed exploring the mountains either on my people had noise makers snowboard, with a pair of hiking boots or checking out a and the atmosphere was hidden lake with my kayak. I must say, the most chal- electric. We were consid- lenging adventure has been a six-day hike on the West ered the lower seed be- Coast Trail with my fellow Marquis, Lauren McCarthy. tween the two teams so we We covered 75 kilometers, 108 bridges, and 75 ladders all GHÀQLWHO\ IHOW OLNH ZH KDG while carrying our 45 lb packs. something to prove. Both I am a proud auntie of four nephews and a niece whom teams played an up tempo I am always excited to see when I come home. Watch- style of game. The game ing them learn new activities and sports brings back fond was very evenly matched memories of my childhood. Some of my most treasured until late in the third quar- Marquis memories were of the many road trips with my ter when we started to cre- teammates on the volleyball and basketball teams. So ate a little separation on many laughs and embarrassing photos which are now the scoreboard. In the clos- locked in a safe, never to be shared with the public! ing minutes with us well I was very proud to wear the Marquis Green. Those ahead, the gym was abso- years were some of the best of my life. I look forward to lutely silent, it was surreal. the day when my niece and nephews will get to experi- Final Score 93-78! ence the same joy of being a Marquis. Monday, August 9, 2021 The World—Spectator — Moosomin, Sask 27 Coaches Honor Roll Janet Frondall Bill MacPherson her and my niece Lisa to practices, games and tourna- Jan was a provincial competitor herself, winning a As McNaughton entered the 21st Century, Bill became ments, so when Barry Rambold asked if I would like to EURQ]H PHGDO LQ WKH P EDFN LQ  6KH VSHQW QX- an invaluable contributor to the Marquis basketball pro- KHOSFRDFK,VDLG\HV)URP,FRQWLQXHGWRKHOS merous hours over the years helping with both the cross grams as a coach, manager, and most importantly as a with the girls, then took a break for a few years to coach FRXQWU\ DQG WUDFN DQG ÀHOG SURJUDPV DW 0F1DXJKWRQ WRSTXDOLW\RIÀFLDO some Junior basketball teams in Wapella before returning +LJK6FKRRO WRWKH0DUTXLVLQ,Q,KDGDQRSSRUWXQLW\WR get involved with the boys program and contributed as D FRDFK RU PDQDJHU XQWLO  'XULQJ WKLV WLPH , KDG the opportunity to work with some excellent basketball people including Herb Kempin, Ryan Bartley, Ian Glasser DQG&ROE\'DYLGVRQ When I got started at McNaughton, I quickly realized WKDWWKHUHZDVDUHDOQHHGIRUEDVNHWEDOORIÀFLDOVLQWKH DUHD:LWKWKHJXLGDQFHRI)UHG-HUUHGDQG7HUU\/\QG ,VWDUWHGGRLQJVRPHRIÀFLDWLQJZKLFK,FRQWLQXHGXQWLO  I’m still living on the farm west of Wapella with my ZLIH 6WDFH\ :H DOZD\V ORYH JHWWLQJ WRJHWKHU ZLWK RXU NLGV$P\&KULVDQG.DODORQJZLWKWKHLUIDPLOLHV 7KH0DUTXLVPHPRU\WKDWVWDQGVRXWIRUPHFDPHLQ 2012, when the Marquis boys team lost in the Provincial %DVNHWEDOOÀQDOWR+XGVRQ%D\:HKDGWKHODVWVKRW but it didn’t drop! Another memory, albeit a sad one, was in 2002, when our team statistician for the Marquis girls team, Lindsay Mullett, passed away after a long battle ZLWK &\VWLF )LEURVLV 6KH ZDV RQH RI WKH PRVW SRVLWLYH 3URÀOH SHRSOH,KDYHHYHUNQRZQ 3URÀOH I started getting involved with the basketball programs :LWKRXW D GRXEW WKH EHVW SDUW RI FRDFKLQJ DQG RIÀFL- I started teaching Home Economics at McNaughton in at McNaughton in 2000 when I took on the role of As- ating at McNaughton was getting to know hundreds of WKHIDOORI,DOZD\VORYHGWUDFNDVDKLJKVFKRROVWX- VLVWDQW&RDFKZLWKWKHJLUOVWHDP0\GDXJKWHU$P\ZDV SOD\HUVFRDFKHVDQGSDUHQWVIURPDOORYHUWKHSURYLQFH dent in Radville, so it only seemed right to help out with LQ *UDGH  DQG D PHPEHU RI WKH WHDP , ZDV GULYLQJ WKHWUDFNWHDPDW0F1DXJKWRQ7KHWHDPQHHGHGDFRDFK for the middle and long distance runners and since I was IDPLOLDUZLWKWKHPWKDWLVZKHUH,ÀWEHVW7KDWVRRQ OHG WR DOVR FRDFKLQJ FURVV FRXQWU\ LQ WKH IDOO , UHWLUHG Team Honor Roll from McNaughton in the summer of 2012 and subbed XQWLO,FRQWLQXHWRVWD\DFWLYHZDONLQJELNLQJDQG GRLQJ\RJDDVZHOODVP\PDQ\KREELHV Left: Girls Volleyball ,OLYHRQWKHIDUPZLWKP\KXVEDQG-DFN:HKDYHWKUHH 2006 (hosted Provin- sons—Greg, Stephanie and our grandson Jonathon live in Moosomin, Kent and Whitney live in Saskatoon and cials). Back row: Sa- :DUGLVLQ5HJLQD mantha Vandekerck- I will always remember the unpredictable weather hove, Allison Hebert, FRQGLWLRQV ZH IDFHG RYHU WKH \HDUV 7KH KLJKOLJKW RI Teghan Lowe, Kaela coaching both those sports was the smile (sometimes it ZDVDJULPDFH DVDWKOHWHVFURVVHGWKHÀQLVKOLQHVXFKD Baudu, Amy Easton, ZRQGHUIXOIHHOLQJRIDFFRPSOLVKPHQW Kari Beckett. Front row: Jocelyn Fisk, Brittany Holloway, Below: Cross Country 2006 (Silver medal). Stephanie Pranke, Ai- Back row: Kirsten Roy, Dorie Taylor, Ryan Bart- mee Beckett, Dorie ley, Brandon Shaw, Stephanie Pranke, Allison Taylor, Chloe Cross- Hebert. Middle row: Michael Lecomte, Colby ley, Lauren McCarthy, Davidson, Chad Stewart. Front row: Wyatt Terry Lynd (Coach). Shaw, Chelsea Hebert, Devon Jamieson, Riley Sinclair.

Above: Boys Basketball 2006-07 (Bronze Medal). Back row: Herb Kempin (Coach), Brandon Shaw, Michael Lecomte, Todd Volk (Coach). Third row: Ryan Bartley, Daniel Schorr, Chris MacPherson, Taylor Volk. Second row: Cody Hudym, Matt Lecomte, Ian Glasser. Front row: Col- by Davidson, Lucas Johnson, Ian Adair.

Left: Boys Basketball 2007-08 (Bronze medal). Back row: Herb Kempin (Coach), Kurtis Thompson, Ian Glasser, Matt Lecomte, Chris MacPherson, Cody Hudym, Todd Volk (Coach). Front row: Ryan Bart- ley, Colby Davidson, Lucas Johnson, Michael Lecomte, Taylor Volk. 28 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 FINANCIAL PLANNING

Fixed income is not the fix for anxiety Security and predictability are a great Opportunity cost is the amount of ad- source of emotional comfort when the ditional money you could have made markets seem erratic and volatile. But E\FKRRVLQJRQHÀQDQFLDOGHFLVLRQRYHU how much security and predictability DQRWKHU,QWKHFDVHRIÀ[HGLQFRPHLQ- are too much? And what’s the price for vestments, the lost opportunity is the short-term comfort? money you might have earned had you Many Canadian investors are sharing LQYHVWHG\RXUPRQH\GLIIHUHQWO\)RUH[- the sentiment that the ups and downs ample, compare two investment returns of the markets are stressful. This is mo- over a 5-year period ending September tivating them to think about moving 30, 2019. money to less-risky, and more predict- ,QWKLVH[DPSOHDQLQYHVWRUZKRDF- DEOH À[HGLQFRPH LQYHVWPHQWV 7KH FHSWHGDVOLJKWO\KLJKHUULVNOHYHO 6 3 logic is sound; any port in a storm, as 76; &RPSRVLWH  ZDV UHZDUGHG ZLWK WKH\ VD\ %XW QRW DOO À[HGLQFRPH LQ- DQDGGLWLRQDOFRPSRXQGDQQXDO vestments are equal. And the ones you growth and that added up to a differ- FKRRVH VKRXOG EH D UHÁHFWLRQ RI \RXU HQFHRIMXVWÀYH\HDUVODWHU)RUULVN age, your goals, and your overall toler- DYHUVHLQYHVWRUVÀ[HGLQFRPHGLYHUVLÀ- ance for risk, not a reaction to the mar- cation may be a wise compromise. kets. $EHWWHUDSSURDFKGLYHUVLÀFDWLRQ What’s at stake? One way to address your need for A well-balanced investment portfo- greater security without risking your lio will have a combination of equity PRQH\WRWKHFRVWRILQÁDWLRQDQGORVW DQG À[HGLQFRPH LQYHVWPHQWV EDVHG opportunity is to re-evaluate the com- on your age, tolerance for risk, and the ELQDWLRQRIÀ[HGLQFRPHLQYHVWPHQWVLQ JRDOVLGHQWLÀHGLQ\RXU,*/LYLQJ3ODQ \RXUSRUWIROLR,WFDQEHPRUHHIIHFWLYH *HQHUDOO\ SRUWIROLRV VKLIW WR D JUHDWHU WRLQYHVWLQDPL[RIDFWLYHO\PDQDJHG SHUFHQWDJHRIÀ[HGLQFRPHLQYHVWPHQWV DVVHWVWKDWGHOLYHUULVNDGMXVWHGUHWXUQV WKHROGHU\RXJHWWRUHÁHFWOHVVDSSHWLWH such as bonds, mortgages, and cash. IRU ULVN %XW LI WKH PL[ RI HTXLW\ DQG So, if the ups and downs of the mar- À[HGLQFRPHLQYHVWPHQWVLQ\RXUSRUW- ket have you feeling unsettled, talk to IROLR JHWV UHVHW EHFDXVH RI DQ[LHW\ RU DQ,*&RQVXOWDQWDERXWDOOWKHZD\V\RX uncertainty, your long-term success can FDQDFKLHYHJUHDWHUÀ[HGLQFRPHGLYHU- FRPH XQGHU DWWDFN IURP LQÁDWLRQ DQG VLÀFDWLRQZLWKLQ\RXUFXUUHQWSODQ lost opportunity. Submitted by IG Wealth ,QÁDWLRQ Management in Moosomin. Over 24 years, with even a modest UDWHRILQÁDWLRQ MXVW  the purchasing power of one million dollars drops E\ DOPRVW  $W  LQÁDWLRQ WKDW LQFUHDVHV WRRYHU6RNHHSLQJ SDFHZLWKLQÁDWLRQRXJKW to be your minimum in- vestment goal because Kevin Zazula, B.ĉĒĎēǡ ǡ ǡ  ǡ  your investments could ˜‡•–‡–†˜‹•‘”Ƭ ‹ƒ ‹ƒŽŽƒ‡” actually go down in ( ) value relative to the cost 306 786-3217 good and services. ‡˜‹Ǥœƒœ—Žƒ̷”„ Ǥ ‘ ,PDJLQH KRZ \RX ™™™Ǥœƒœ—ŽƒǤ ‘ might feel if you had one million dollars in 1996 Kelsey Nagy Jan Gustafson and by 2019 it was only ”‘ˆ‡••‹‘ƒŽ‡ƒŽ–Šƒƒ‰‡‡–‹ ‡ͳͻͲͳǤ CFP®, RRC® QAFP® worth $375,413. That’s [email protected] [email protected] what’s at stake when you RBC Dominion Securities Inc.* and Royal Bank of Canada are separate corporate entities which are affili- LJQRUHLQÁDWLRQ ated. *Member Canadian Investor Protection Fund. RBC Dominion Securities Inc. is a member company 306-435-2430 | 626 Carleton St. | Moosomin, SK of RBC Wealth Management, a business segment of Royal Bank of Canada. ®Registered trademarks of 2SSRUWXQLW\FRVW Royal Bank of Canada. Used under licence. © Royal Bank of Canada. All rights reserved. https:// advisor.investorsgroup.com/en/kelsey_nagy

The World-Spectator’s Financial Planning page runs once a month! Advertise your financial services and submit a financial advice article at the same time! Call 306-435-2445 or email [email protected] to find out more!

Reach over 12,000 local readers when you advertise in the World-Spectator! Call 306-435-2445 to find out more! Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 29 Obituaries

life, that Mildred’s family memory are her children happiest gathering her ued to teach us lessons not ing journey. We would announces her passing on Janice (Ed) Kalaman, Nor- family and friends around so much by what she said like to thank the staff at Sunday, August 1, 2021. ma (Ken Walters) Wilson her, making Christmas, but by how she lived her Sunrise Villa for the excep- Her passing has left a gap and Grant (Sherry) Wil- birthdays and anniversa- life. tional care and compas- in our lives that we will son; cherished grandchil- ries so special; in fact, she A Funeral Service and sion you showed to our VWULYHWRÀOOZLWKWKHZRQ- dren Christina (Jeff) Nel- made all events memo- Celebration of Life to re- Mom and to us. derful memories she left son, Todd (Lesley) Wilson, rable. Mom had a very member Mildred and the Donations in Mildred’s us of a life well and fully Erin (Josh) Graff, Sheldon strong bond with her chil- beautiful person she was, memory may be made to lived. (Christine) Wilson, Ryan dren, grandchildren and was held at the Wawota the charity of the donor’s She was predeceased by (Sarah) Kalaman and An- great-grandchildren but Town Hall on Saturday, choice, Sunrise Villa, Box her husband Lorne (2000); drea (Josh) Kosior; pre- her strongest bond was August 7, 2021 at 2 pm.  0DU\ÀHOG 6. 6* parents Fred and Eva Cud- cious great-grandchildren with our dad. Her quiet To view a livestream ver- 3K0 or if you so choose, more; brother Ken Cud- Addisen and Aiden Nel- faith saw her through life’s sion of the service, please SODQW DQ H[WUD ÁRZHU LQ more; sister Iveh Riddell; son, Reagan, Avery and challenges. Mom was a log onto www.livememo- your garden or perform a great-grandchildren Alex- Brielle Wilson, Rachel and very strong and resilient rialservices.com/Home/ random act of kindness in andra Kalaman and Ben- Alyssa Wilson, Arwyn woman who dealt with ServiceDetail/15335. She her memory. jamin Wilson; son-in-law Graff, Kenzie-Lyn, Kait- tragedy and struggles will be laid to rest beside Family and friends are Terry Yaremchuk; as well lyn and Jaxson Kalaman, with courage and determi- her beloved Lorne at the invited to view the online MILDRED RUTH WILSON as Lorne’s family parents and Marek Kosior; special nation. She was the foun- Wawota Cemetery. obituary and tributes page 1929–2021 Harvey and Sarah; sib- cousin Ella (Dwayne) Bris- dation of our family who The family wishes to ex- at www.reginafuneral- lings May (Percy), Albert tow, and special friends provided encouragement tend a heartfelt thank you home.ca. Arrangements It is with sadness for our (Aura), Margaret (Carly) she cherished dearly. and guidance in a loving to the many friends who entrusted to Regina Fu- loss but gratitude for her and Tom. Left to cher- Mom loved people and and thoughtful manner. supported Mom and our neral Home and Cemetery ish and honour Mildred’s people loved her. She was Until the end, she contin- family through her amaz- (306) 789-8850. Welwyn News Wawota News Phyllis Harper Myrna Olson 306-733-2155 306-739-2519 • [email protected] Ellery, Teri, Morgan and Hudson Beck of Drayton Val- ley, Alberta visited for a few days with Grandma Toots Buzz and Sheila Lonethunder have moved to Regina. family members on the passing of Buzz’s sister, Ladonna Stewart. We wish them well in their new home. Wilson at Westbank, British Columbia. Recent visitors with Shirley Cuthill were Ed and Cindy Ruth Dennis, who is a resident at the Maryfield Villa, The Wawota Library has been a busy place this sum- Cuthill of Brandon and granddaughter Chloe Ireland of celebrated her 95th birthday recently. Audrey McVicar mer. They gave away kits to make sun catchers, a cookie Russell, Manitoba. hosted a party for her and she was joined by Jean Bogner, package for Father’s Day, Hummingbird Feeders and Bruce and Betsy Case of Regina were visitors to town Edna Benner, Josephine Easton and daughter, and Gwen reusable Nature Bingo Cards. The children also had an on Monday for John Bodenstaff’s funeral. Donais of Estevan. After the party, Ruth and Gwen vis- opportunity to write to a pen pal from another library Cindy Cuthill of Brandon and Megan Le Boutillier and ited Liz Luscombe at Deer View Lodge. Ruth also had a and patriciate in a Summer Reading Club. For the teens daughter of Carberry, Manitoba visited recently with birthday celebration at the Villa. and adults there is a Lawn Chair Travel Challenge where Shirley Cuthill. Harvey Hurren of Brandon has retired from the min- there are two reading options, read across Canada or Marg Dumville and Connie Sothman of Elrose, Sas- istry of the United Church as of June 30. He and his wife around the World! katchewan and Rick Dumville of Saskatoon were in town Ethel were residents of Wawota from 2003-2005 when Congratulations to Shana Puskas on the grand opening on the weekend and placed a stone at the cemetery for Harvey was the minister here. of her Cafe, Puskas Palace last Sunday. Lynn. They and Trent joined us at the United Church Happy birthday to Beryl Richards whose 85th birthday Carey Lamoureaux and I travelled to Echo Lake on Sat- for service and lunch on Sunday—lots of laughs and old was on July 24! urday, July 31 to attend the lake-front wedding of Brit- memory chatter. A memorial graveside service was held at Kelso on Sat- tany Olson and Riley Schnell. She is the first of our grand- Pam Likuski of Drayton Valley, Alberta visited this urday, July 31 for the late Karl Johnson. Karl passed away children to be married. week with her mom Toots Stewart and other relatives and on April 4, 2020 at the age of 78 years. If you are having company or are taking a trip this sum- friends in the area. Sympathy to buzz and Sheila Lonethunder and other mer, please share it with me and my readers. Correction to last week’s news: Orville and Phyllis Harper, not Bruce and Phyllis Harper. Tundra Chad Carpenter 30 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 &ODVVLÀHGV YOUR COMMUNITY. YOUR NEWSPAPER. ONLINE @ WWW.WORLD-SPECTATOR.COM &ODVVLÀHG'HDGOLQH &ODVVLÀHG5DWHV 3D\PHQW0HWKRGV &RQWDFW $OOFODVVLÀHGVUHTXLUHHSUHSD\PHQW E-mail: [email protected] THURSDAYS 1 week: $11 + GST 3 weeks: $24 + GST Phone: 306-435-2445 (44¢/word) (32¢/word - $8/week) VISA, MasterCard, Fax: 306-435-3969 @ NOON 2 weeks: $18 + GST 4 weeks: $28 + GST Cheque, Cash (36¢/word - $9/week) (28¢/word - $7/week) Mail: Box 250, Moosomin, SK S0G 3N0

UPCOMING CARD OF EVENT THANKS Employment Employment CIRCLE OF CARING The family of the late Jean Opportunity AND SUPPORT Backlin would like to thank the Opportunity A support group for women staff at Moosomin Hospital, with any cancer diagnosis, will Dr. Van and Hutch Ambulance MOTEL 6 IN MOOSOMIN IS meet Wednesday, August 11 Service. Thank you to the Red WE ARE HIRING! at 7:00 pm on the patio of the Barn for lunch and all who made Sports Plex at Bradley Park. If inquiries, sent cards, fl owers, NOW HIRING! you have any questions email: meat trays and baking. Thank Full-Time Positions [email protected]. you to all who made Donations to the Royal Canadian Legion available for immediate hire Part-Time MARYFIELD #081, and to the Moosomin AUDITORIUM MOVIES & District Health Care Foun- Housekeeping Staff Friday, August 13 at 8:00 dation, Southeast Integrated Housekeeping p.m. Sunday, August 15 at Care Centre in Mom’s memory. Shifts include 9 a.m. - 5 p.m. or 5 p.m. - 9 p.m. 3:00 p.m. Space Jam: A New Thanks also to Jim at Carscad- Laundry Attendant Legacy. Adults $6, Students den’s for all the arrangements &RPSHWLWLYHZDJHVDQGFRPSDQ\SDLGEHQHÀWV Contact Kim Hogg (On-site General Manager) $5, Children $3. and to Sheilagh Garrett for 43:tfc offi ciating the Service. Spe- at 306-435-3666, or send expressions of interest to: cial thanks to the Moosomin Please contact the hotel directly 306.435.4700 or [email protected] MOOSOMIN CHAMBER email your resume to Cheryl at [email protected] OF COMMERCE Fire Dept. and Hutch Ambu- The next Moosomin and Dis- lance, along with Dave Reed of Regina EMS for the wonderful trict Chamber of Commerce 405 Moose Street | Moosomin, SK 45:2c meeting will be held September Honour Guard Service. Your Town of Wapella 14 at 11:45 at the Canalta. thoughtfulness will never be Lunch will be served. Speakers forgotten! CLASSIFIED DEADLINE THURSDAY @ NOON EMPLOYMENT Devona Putland-Age Friendly —Dave (Linda), Rick Community and a representa- (Louise), Darlene, Linda (Ab), CALL 306-435-2445 tive from the Local Immigration Garry (Cindy), Dale (Christina) OPPORTUNITY Partnership. 43:tfc and families. 45:1p Administrator Position The Town of Wapella invites applications from qualifi ed HOUSE 45:1c FOR RENT persons to assume the position of Administrator. The Administrator will work with Council providing sound advice and ensuring municipal policies, bylaws and Boardwalk Apt. Taking appli- priorities are implemented and that provincial and cations. Newly renovated Career Opportunity unfurnished one and two bedroom federal legislation is followed. The Administrator will suites, in Moosomin. Text or call assume all duties required under the Municipality Act. 306-434-5402 after 6 p.m. 6:tfc Federated Co-operatives Limited (FCL) is hiring a PROPANE DISTRIBUTION COORDINATOR The offi ce is located in the Town of Wapella, Sask., 28 on a permanent basis at our of¿ ce in Yorkton, Saskatchewan. kilometres west of the Town of Moosomin and near SERVICES Who we are: both the Esterhazy (Mosaic) and Rocanville (Nutrien) As a co-operative, we do business differently. We believe in working together to serve Potash Mines. Our offi ce is currently open Monday Western Canadians, delivering pro¿ ts back to our communities and investing in sustainable through Thursday. Glasser’s TV Service. growth. Our work is guided by our values of integrity, excellence and responsibility and driven Repairs for electronics, com- by our vision of building sustainable communities together. To learn more about who we are, puters, etc. Experienced Applicant(s) should possess the visit www.fcl.crs. technicians. Fully equipped following qualifi cations: service shop. Phone 306-435- What you’ll do: • A minimum Standard Certifi cate in Local Govern- 3040, fax 306-435-2662. You will coordinate the delivery of orders to the existing propane customer base while ment Administration, however other combinations 49:tfc ensuring compliance with National Safety Code standards, FCL policy and procedures and other transportation regulations. You will also be responsible for the tracking of operational of education or qualifi cations may be considered J.B. Tree Trimming. Tree trim- provided the applicant is willing to enroll and ming and removal and sewer results to ensure monthly and annual budget targets are achieved for current customer base services. Jim Barry c-306-434- sales, margins and expenses. Positive leadership, guidance and supervision to all driver complete the LGA program through the University 7371 or h-306-435-2982. sales personnel is also essential to ensure that all deliveries are made ef¿ ciently and safely. of Regina and achieve certifi cation; 56:tfc • Propane Distribution and Customer Service; You will track and assist in the coor- • Strong communication, management, personal and dination of the distribution and supply of bulk propane to existing customers ensuring HOME RENOVATIONS that it is done in an ef¿ cient, and cost-effective manner while providing a consistently organizational skills; Additions & garages, windows, • Experience using Microsoft Offi ce (Word, Excel, doors, siding, bathrooms, high level of customer service to Local Co-ops and FCL Direct accounts. kitchens, tile, fences, decks, • Operationalization of Safety and Compliance Programs: You will ensure all driver Publisher) & online applications fl ooring and more! Call Terry at personnel have received adequate training to perform their duties conforming to the • Previous experience in fi nancial management and 306-435-6684. 7:tfc Department’s Safety Program and all industry safety procedures, policies and regula- tions are followed and fully documented. the use of Munisoft Software would be an asset. • Supervision: Supervise guide and direct all driver personnel on a day-to-day basis. A competitive salary complete with a benefi ts package WANTED Support Talent Management process for direct reports including Talent Acquisition and Performance Management. will be determined based on qualifi cations, education and experience. Why it matters: Military uniforms, badges, We fuel Western Canadian communities by offering innovative energy products and providing Interested candidates are invited to submit their unmatched service to Co-op member-owners and customers. medals, equipment, lead sol- resume including 3 references and a cover letter with diers also LP records, 78 RPM records, older cameras and pho- Who you are: their salary expectation by 4:30 p.m. Monday August tographic equipment. Call Ed You are looking for a career in Administration and: 16th, 2021 to [email protected]. James after 6 p.m. at 204-845- • You have a High School Diploma. 2630. 27:tfc • You have a minimum of 5+ years of relevant experience. Experience in the Ag and/or All applicants are thanked for their interest, but only Petroleum Industries is an asset (a combination of relevant education and those selected for an interview will be contacted. experience may be considered). CLASSIFIEDS • Minimum 3A license required. Class 1A license is considered an asset. For further information please contact: WORK! • PTI Trainer Certi¿ cation is considered an asset. Town of Wapella If this opportunity speaks to you, PO Box 189, Wapella, SK S0G 4Z0 CALL E-mail: [email protected] 306-435-2445 we invite you to apply by August 20, 2021 at www.fcl.crs. Phone: 306-532-4343 DEADLINE: 44:2c THURSDAYS AT NOON ,17(*5,7<‡(;&(//(1&(‡5(63216,%,/,7< – CONDITIONS OF ADVERTISING ACCEPTANCE All advertising is subject to the publisher’s approval. It is agreed by The World-Spec- whether such error, or non-insertion is due to the negligence of its servants or oth- tator and any advertiser using or requesting the space that the publisher shall not be erwise. Advertiser must assume responsibility for errors in any advertisement which liable for damages in the event of non-insertion of, or errors in, advertisements in is supplied to The World-Spectator in hand-written form, or given over the telephone. excess of, or beyond the amount paid for space actually occupied by the non-insertion The World-Spectator is responsible, subject to conditions as noted above, for ONLY or by that portion of the advertisement in which the error or non-insertion occurred, the fi rst incorrect insertion. Classifi eds require prepayment before being inserted. Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 31 32 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

29:tfc Trent MacMillan (306) 434-9399 Jarvis Olsen (306) 645-4299 Water/Sewer, Sand/Dirt/Gravel Products, Demolition & Concrete Work, Land Clearing, Prep. and Landscaping

ˆϐ‹ ‡ǣ(306)645-4299 RHINORhinodirtworks.com DIRTWORKS LTD

Moosomin, Rocanville and Area WE ACCEPT MASTERCARD AND VISA Business Directory

MASSAGE THERAPY CHIROPRACTOR ACCOUNTING

CHIROPRACTOR Dr. Brian Grassick 906 Main Street Moosomin, SK Virden, MB. MASSON & ASSOCIATES (306) 435-4250 1.800.236.7656 CHARTERED PROFESSIONAL ACCOUNTANT (306) 435-7568 (cell) Direct: 204.748.1200 Accounting BDO Canada LLP Business Advisory $OVR2IÀFHV,Q Tax REDVERS 613 Main Street, Moosomin. CARLYLE Ph. 306-435-3886 WINDTHORST MASSONCPA.CA

11:52c REAL ESTATE HEARING SERVICES

ARTIN IBERTY ASK EALTY ARTIN IBERTY EALTY Jacquie Mvula Melanie Tribiger M L (S ) R M L R M.S. R.Aud Office Manager MOOSOMIN, SK BRANDON, MB Clinical Audiologist & Hearing Aid Kim Setrum and Owner Practitioner Student OPTOMETRIST NOW IN REAL ESTATE AGENT Rolna Pranke MOOSOMIN DR. NATHAN (306) 435-7343 Hearing Aids, Repairs, Batteries, KNEZACEK, OD Serving Moosomin & Area! Custom Hearing Protection, Wax Removal, Hearing Tests in a Sound Booth SERVING SOUTHEASTERN SK AND SOUTHWESTERN MANITOBA Moosomin Provincial Court Building – 709 Carleton Street, Moosomin, SK EYESAGE.NET Cell: 306-434-8733 [email protected] By Appointment Only: 306-435-EARS (3277) Box 1270 | 519 Main Street Esterhazy, SK LEGAL SERVICES 306-745-2524 Fax: 306-745-3437 WE PRINT VINYL [email protected] BOCK & COMPANY MITTEN LAW OFFICE BUSINESS CARDS! CONSTRUCTION LAW OFFICE Rae Mitten They won’t tear, crumple and they're waterproof! Lynnette Bock, Barrister, Solicitor & Notary and Marriage Commissioner B.A., J.D. 250 Color 500 Color BY APPOINTMENT: ESTERHAZY OFFICE (306) 840-7465 Business Cards Business Cards 500 Maple St. (306) 452-3356 306-745-3952 $ 00 $ 00 [email protected] ROCANVILLE OFFICE 68 130 Box 695 • 19 Rhodes Street 124 Ellice St. Redvers, SK S0C 2H0 (Andrew Agencies) Friday Afternoons KENOSEE LAKE, SK. 306-645-4552 Residential & Commercial Construction ROOFING/CLADDING Phone: 306-961-4118 Able Eavestroughing Ltd. Towler Metal Roofing 306.532.4496 - Wapella Construction 204.725.2294 - Brandon JOURNEYMAN CARPENTER Bonkowski Enterprises Three sizes of heavy gauge 0ITMRI´W6SS½RK steel continuous trough: Home Renovations 6SHFLDOL]LQJLQ&RQWLQXRXV0HWDO5RRÀQJ Siding Systems & Cladding • Custom Flashings • 5” Residential Specializing in Fiberglass Shingling Interior & Exterior • 6” Commercial No Exposed Fasteners • Quality Workmanship New Construction • 7” Commercial Residential & Commercial Cedar Shakes Call for a Quote Today! Call today for a free estimate! 306.435.7595 Call Ron at (306) 435-9714 306-435-8008 We have fi ve machines – two more 306.435.2710 this year – to provide faster service. Moosomin, SK

GET YOUR AD IN THE BUSINESS DIRECTORY CALL 306-435-2445 Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 33

MEMORIAM

CHURCH LEE: In memory of Margaret Lee, who passed away August 11, 2016. Time slips by and life goes DIRECTORY on But in our hearts you’re never gone We think about you always We talk about you too We have so many memories ASK ATEWAY NGLICAN ARISH But we wish we still had you. S G A P —Lovingly Remembered by Phone 306-435-3002 Rod, Scott and Carla, Heather TRINITY and Kevin and family. 45:1p St. Alban’s, Moosomin • St. Thomas, Rocanville EMPLOYMENT LUTHERAN OPPORTUNITY Sunday, August 15, 2021 CHURCH Fort La Bosse is accepting Moosomin applications for a full time Sunday Services will be suspended 501 Mark Ave. Head Custodian at the Virden Collegiate Institute beginning until further notice Phone August 2021. This position is 306-435-9035 responsible for the cleaning, Rocanville care and minor maintenance of the building and for the orga- Morning Prayer Service at 11 a.m. Saturday, nization and supervision of subordinate cleaning staff. For Bible Study and Sunday School on break until September August 14, more information visit our web- site fl bsd.mb.ca 45:1c Follow Anglican Church, Moosomin on Facebook 2021 for our daily prayer at 7:00 p.m. Color Photocopies EVERYONE of your favorite photos WELCOME! 8.5 x 11: $ 49 CATHOLIC COMMUNITIES OF 2 ST MARY’S, MOOSOMIN MOOSOMIN, SK | 306-435-3393 & ST ANDREW’S, WAPELLA Father Franklin Emereuwa Watch 306-435-2993 www.facebook.com/StMarysCatholicChurchMoosomin for 6XEVFULSWLRQ5DWHV Sunday, August 15, 2021 updates The Assumption of the on One-Year Two-Year Three-Year Blessed Virgin Mary Subscription Subscription Subscription $ St. Mary’s Moosomin 11:00 a.m. Church 45 $80 $105 St. Andrews Wapella 1:00 p.m. Services MAILED VIA CANADA POST • CALL 306-435-2445

BETHEL UNITED CHURCH St. Andrew’s Seeking God’s Way as Community Presbyterian No Worship Services for Church the Summer Months 716 Main St. Website: http://bethel-united.ca/ Moosomin, SK Facebook: Bethel United Church Offi ce: 306-435-2155 Please watch for details in September 2021 Church: 306-435-2731 Sunday Email: [email protected] Worship :HDUHKLULQJ MOOSOMIN 1117 Main Street BAPTIST CHURCH Services Ph: 306-435-2455 1HZSURGXFWLRQRSSRUWXQLWLHV www.moosominbaptist.com at the In 6KLIWSUHPLXPV Person Church &RPSDQ\PDWFKHGSHQVLRQFRQWULEXWLRQV
Service Sunday *URXSEHQHoWV 10:30 a.m. Morning Building and nurturing Christian relationships Check website for details 10:00 a.m. follow us online: www.moosominbaptist.com, 6FDQWKHTUFRGHRUYLVLW or Facebook page: Moosomin Baptist Church or email us at [email protected] ZZZELWO\9,,FDUHHUV OHDUQPRUHDQGDSSO\ Online Streaming Pastor: MOOSOMIN Allan Lautamus Services on IVER OF 1501 Broadway Ave. YouTube will also be R (306) 435-2798 provided at the same LIFE CHURCH (Church) Leave message times. Sunday Children’s Sunday School 10:00 a.m. Pre-Service Prayer 10:00 a.m. Sunday Service 11:00 a.m. Everyone Welcome! 42:4c 34 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021 Westman RCMP Report

BY CPL. KEVIN BRUCE Sioux Valley for a report of a break and hospital for further assistance. Report of children During the week of July 26 to August 1, enter in progress. Upon police atten- roaming the street the Westman RCMP dealt with 54 police dance, it was determined that a break and Mental health transport activities. enter did not occur. Drugs are believed to in Virden be a factor. at Virden hospital August 1 – RCMP were dispatched to Stolen pontoon boat July 28 – RCMP were dispatched to Virden for a report that children were Report of domestic the Virden hospital to complete a mental roaming the street and were “up to no reported in the RM health transport. RCMP transported an assault in Sioux Valley good.” Patrols were made, no one was lo- of Ellice-Archie adult female to Brandon, and waited with cated. There were no reports of any item July 27 – RCMP were dispatched to the patient until admitted. or building damage in the area. July 26 – RCMP were dispatched to the Sioux Valley for a report of a domestic RM of Ellice-Archie for a report of a sto- assault. Upon police arrival, the accused Medical distress len pontoon boat. The boat was located/ had departed the residence. Subsequent Loud music and recovered by police on a rural property to investigation, it was determined that call from Melita yelling reported at in the RM of Wallace-Woodworth. The the accused had committed an assault. A July 28 – RCMP were dispatched to Reston Campground boat was returned to the rightful owner. warrant of arrest is being sought for the Melita for a 911 hang up. Upon police A 34-year-old female and a 38-year-old accused. attending, it was determined that an in- August 1 – RCMP were dispatched to male were arrested for possessing prop- dividual was in medical distress. The in- the Reston Campground for a report of erty obtained by crime. They were re- Meth found at traffic dividual was transported by EMS to the loud music and yelling. Police located the leased on a future court date. hospital for further assistance. source of the loud noise, and asked that stop in RM of Sifton noise be kept to a minimum. Stolen catalytic July 27 – A traffic stop was initiated in Report of people in a converter in RM the RM of Sifton. A 32-year-old male was condemned residence Report of attempted located with approximately five ounces break and enter in of Wallace-Woodworth of meth. The male is facing three drug re- July 28 – RCMP were dispatched to July 26 – RCMP were dispatched to lated charges. Sioux Valley for a third party report that Sioux Valley the RM of Wallace-Woodworth for a re- people were in a condemned residence. August 1 – RCMP were dispatched to port of a stolen catalytic converter from a Report of mental Upon police attending, no one was pres- Sioux Valley for a report of an attempted truck. The investigation is ongoing. ent. break and enter. It was then reported that health crisis in Virden an individual was outside trying to run Report of a break and July 27 – RCMP were dispatched to Report of suspicious people over with an ATV. The investiga- Virden for a report of an individual going tion is ongoing. enter in Sioux Valley through a mental health crisis. An adult person in RM of July 27 – RCMP were dispatched to male was arrested, and transported to the Wallace-Woodworth Person approached by July 30 – RCMP were dispatched to the RM of Wallace-Woodworth for a report man with machete of a suspicious person with their camper. August 1 – RCMP were dispatched to Police attended, spoke to the individual Sioux Valley for a report that someone and determined there was no suspicious tried to get a dog to get off the roadway, Gov’t needs tools and then was approached by a male with activity occurring. a machete. The caller was not injured, the investigation is ongoing. Report of suspicious to fight Covid-19 person walking on the Traffic enforcement Saskatchewan still needs highway in RM of Sifton actions and proper tools to avoid the July 31 – RCMP were dispatched to spread of the new Cov- Highway 1 in the RM of Sifton for a re- wellbeing checks id-19 variants among those Murray Mandryk port of a suspicious person walking on Five traffic enforcement actions and who do contract the virus. the highway. The person was located, three wellbeing checks were undertaken This makes recent sug- and given a ride to the next gas station. during this reporting period. gestions from the Sas- katchewan Party that it might be less forceful in its self-isolation laws rather ernment, who have clearly not get behind the wheel. puzzling. tried to be compromising So why remove this tool At the time of the July and reasonable. at this point? Why remove re-opening, it appeared Covid-19 may linger isolation standards when, the provincial govern- around for months or since the July 11 re-open- ment had removed the maybe for years. At some ing we still have problems Looking Back self-isolation orders. Since point, we would have had with outbreaks because of then, the kindest thing one to loosened restrictions unvaccinated people? can say is that the govern- like social-distancing, Shouldn’t the govern- ment has been muddled in masking requirements and ment have at its disposal Ten years ago, 2011: A skate jam was the Communiplex and the tractor pull. both its messaging and its mass gatherings that were whatever tools it needs to held in Wawota to mark the completion of They also made $27,000 from the event. approach to self-isolation removed July 11. stop the spread? Wawota’s skate park on the south end of There was over $7,500 worth of prizes laws. Some people argue this Right now, less than one- town. B3 Extreme skate club out of York- given away and more than 2,034 people “How long does govern- was far too soon, although third of people in the north ton was invited to the event, which kicked joined. Children were able to attend the ment have to keep enforc- it should be noted these have been fully vaccinated off with a barbecue lunch. The skate club event free of charge and so they weren’t ing this when the indi- are often the same people against Covid-19—a rate did a number of demonstrations for spec- included in the number of people who vidual has responsibility who also argue we needed that is half that of the rest tators and then invited local skaters to try went to the event. to make that decision and stricter restrictions. of the province. some of their own tricks. The town of Wa- Fifty years ago, 1971: Tommy Fry, a make an informed deci- The number of active Fortunately, southern ZRWDDVVHPEOHGWKHÀEHUJODVVVNDWHSDUN 90-year-old Spring Creek farmer pioneer sion on what they need to cases has nearly doubled cities and most rural areas after moving it from Moosomin. was featured on the front cover of the do,” Health Minister Paul since the July 11 re-open- have seen few Covid-19 Fifteen years ago, 2006: The Ride for paper. He had completed his stone fence Merriman recently asked ing, although it should be cases since re-opening. Hope camp was a busy place full of fun. project at the Spring Creek St. Peter’s An- during an interview on noted we have had only However, Covid-19 cases There was old-time music at the campsite glican Church. An interesting fact was that CBC radio. ÀYH PRUH GHDWKV VLQFH in Northern Canada are ZLWK DWWHQGHHV SOD\LQJ ÀGGOHV DFFRUGL- KHZDVWKHÀUVWSHUVRQWREHFRQÀUPHGDW Later, the government re-opening. That’s less now occurring at a rate RQV DQG SLDQR $W WKH FDPSÀUH IDPLO\ St. Peter’s church. sent out an e-mail saying deaths than in a similar pe- 33 times higher than the and friends gathered together after sup- the law is still in effect— riod prior to the July 11 re- Canadian rate—391 active per. People also brought their horses to unlike in Alberta where opening, which speaks to cases per 100,000 (dur- the event. A fundraising auction was held the law will be removed the success of getting older ing a seven day period) on Saturday evening and drew a large this month. That province people vaccinate. in northern Saskatchewan crowd. will rely on some sort of But while restrictions for compared with 12 cases Twenty years ago, 2001: Many Alber- honour system. those who may not have per 100,000 in Canada. In tans were making the move to Saskatch- But there still seem to be Covid-19 are one thing, Saskatchewan the overall ewan as pastures were drying up and questions here in Saskatch- ensuring that those who rate is now 28 cases per ranchers were facing high costs for feed, ewan how and who will do have Covid-19 aren’t 100,000 in Saskatchewan. hay and land. Pastures in Saskatchewan enforce stay-at-home or- spreading it to others is With major outbreaks on were in good shape and hay and feed ders—largely because the completely another thing. the Hatchet Lake Denesu- were abundant. language has changed to Again, this is why we line First Nation, Buffalo Thirty years ago, 1991: Saskatchewan sound slightly less forceful. have blood alcohol content River Dene Nation and Premier Grant Devine visited Rocanville How long do we have to restrictions or seat-belt Black Lake Denesuline and Moosomin on July 18, 1991. While make it known we are still laws. Of course, they don’t First Nation, lockdowns in Moosomin he dedicated the rural ser- enforcing the law? One stop everyone who choos- have been needed. vice centre with a plaque. He said in an could ask how long we es to drink and drive. But These lockdowns were interview he wanted to see government must have laws enforcing the very existence of a law actually requested by re- services and programs be expanded at the .08 blood alcohol content helps make it socially un- sponsible community province’s rural service centres. for impaired drivers when acceptable. leaders. Forty years ago, 1981: A tractor pull we all should know we The very threat of large So given this reality, competition was held and it was said to This was the front page of The shouldn’t drink and drive. ÀQHV RU MDLO PDNHV LW HDV- don’t we still have to have be the “best one ever!” It was the seventh One gets the frustration ier for people to tell their effective self-isolation annual Moosomin tractor pull. The activi- World-Spectator five years ago on of Merriman and his gov- friends to stay home and laws? ties that were put on were two dances at August 8, 2016. Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 35

Alvin Nixon captured these photos, and the ones below, of a juvenile red-tailed hawk near his farm at Wapella. He was able to confirm that the hawk was the very same one banded as part of a project in Kansas. At the bottom of the page are photos taking by Luke Decicco with the Uni- versity of Kansas, showing the hawk when it was being banded.

Red-Tailed Hawk near Wapella migrated from Kansas BY ALVIN NIXON I am a member of a Facebook group Red-Tailed Hawks of this hawk. Lynn and I regularly go for an evening drive from our of Western Canada so I decided to post the pictures there The opportunity came one afternoon last week when farm near Wapella, looking for wildlife, armed with a for the members to check out. The group has red-tailed Lynn drove into the yard, telling me to grab my camera camera and a pair of binoculars. About two weeks ago, hawk enthusiasts from all over North America. One of the as she had spotted the hawk not far from our farm. We set we started to notice a unique looking red-tailed hawk in members, Mike Borlé, a group administrator, who is an out with the camera and lucky enough, the hawk was in the area, sometimes sitting on a fence post or in a ditch avid birder and red-tailed hawk specialist from Alberta, the same area where Lynn had spotted it a few minutes hunting for gophers and mice. It was strikingly unique noticed the pictures and thought my bird may have been before. We kept our distance so as not to frighten the bird because of its nearly white breast and light colored banded by a project in the United States called The Red- away and I snapped a few photos. I was very excited to head—a real standout. Unfortunately, up until this point, Tailed Hawk Project. So he sent me a link to the group note right away that the blue band on our hawk matched I was not lucky enough to actually photograph the hawk. that included a number of pictures of a hawk that looked the one on the hawk that was banded in Eastern Kansas Last week, we were out for a drive and I spotted the remarkably similar to my hawk, also with a blue band on on November 10, 2020. hawk sitting on a fence post near the road. By the time I the left leg and a gray band on the right leg, just like the , QRZ KDG FRQÀUPDWLRQ WKDW %OXH : ZDV WKH VDPH slammed on the brakes (there were no other vehicles on one I had photographed. bird captured by Luke Decicco near Lawrence, Kansas the road), opened the window, reached for my camera, Photos of that hawk below (bottom of page) are cour- on November 10, 2020. This bird is a Red-Tailed Hawk, with Lynn in the passenger seat reaching to get hold of tesy of Luke Decicco, a PH.D. candidate at the Univer- VXEVSHFLHV.ULGHU·VDQGZDVWKHYHU\ÀUVWFRORUEDQGHG the steering wheel that I was no longer holding, the hawk sity of Kansas. Luke captured and banded this hawk near bird of The Red-Tailed Hawk Project in the States (www. was adjacent to me. Lawrence, Kansas on November 10, 2020. The last photo redtailedhawkproject.org). ,PDQDJHGWRJHWDFRXSOHRIGHFHQWÁLJKWVKRWVRIWKH shows the band 1W that was placed on the hawk in Kan- I spoke with Bryce W. Robinson, a PH.D. student with frightened hawk who had left the fence post immediately sas. Cornell University and Cornell Lab of Ornithology, and with all the commotion and noise. The lettering on the blue band in my photo was not a lead member of the Red-Tailed Hawk Project. He was Later, back at home, when I had a look at the photos, I legible so, even though the two birds were very similar, TXLWHKDSS\WRKHDURIP\ÀQGDQGKDVDVNHGWRXVHP\ noticed something unusual about the bird. First I noted FRQÀUPDWLRQZDVVWLOOXSLQWKHDLUZKHWKHURUQRWWKH\ photos in the story of the migration of this hawk. It was that the bird was a juvenile because of the light-colored were the same bird. Encouraged by other group members exciting and gratifying to be able to help track this bird eyes. Secondly, it was obvious that it had been banded at DQG0LNH%RUOHZKRZDVFRQÀGHQWWKH\ZHUHWKHVDPH all the way from Kansas to our corner of the world in Sas- some point with a band on each leg. bird, Lynn and I were on the lookout for another sighting katchewan. 36 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021

IN GIFT CERTIFICATES PLUS A BRADLEY SMOKER ($400 VALUE)

210 Frontage Road Shop at these participating Virden, MB businesses and enter to win a (204) 748-2060 $100 gift certifi cate to each business! NOW THE DISTRIBUTER FOR WWW.VIRDENREC.COM Draw Date: September 10, 2021 TOLL FREE 1-888-877-7623

CELEBRATION YOUR ONE STOP SHOP –FORD SALES– TO YOUR FIELD, HOME AND YARD FOR EVERYTHING ;)ƅ6),)6)83 FIREARMS, ARCHERY 7)6:)=39 & OUTDOORS Service • Parts • Autobody • Detailing AGRICULTURAL PARTS, SUPPLIES & EQUIPMENT 1-800-880-4533 • (306) 435-3313 VIRDEN, MB VIRDEN, MB P (204) 748-2454 #1 Highway East • Moosomin, SK P (204) 748-4469 E [email protected] E [email protected] WOLVERINESUPPLIES.COm celebrationford.com VIRDENAG.CA

ERIN’S I.D.A. Your PHARMACY Community Builder ESTERHAZY’S ONLY LOCALLY OWNED & OPERATED PHARMACY! VALLEYVIEW Enter at all ³ Free Compliance Packaging ³ Medication Reviews ³ Minor Ailment Prescribing ³ Injection Services FOOD STORE AGRO CENTRE GAS BAR Borderland ³ Sigvaris Stockings ³ Free Delivery ³ Fast & Professional service! 204-748-2520 204-748-2843 204-748-1317 Co-op 250 PRINCESS ST. W. 430 FRONTAGE RD. 114 7TH AVE. S. 422 Main Street • Esterhazy, SK • 306-745-2525 Serving Virden, Kenton, Pierson, Oak Lake, Oak River, Melita and Reston Borderland locations

BUSINESS HOURS: – the – Monday - Saturday: 9 a.m. - 5 p.m. • Sunday: Closed Liquor www.kullbergs.ca UPTOWN Store Liquor • Beer • Wine 204-748-3331 HOURS: 10 AM-8 PM MONDAY-SATURDAY TOLL FREE: 1-888-871-6265 NOON-7PM SUNDAY VISIT US ONLINE: www.virdenford.ca Main St. & South Front St. - Moosomin, SK Facebook: Virdenford • Twitter: virden_ford Instagram: virdenfordsales 346 KING STREET • VIRDEN, MB 306-435-4001 173 KING STREET EAST, VIRDEN, MANITOBA, R0M 2C0

.0-;()3,:‹*63+),,9‹>05,‹:7090;:;6.6 Liquor Franchise & Reverse Osmosis Bottled Water Monday: Closed Tuesday - Friday: 11 a.m. - 5:30 p.m. Saturday: 10 a.m. - 5:30 p.m. +28560RQGD\)ULGD\DPSP Home Delivery & 6DWXUGD\DPSP‡6XQGD\&/26(' In Store Pick-up www.EsterhazyFreshmart.ca ,SSPJL:[YLL[9VJHU]PSSL:2 ‡ZZZÁDPDQFRP 306-745-3500   0RRVRPLQ6. 515 Main Street • Esterhazy, SK Monday, August 9, 2021 World-Spectator - Moosomin, Sask. 37

IN GIFT CERTIFICATES PLUS A BRADLEY SMOKER ($400 VALUE)

Shop at these participating businesses and enter to win a $100 gift certifi cate to each business! Draw Date: September 10, 2021 “We Want To Satisfy You” Flower Attic & Gifts VIRDEN, MB est. 1946 Call 204.748.1869 1102 PARK AVE. | MOOSOMIN, SK Open Mon. to Fri. 9 am - 6 pm 306-435-3367 Enter as strangers.... BRADLEYGM.COM leave as friends BALFOUR DRUGS KARI’S KLOSET FASHIONS FOR ALL WOMEN

DEX • FDJ • TRIBAL • GUESS • CHARLIE B SOFTINO • ASPORTUGUESAS • BOS&CO • NAOT • BUENO Kassies’s Jewelry 306-435-2738 & Giftware 705 Main Street • Moosomin, SK • [email protected] KIPLING, SK • 306-736-2242 (PHARMACY) WWW.KARISKLOSETONLINE.COM 630 Main St. • 306.435.2977 306-736-2992 (TIM HORTONS) Your fl ower store and Essentials Flower much more! Wellness Spa 457 Main Street • Esterhazy, SK [email protected] 306-745-2965 Massage Therapy, Esthetics, Sugaring Hair Removal Open Monday - Friday: Brand Name clothing Eco-Friendly Canadian-MadeNatural Health & Beauty Products 10:00 a.m. - 5:00 p.m. and footwear for 465 MAIN | ESTERHAZY, SK Saturday: men, women 709 Main St. — Moosomin, SK 11:00 a.m. - 4:00 p.m. & children 306-740-7732 www.schedulicity.com/scheduling/PHEMRT 306-435-2725 SAPARA’S Moosomin SK , 306-435-3836 DRUG MART Authorized YETI Dealer • Free People Orb Clothing • Toms • Tentree • LOLE • Wide selection of sunscreen, bug El Naturalista • Fig • The Giving Keys sprays, after-sun & Sun Bum • Undercarriage • Miz Mooz Spiritual Gangster • Mantra Bands after-bite products Pottery & Much More! • Garden & Yard Decor Fully Appointed Travel Agency • Outdoor Summer Toys & Games Main Street www.facebook.com/mcphailtravel/ @mcphail.travel.boutique 306-745-6662 – Esterhazy, SK Moosomin, SK Open Monday to Friday 9 a.m. to 5 p.m. Monday- Saturday: 9 a.m. - 5:30 p.m. Saturday 10 a.m. to 2 p.m. Thursdays: 9 a.m. - 7 p.m. 306-435-3040

Great Selection of Car, SEW CREATIVE Light Truck, Ag & & INTERIORS Semi Tires Moosomin, SK 306-435-2518 24 Hour SALES/SERVICE Service! See us for all of your sewing 1.877.868.9871 and decorating needs, custom draperies Let Our Family Help Your Family! [email protected] 1004 North Front Street, Moosomin, SK and a complete line of HWY 22 & 80 306-435-2949 Hunter Douglas Window Fashions! ESTERHAZY, SK Monday, August 9, 2021 World-Spectator - Moosomin, Sask. 38

IN GIFT CERTIFICATES PLUS A BRADLEY SMOKER ($400 VALUE)

Shop at these participating businesses and enter to win a $100 gift certifi cate to each business! Draw Date: September 10, 2021

Mane.tain Your Locally Owned Hometown Pharmacy 2 miles north on Hwy #8 630 MAIN ST. MOOSOMIN, SK hair lounge & gift shoppe Moosomin, SK 100% LOCALLY OWNED 306-645-2721 306-435-5800 (306) 435-3345 105 ELLICE STREET www.rpmserviceltd.com pharmasave.com/Moosomin Mane’tain your look, home & wardrobe

MULLETT’S Here’s Serving Moosomin & Area How. since 1987 Your one-stop summer shop for hardware, household and outdoor supplies! Monday - Friday 8:30 am - 6 pm Saturday - 9 am - 5:30 pm Monday to Friday: 9 a.m. - 5:30 p.m. 306-435-3919 Saturday: 9 a.m. - 5 p.m. 505 MOOSE ST. • MOOSOMIN, SK 602 Birtle Street • Moosomin, SK 604 Gordon St. – Moosomin, SK Visit us on Facebook! 306-435-3252 www.homehardware.ca 306-435-2220

Moosomin, SK • 306-435-3906 Hardwood • Laminate • Tile 461 MAIN ST. • ESTERHAZY, SK Carpet • Linoleum • Vinyl 306-745-1600 We do Kitchen Craft Cabinets www.thewirelessage.com

Universe Satellite Sales Ltd. 520 Railway Ave. • Rocanville, SK 306.645.2669 www.universesatellite.com

220 Nelson St. W. • Virden, MB 480-7th Ave. • Virden, MB 204-748-2382 204-748-2143

ESTERHAZY LANGENBURG 300 Kennedy Drive 421 Kaiser William Ave E Furniture & Electronics Esterhazy, SK Langenburg, SK See us for all your Car, Truck, 306-745-2688 306-743-2688 Furniture Traeger Ag and Auto needs! Breakfast, Lunch and Dinner • Dine-In or Take-Out Electronics Grills See our full menu online at www.chickenchef.com ROCANVILLE, SK LANGENBURG, SK 27 Railway Ave, Redvers SK 306-452-6309 306-645-2112 306-743-2332 Monday, August 9, 2021 The World-Spectator - Moosomin, Sask. 39 SHOP LOCAL 1Ĕ
;LĔ
IJ?ř WE’RE BACK TO OUR REGULAR HOURS! 9 am - 6 pm Monday - Saturday Business Directory at both locations Moosomin, SK Esterhazy, SK Support your local Businesses (306) 435-2464 (306) 745-3915

We’re here for you! Precious Details PACKAGES CUSTOM MADE KEEPSAKES! Car Wash IN-STORE DINING NOW AVAILABLE! Embroidery • Decals• Baby/Birthday gifts & Laundrom at Looking for something unique? Moosomin, SK • 306) 434-6683 from 1o am - 1o pm daily Just call or email ahead and we We provide safe service through can design something for you! WE ARE OPEN! Hours are by appointment only: Monday - Saturday between Drive Thru, Take Out & Dine in 9 am - 8 pm, pick up arranged through social distancing Car Wash • Laundrom at We recommend using Interac or Credit Cards for payment We are so grateful for your support! 306-434-8770 Car Detaling • Pet Wash [email protected] Open 7 Days a week from 6 am - 9 pm 306-435-2707 @MoosominDQ www.preciouspackages.ca Fleming Windsor Covid-19 Vaccinations Bar & Grill Appointments Shirley’s Tuesday - Saturday Available at 12 Noon Sewing Room Closed Sundays for 608 Carleton Street – Moosomin, SK August & September Covid-19 Vaccination available by 306-435-3633 Now Open appointment only at the pharmacy Sit Down Service & Takeout (based on availability from Saskatchewan Health) Tuesday - Friday Daily Specials Phone 306-435-3252 10 a.m. - 5 p.m. Off-Sale to book your appointment Still accepting phone call orders, curbside pick-up and mailing services! FLEMING, SK – 306-435-2074 602 BIRTLE STREET • MOOSOMIN, SK [email protected] www.facebook.com/Fleming-Windsor-Bar-Grill 306-435-3252 We Are Open! Q Curbside Pick-Up Q Delivery within St. Lazare Tire Elkhorn, Virden & McAuley A SAFE RELIABLE VEHICLE IS Q $15 Flat Rate Shipping Pickup or Delivery STORE HOURS: Open for pick ups 1-6 Monday-Friday. Shopping can be done on to your doorstep. 11 am - 5:00 pm ALWAYS ESSENITAL. our Facebook page and our product can be found in “albums” then call the shop or message our page to place an order! NO DELIVERY FEE! Monday - Friday WE ARE OPEN AND HERE TO HELP NO CONTACT PAYMENT 1002 North Front St. Please phone ahead and adhere to Samantha’s Boutique OPTIONS: Moosomin, SK local public health orders. Credit Card, E-Transfer The Trendy Store with the Pink Door Monthly Billing 306-434-5880 204-683-2290 Flowers. Photography. Ladies Fashion. Gifts. [email protected] Hours: Monday - Friday: 8 am - 6 pm ELKHORN, MB • 204-845-2530

506 Main Street • Moosomin, SK 306-435-2227 tjspizza.ca OPEN 7 DAYS A WEEK lo Both Esterhazy & Langenburg ApolRESTAURANT OPEN 7 locations are open 10 a.m. - 9 p.m. DAYS A WEEK! Pickup • Delivery • Offsale 306-645-2833 Monday - Saturday: 11 a.m. - 9 p.m. Rocanville, SK Sunday: 1 p.m. - 9 p.m. DINE-IN AVAILABLE WE ARE OPEN FOR Esterhazy Langenburg SIT DOWN AND TAKE OUT! NO-CONTACT DELIVERY Curbside Pickup 306-745-2688 306-743-2688 Monday - Friday: Sunday: See our full menu online at www.chickenchef.com 8 a.m. - 8 p.m. 9 a.m. - 7 p.m. or In-Store Pickup Closed Saturday 40 The World-Spectator - Moosomin, Sask. Monday, August 9, 2021