DOCSLIB.ORG

LINE-1 Retrotransposition: Impact on Genome Stability and Diversity and Human Disease

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
LINE-1 Retrotransposition: Impact on Genome Stability and Diversity and Human Disease Journal of Biomedicine and Biotechnology LINE-1 Retrotransposition: Impact on Genome Stability and Diversity and Human Disease Guest Editors: Nina Luning Prak and Abdelali Haoudi Journal of Biomedicine and Biotechnology LINE-1 Retrotransposition: Impact on Genome Stability and Diversity and Human Disease Journal of Biomedicine and Biotechnology LINE-1 Retrotransposition: Impact on Genome Stability and Diversity and Human Disease Guest Editors: Nina Luning Prak and Abdelali Haoudi Copyright © 2006 Hindawi Publishing Corporation. All rights reserved. This is a special issue published in volume 2006 of “Journal of Biomedicine and Biotechnology.” All articles are open access articles distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Founding Managing Editor Abdelali Haoudi, Eastern Virginia Medical School, USA Editors-in-Chief H. N. Ananthaswamy, USA Marc Fellous, France Peter M. Gresshoff, Australia Associate Editors Halima Bensmail, USA Vladimir Larionov, USA Wolfgang A. Schulz, Germany Marìa A. Blasco, Spain George Perry, USA O. John Semmes, USA Shyam K. Dube, USA Steffen B. Petersen, Denmark James L. Sherley, USA Mauro Giacca, Italy Nina Luning Prak, USA Mark A. Smith, USA James Huff, USA Annie J. Sasco, France Lisa Wiesmuller, Germany Editors Claude Bagnis, France Shahid Jameel, India Allal Ouhtit, USA Mohamed Boutjdir, USA Celina Janion, Poland Kanury V. S. Rao, India Douglas Bristol, USA Pierre Lehn, France Gerald G. Schumann, Germany Ronald E. Cannon, USA Nan Liu, USA Pierre Tambourin, France V. Singh Chauhan, India Yan Luo, USA Michel Tibayrenc, France Jean Dausset, France John Macgregor, France Leila Zahed, Lebanon John W. Drake, USA James M. Mason, USA Steven L. Zeichner, USA Hatem El Shanti, USA Ali Ouaissi, France Contents LINE-1 Retrotransposition: Impact on Genome Stability and Diversity and Human Disease, Nina Luning Prak and Abdelali Haoudi Volume 2006 (2006), Article ID 37049, 2 pages The ORF1 Protein Encoded by LINE-1: Structure and Function During L1 Retrotransposition, Sandra L. Martin Volume 2006 (2006), Article ID 45621, 6 pages Do LINEs Have a Role in X-Chromosome Inactivation?, Mary F. Lyon Volume 2006 (2006), Article ID 59746, 6 pages LINE-1 Endonuclease-Dependent Retrotranspositional Events Causing Human Genetic Disease: Mutation Detection Bias and Multiple Mechanisms of Target Gene Disruption, Jian-Min Chen, Claude Férec, and David N. Cooper Volume 2006 (2006), Article ID 56182, 9 pages L1 Antisense Promoter Drives Tissue-Specific Transcription of Human Genes, Kert Mätlik, Kaja Redik, and Mart Speek Volume 2006 (2006), Article ID 71753, 16 pages Links Between Repeated Sequences, Sachiko Matsutani Volume 2006 (2006), Article ID 13569, 3 pages The Genomic Distribution of L1 Elements: The Role of Insertion Bias and Natural Selection, Todd Graham and Stephane Boissinot Volume 2006 (2006), Article ID 75327, 5 pages L1 Retrotransposons in Human Cancers, Wolfgang A. Schulz Volume 2006 (2006), Article ID 83672, 12 pages LINE-1 Hypomethylation in a Choline-Deficiency-Induced Liver Cancer in Rats: Dependence on Feeding Period, Kiyoshi Asada, Yashige Kotake, Rumiko Asada, Deborah Saunders, Robert H. Broyles, Rheal A. Towner, Hiroshi Fukui, and Robert A. Floyd Volume 2006 (2006), Article ID 17142, 6 pages DNA Damage and L1 Retrotransposition, Evan A. Farkash and Eline T. Luning Prak Volume 2006 (2006), Article ID 37285, 8 pages Do Small RNAs Interfere With LINE-1?, Harris S. Soifer Volume 2006 (2006), Article ID 29049, 8 pages The Potential Regulation of L1 Mobility by RNA Interference, Shane R. Horman, Petr Svoboda, and Eline T. Luning Prak Volume 2006 (2006), Article ID 32713, 8 pages Hindawi Publishing Corporation Journal of Biomedicine and Biotechnology Volume 2006, Article ID 37049, Pages 1–2 DOI 10.1155/JBB/2006/37049 Editorial LINE-1 Retrotransposition: Impact on Genome Stability and Diversity and Human Disease Nina Luning Prak and Abdelali Haoudi Department of Microbiology and Molecular Cell Biology, Eastern Virginia Medical School, Norfolk, Virginia 23501, USA Received 6 February 2006; Accepted 6 February 2006 Copyright © 2006 N. L. Prak and A. Haoudi. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. When we started thinking about devoting an issue of the cleic acid binding, and nucleic acid chaperone activity. In her Journal of Biomedicine and Biotechnology to LINE-1s, we were paper, Mary F Lyon discusses the possible role of L1s in X- not sure it would fly. LINE-1s are long interspersed elements chromosome inactivation (XCI). Lyon presents evidence and that account for 17% of the mass of the human genome (1), a possible mechanism for the accumulation of L1s on the hu- but far fewer than 17% of geneticists work on them! Nev- man X-chromosome in such a manner that they could fulfill ertheless, L1s have received considerable press lately, includ- the potential function as booster elements in XCI. Whether ing a number of high-profile stories featuring retrotranspo- L1s are part of the mechanism of XCI or a result of it re- sition in L1 transgenic mice, functional studies of L1, and mains enigmatic. Shifting gears from L1 biology to L1 ef- the potential contributions of L1s to the transcriptome (2– fects on the genome, Jian-Min Chen et al point to the chal- 13). Based on these exciting developments in the L1 field and lenges of detecting of autosomal L1-mediated insertions in the collective enthusiasm and expertise of the contributors to their review article. In addition, Chen et al discuss the man- this edition, we are pleased to present this special L1 issue. ner in which target genes are disrupted by L1-mediated retro- The LINE-1 element (long interspersed element, L1) is an transpositional events and comment that these are likely to autonomous retrotransposon that propagates in the genome depend upon several different factors such as the type of via retrotransposition. During retrotransposition, L1 DNA insertion (ie, L1 direct, L1 trans-driven Alu,orL1trans- is transcribed to RNA and processed. The processed RNA driven SVA), the precise locations of the inserted sequences is reverse-transcribed by the L1-encoded reverse transcrip- within the target gene regions, the length of the inserted tase and the cDNA copy is inserted into a new chromoso- sequences, and possibly also their orientation. In their re- mal location. Over 500,000 L1 copies reside in the human search article, Kert Matl¨ık et al identify and characterize 49 genome, but L1 retrotransposition can also mobilize Alu ele- chimeric L1 mRNAs, continuing the theme of L1 effects on ments (short interspersed elements) and contribute to pro- genes. These chimeric transcripts are due to L1 sense or anti- cessed pseudogene formation (1, 14–16). Much have been sense promoter activity arising from within or nearby exist- learned in recent years about L1 structure, function, and con- ing genes. In 45 out of the 49 cases, the chimeric transcript tribution to the genome, but much more remain to be under- is in the same transcriptional orientation as the neighbor- stood, particularly how L1 insertions influence the expres- ing/surrounding gene. In addition, Matl¨ık et al show that the sion and function of neighboring genes and how L1 mobility L1 antisense promoter (ASP) can give rise to a chimeric tran- is kept in check. script whose coding region is identical to the ORF of mRNA This L1 issue is organized into two parts. The first part of several genes such as: KIAA1797, CLCN5,andSLCO1A2. consists of six papers describing L1 biology (two papers) and Finally and most provocatively, they provide evidence that the interactions of L1s with the genome (four papers). In the L1 ASP can alter the tissue-specific pattern of transcrip- a minireview, Sandra L Martin describes the structure and tion of some genes. Their study provides another dimension function of the L1 ORF1 protein during L1 retrotransposi- to the ways in which L1 can influence gene expression. In a tion. Her minireview article includes an update on recent minireview article, Sachiko Matsutani discusses the links be- studies describing L1 ORF1 protein-protein interactions, nu- tween LINE-1 and SINE (Alu) elements and how L1-encoded 2 Journal of Biomedicine and Biotechnology proteins contribute to the mobilization of other mobile el- could be targeted by RNAi, with an emphasis on different ements including Alu andprocessedpseudogenesandeven forms of double-stranded and hairpin RNA. Horman et al cellular genes. In their minireview article, Todd Graham and also point out that the conventional cell-culture-based L1 Stephane Boissinot discuss factors affecting how L1s are dis- retrotransposition assay (which relies on the expression of an tributed in the genome. L1 elements do not appear to be antisense marker cassette) may induce RNAi. randomly distributed in the genome. Graham and Boissinot We thank the contributors for their thought-provoking discuss factors that could skew the distribution of L1s in manuscripts and hope that readers will enjoy this special is- the genome, including L1 insertion bias and selection (ei- sue of the Journal of Biomedicine and Biotechnology on L1s. ther negative or positive) after insertion. The notion of neg- ative selection arising when an L1 insertion has especially Nina Luning Prak deleterious consequences (including increased recombina- Abdelali Haoudi tion, altered transcription of neighboring genes, and contin- ued retrotransposition) provides a bridge to the second sec- tion of the issue, which deals with the regulation of L1s. Nina Luning Prak is an Assistant Profes- The regulation of L1s can occur on many levels. L1 reg- sor at the Department of Pathology and ulation can occur before the element has a chance to get Laboratory Medicine at the University of going (pre- or posttranscriptional silencing, inefficient full- Pennsylvania Health System.
Load more

Recommended publications
  • Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337855 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C- terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 58 kDa Gene Name: sperm adhesion molecule 1 Database Link: NP_694859 Entrez Gene 6677 Human P38567 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855 Background: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1.
    [Show full text]
  • Program Nr: 1 from the 2004 ASHG Annual Meeting Mutations in A
    Program Nr: 1 from the 2004 ASHG Annual Meeting Mutations in a novel member of the chromodomain gene family cause CHARGE syndrome. L.E.L.M. Vissers1, C.M.A. van Ravenswaaij1, R. Admiraal2, J.A. Hurst3, B.B.A. de Vries1, I.M. Janssen1, W.A. van der Vliet1, E.H.L.P.G. Huys1, P.J. de Jong4, B.C.J. Hamel1, E.F.P.M. Schoenmakers1, H.G. Brunner1, A. Geurts van Kessel1, J.A. Veltman1. 1) Dept Human Genetics, UMC Nijmegen, Nijmegen, Netherlands; 2) Dept Otorhinolaryngology, UMC Nijmegen, Nijmegen, Netherlands; 3) Dept Clinical Genetics, The Churchill Hospital, Oxford, United Kingdom; 4) Children's Hospital Oakland Research Institute, BACPAC Resources, Oakland, CA. CHARGE association denotes the non-random occurrence of ocular coloboma, heart defects, choanal atresia, retarded growth and development, genital hypoplasia, ear anomalies and deafness (OMIM #214800). Almost all patients with CHARGE association are sporadic and its cause was unknown. We and others hypothesized that CHARGE association is due to a genomic microdeletion or to a mutation in a gene affecting early embryonic development. In this study array- based comparative genomic hybridization (array CGH) was used to screen patients with CHARGE association for submicroscopic DNA copy number alterations. De novo overlapping microdeletions in 8q12 were identified in two patients on a genome-wide 1 Mb resolution BAC array. A 2.3 Mb region of deletion overlap was defined using a tiling resolution chromosome 8 microarray. Sequence analysis of genes residing within this critical region revealed mutations in the CHD7 gene in 10 of the 17 CHARGE patients without microdeletions, including 7 heterozygous stop-codon mutations.
    [Show full text]
  • Mammalian Male Germ Cells Are Fertile Ground for Expression Profiling Of
    REPRODUCTIONREVIEW Mammalian male germ cells are fertile ground for expression profiling of sexual reproduction Gunnar Wrobel and Michael Primig Biozentrum and Swiss Institute of Bioinformatics, Klingelbergstrasse 50-70, 4056 Basel, Switzerland Correspondence should be addressed to Michael Primig; Email: [email protected] Abstract Recent large-scale transcriptional profiling experiments of mammalian spermatogenesis using rodent model systems and different types of microarrays have yielded insight into the expression program of male germ cells. These studies revealed that an astonishingly large number of loci are differentially expressed during spermatogenesis. Among them are several hundred transcripts that appear to be specific for meiotic and post-meiotic germ cells. This group includes many genes that were pre- viously implicated in spermatogenesis and/or fertility and others that are as yet poorly characterized. Profiling experiments thus reveal candidates for regulation of spermatogenesis and fertility as well as targets for innovative contraceptives that act on gene products absent in somatic tissues. In this review, consolidated high density oligonucleotide microarray data from rodent total testis and purified germ cell samples are analyzed and their impact on our understanding of the transcriptional program governing male germ cell differentiation is discussed. Reproduction (2005) 129 1–7 Introduction 2002, Sadate-Ngatchou et al. 2003) and the absence of cAMP responsive-element modulator (Crem) and deleted During mammalian male
    [Show full text]
  • Gene Section Mini Review
    Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL AT INIST-CNRS Gene Section Mini Review SPAM1 (sperm adhesion molecule 1 (PH -20 hyaluronidase, zona pellucida binding)) Asli Sade, Sreeparna Banerjee Department of Biology, Middle East Technical University, Ankara 06531, Turkey (AS, SB) Published in Atlas Database: March 2010 Online updated version : http://AtlasGeneticsOncology.org/Genes/SPAM1ID42361ch7q31.html DOI: 10.4267/2042/44921 This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 2.0 France Licence. © 2010 Atlas of Genetics and Cytogenetics in Oncology and Haematology are clustered on chromosome 3p21.3 and the other Identity three (HYAL4, SPAM1 and HYALP1) are clustered on Other names: EC 3.2.1.35, HYA1, HYAL1, HYAL3, chromosome 7q31.3. Of the three genes on HYAL5, Hyal-PH20, MGC26532, PH-20, PH20, chromosome 7q31.3, HYALP1 is an expressed SPAG15 pseudogene. The extensive homology between the six HGNC (Hugo): SPAM1 hyaluronidase genes suggests an ancient gene duplication event before the emergence of modern Location: 7q31.32 mammals. Local order: According to NCBI Map Viewer, genes flanking SPAM1 in centromere to telomere direction Description on 7q31.3 are: According to Entrez Gene, SPAM1 gene maps to locus - HYALP1 7q31.3 hyaluronoglucosaminidase NC_000007 and spans a region of 46136 bp. According pseudogene 1 to Spidey (mRNA to genomic sequence alignment - HYAL4 7q31.3 hyaluronoglucosaminidase 4 tool), SPAM1 has 7 exons, the sizes being 78, 112, - SPAM1 7q31.3 sperm adhesion molecule 1 1160, 90, 441, 99 and 404. - TMEM229A 7q31.32 transmembrane protein 229A - hCG_1651160 7q31.33 SSU72 RNA polymerase II Transcription CTD phosphatase homolog pseudogene The SPAM1 mRNA has two isoforms; transcript Note: SPAM1 is a glycosyl-phosphatidyl inositol variant 1 (NM_003117) a 2395 bp mRNA and (GPI)-anchored enzyme found in all mammalian transcript variant 2 (NM_153189) a 2009 bp mRNA.
    [Show full text]
  • Hyaluronidase PH20 (SPAM1) (NM 003117) Human Mass Spec Standard – PH305378 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH305378 Hyaluronidase PH20 (SPAM1) (NM_003117) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: SPAM1 MS Standard C13 and N15-labeled recombinant protein (NP_003108) Species: Human Expression Host: HEK293 Expression cDNA Clone RC205378 or AA Sequence: Predicted MW: 58.2 kDa Protein Sequence: >RC205378 representing NM_003117 Red=Cloning site Green=Tags(s) MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDM SLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNL GMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLL RPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRN RVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLS ATMFIWRLEVWDQGISRIGFF myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq:
    [Show full text]
  • HYAL1LUCA-1, a Candidate Tumor Suppressor Gene on Chromosome 3P21.3, Is Inactivated in Head and Neck Squamous Cell Carcinomas by Aberrant Splicing of Pre-Mrna
    Oncogene (2000) 19, 870 ± 878 ã 2000 Macmillan Publishers Ltd All rights reserved 0950 ± 9232/00 $15.00 www.nature.com/onc HYAL1LUCA-1, a candidate tumor suppressor gene on chromosome 3p21.3, is inactivated in head and neck squamous cell carcinomas by aberrant splicing of pre-mRNA Gregory I Frost1,3, Gayatry Mohapatra2, Tim M Wong1, Antonei Benjamin Cso ka1, Joe W Gray2 and Robert Stern*,1 1Department of Pathology, School of Medicine, University of California, San Francisco, California, CA 94143, USA; 2Cancer Genetics Program, UCSF Cancer Center, University of California, San Francisco, California, CA 94115, USA The hyaluronidase ®rst isolated from human plasma, genes in the process of carcinogenesis (Sager, 1997; Hyal-1, is expressed in many somatic tissues. The Hyal- Baylin et al., 1998). Nevertheless, functionally 1 gene, HYAL1, also known as LUCA-1, maps to inactivating point mutations are generally viewed as chromosome 3p21.3 within a candidate tumor suppressor the critical `smoking gun' when de®ning a novel gene locus de®ned by homozygous deletions and by TSG. functional tumor suppressor activity. Hemizygosity in We recently mapped the HYAL1 gene to human this region occurs in many malignancies, including chromosome 3p21.3 (Cso ka et al., 1998), con®rming its squamous cell carcinomas of the head and neck. We identity with LUCA-1, a candidate tumor suppressor have investigated whether cell lines derived from such gene frequently deleted in small cell lung carcinomas malignancies expressed Hyal-1 activity, using normal (SCLC) (Wei et al., 1996). The HYAL1 gene resides human keratinocytes as controls. Hyal-1 enzyme activity within a commonly deleted region of 3p21.3 where a and protein were absent or markedly reduced in six of potentially informative 30 kb homozygous deletion has seven carcinoma cell lines examined.
    [Show full text]
  • Hyaluronidase PH20 (SPAM1) (NM 001174045) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG230203 Hyaluronidase PH20 (SPAM1) (NM_001174045) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Hyaluronidase PH20 (SPAM1) (NM_001174045) Human Tagged ORF Clone Tag: TurboGFP Symbol: SPAM1 Synonyms: HEL-S-96n; HYA1; HYAL1; HYAL3; HYAL5; PH-20; PH20; SPAG15 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 5 Hyaluronidase PH20 (SPAM1) (NM_001174045) Human Tagged ORF Clone – RG230203 ORF Nucleotide >RG230203 representing NM_001174045 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGAGTGCTAAAATTCAAGCACATCTTTTTCAGAAGCTTTGTTAAATCAAGTGGAGTATCCCAGATAG TTTTCACCTTCCTTCTGATTCCATGTTGCTTGACTCTGAATTTCAGAGCACCTCCTGTTATTCCAAATGT GCCTTTCCTCTGGGCCTGGAATGCCCCAAGTGAATTTTGTCTTGGAAAATTTGATGAGCCACTAGATATG AGCCTCTTCTCTTTCATAGGAAGCCCCCGAATAAACGCCACCGGGCAAGGTGTTACAATATTTTATGTTG ATAGACTTGGCTACTATCCTTACATAGATTCAATCACAGGAGTAACTGTGAATGGAGGAATCCCCCAGAA GATTTCCTTACAAGACCATCTGGACAAAGCTAAGAAAGACATTACATTTTATATGCCAGTAGACAATTTG GGAATGGCTGTTATTGACTGGGAAGAATGGAGACCCACTTGGGCAAGAAACTGGAAACCTAAAGATGTTT
    [Show full text]
  • Characterization of Recombinant Bovine Sperm Hyaluronidase And
    J. Microbiol. Biotechnol. (2018), 28(9), 1547–1553 https://doi.org/10.4014/jmb.1804.04016 Research Article Review jmb Characterization of Recombinant Bovine Sperm Hyaluronidase and Identification of an Important Asn-X-Ser/Thr Motif for Its Activity Chaeri Park1†, Young-Hyun Kim2,3†, Sang-Rae Lee2,3†, Soojin Park4, Yena Jung1, Youngjeon Lee2,3, Ji-Su Kim2,3, Taekil Eom5, Ju-Sung Kim5, Dong-Mok Lee6, Bong-Suk Song2,3, Bo-Woong Sim2, Sun-Uk Kim2,3, Kyu-Tae Chang2,3*, and Ekyune Kim1* 1College of Pharmacy, Catholic University of Daegu, Gyeongsan 38430, Republic of Korea 2National Primate Research Center (NPRC), Korea Research Institute of Bioscience and Biotechnology (KRIBB), Daejeon 34141, Republic of Korea 3Department of Functional Genomics, KRIBB School of Bioscience, Korea University of Science and Technology (UST), Daejeon 34113, Republic of Korea 4Graduate School of Medicine, Osaka University, Suita, Osaka 5650871, Japan 5College of Applied Life Sciences, the Research Institute for Subtropical Agriculture and Biotechnology, Jeju National University, Jeju 63249, Republic of Korea 6Daegyeong Regional Division, Technology Convergence R&BD Group, Korea Institute of Industrial Technology, Yeongcheon 38822, Republic of Korea Received: April 16, 2018 Revised: July 3, 2018 Hyaluronidases are a family of enzymes that catalyse the breakdown of hyaluronic acid, Accepted: July 19, 2018 which is abundant in the extracellular matrix and cumulus oocyte complex. To investigate the First published online activity of recombinant bovine sperm hyaluronidase 1 (SPAM1) and determine the effect of July 19, 2018 the Asn-X-Ser/Thr motif on its activity, the bovine SPAM1 open reading frame was cloned *Corresponding author into the mammalian expression vector pCXN2 and then transfected to the HEK293 cell line.
    [Show full text]
  • Insights Into the Mechanism of Bovine Spermiogenesis Based on Comparative Transcriptomic Studies
    bioRxiv preprint doi: https://doi.org/10.1101/2020.09.25.313908; this version posted September 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Insights into the mechanism of bovine spermiogenesis based on comparative transcriptomic studies Xin Li 1, Chenying Duan 2, Ruyi Li 2, Dong Wang 1,* 1 Institute of Animal Science, Chinese Academy of Agricultural Sciences, 100193 Beijing, China 2 College of Animal Science and Technology, Jilin Agricultural University, 130118 Changchun, China * Corresponding author: Dong Wang E-mail: [email protected] Keywords: Spermiogenesis, Differentially expressed genes, Homology trends analysis, Protein-regulating network, ADP-ribosyltransferase 3 (ART3) 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.09.25.313908; this version posted September 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. (2), resulting in a tremendous waste. At the same Abstract time, about 15% of the couples of childbearing age worldwide are affected by infertility, of To reduce the reproductive loss caused by which 50% are due to male factors (3), and even semen quality and provide theoretical guidance sperm with normal morphology can cause
    [Show full text]
  • Dissecting the Genetics of Human Communication
    DISSECTING THE GENETICS OF HUMAN COMMUNICATION: INSIGHTS INTO SPEECH, LANGUAGE, AND READING by HEATHER ASHLEY VOSS-HOYNES Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy Department of Epidemiology and Biostatistics CASE WESTERN RESERVE UNIVERSITY January 2017 CASE WESTERN RESERVE UNIVERSITY SCHOOL OF GRADUATE STUDIES We herby approve the dissertation of Heather Ashely Voss-Hoynes Candidate for the degree of Doctor of Philosophy*. Committee Chair Sudha K. Iyengar Committee Member William Bush Committee Member Barbara Lewis Committee Member Catherine Stein Date of Defense July 13, 2016 *We also certify that written approval has been obtained for any proprietary material contained therein Table of Contents List of Tables 3 List of Figures 5 Acknowledgements 7 List of Abbreviations 9 Abstract 10 CHAPTER 1: Introduction and Specific Aims 12 CHAPTER 2: Review of speech sound disorders: epidemiology, quantitative components, and genetics 15 1. Basic Epidemiology 15 2. Endophenotypes of Speech Sound Disorders 17 3. Evidence for Genetic Basis Of Speech Sound Disorders 22 4. Genetic Studies of Speech Sound Disorders 23 5. Limitations of Previous Studies 32 CHAPTER 3: Methods 33 1. Phenotype Data 33 2. Tests For Quantitative Traits 36 4. Analytical Methods 42 CHAPTER 4: Aim I- Genome Wide Association Study 49 1. Introduction 49 2. Methods 49 3. Sample 50 5. Statistical Procedures 53 6. Results 53 8. Discussion 71 CHAPTER 5: Accounting for comorbid conditions 84 1. Introduction 84 2. Methods 86 3. Results 87 4. Discussion 105 CHAPTER 6: Hypothesis driven pathway analysis 111 1. Introduction 111 2. Methods 112 3. Results 116 4.
    [Show full text]
  • Detection of Copy Number Alterations in Metastatic Melanoma by a DNA
    Human Cancer Biology Detection of Copy Number Alterations in Metastatic Melanoma by aDNAFluorescenceIn situ Hybridization Probe Panel and Array Comparative Genomic Hybridization: A Southwest Oncology Group Study (S9431) Stephen R. Moore,1Diane L. Persons,2 Jeffrey A. Sosman,3 Dolores Bobadilla,1Victoria Bedell,1 David D. Smith,1Sandra R.Wolman,4 Ralph J. Tuthill,5 Jim Moon,6 Vernon K. Sondak,7 and Marilyn L. Slovak1 Abstract Purpose: Gene copy number alteration (CNA) is common in malignant melanoma and is associated with tumor development and progression. The concordance between molecular cytogenetic techniques used to determine CNA has not been evaluated on a large set of loci in malignant melanoma. Experimental Design: A panel of 16 locus-specific fluorescence in situ hybridization (FISH) probes located on eight chromosomes was used to identify CNA in touch preparations of frozen tissue samples from19 patients with metastaticmelanoma (SWOG-9431). A subset ( n =11)was analyzed using bacterial artificial chromosome (BAC) array comparative genomic hybridization (aCGH) of DNA isolated directly from touch-preparation slides. Results: By FISH, most samples showed loss near or at WISP3 /6p21, CCND3/6q22, and CDKN2A /9p21 (>75% of samples tested). More than one third of CDKN2A /9p21losses were biallelic. Gains of NEDD9/6p24, MET/7q31, and MYC/8q24 were common (57%, 47%, and 41%, respectively) and CNA events involving 9p21/7p12.3 and MET were frequently coincident, suggesting gain of the whole chromosome 7. Changes were confirmed by aCGH, which also uncovered many discreet regions of change, larger than a single BAC. Overlapping segments observed in >45% of samples included many of the loci analyzed in the FISH study, in addition to other WNT pathway members, and genes associated withTP53 pathways and DNA damage response, repair, and stability.
    [Show full text]
  • Atlas Journal
    Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 12, Number 4, Jul-Aug 2008 Previous Issue / Next Issue Genes AKR1C3 (aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)) (10p15.1). Hsueh Kung Lin. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 498-502. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/AKR1C3ID612ch10p15.html CASP1 (caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)) (11q22.3). Yatender Kumar, Vegesna Radha, Ghanshyam Swarup. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 503-518. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/CASP1ID145ch11q22.html GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type) (15q21.3). Prakash Radhakrishnan, Pi-Wan Cheng. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 519-524. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/GCNT3ID44105ch15q21.html HYAL2 (Hyaluronoglucosaminidase 2) (3p21.3). Lillian SN Chow, Kwok-Wai Lo. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 525-529. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/HYAL2ID40904ch3p21.html LMO2 (LIM domain only 2 (rhombotin-like 1)) (11p13) - updated. Pieter Van Vlierberghe, Jean Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2008; Vol (12): 530-535. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/RBTN2ID34.html PEBP1 (phosphatidylethanolamine binding protein 1) (12q24.23).
    [Show full text]