DOCSLIB.ORG

Testis Systems Biology Michael K

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Testis Systems Biology Michael K Spring 2018 – Systems Biology of Reproduction Discussion Outline – Testis Systems Biology Michael K. Skinner – Biol 475/575 CUE 418, 10:35-11:50 am, Tuesday & Thursday February 22, 2018 Week 7 Testis Systems Biology Primary Papers: 1. Endo, et al. (2015) PNAS E2347-2356 2. Chalmel, et al., (2014) Plos One 9:e104418 3. Gatta, et al. (2010) BMC Genomics 11:401 Discussion Student 19: Reference 1 above • How do retinoids and Stra8 interact? • What experimental design was used? • What is the integration of retinoid actions and spermatogenesis? Student 20: Reference 2 above • What was the experimental design and omics technologies used? • What was the secretome observed? • How do Sertloli and germ cells interact? Student 22: Reference 3 above • What is the experimental and systems approach? • What genetic and expression relationships exist? • What insights are provided on the molecular control of male infertility? Periodic retinoic acid–STRA8 signaling intersects with PNAS PLUS periodic germ-cell competencies to regulate spermatogenesis Tsutomu Endoa,1,2, Katherine A. Romera,b,1, Ericka L. Andersona,c,1, Andrew E. Baltusa,c, Dirk G. de Rooija, and David C. Pagea,c,d,2 aWhitehead Institute, Cambridge, MA 02142; bComputational and Systems Biology Program and cDepartment of Biology, Massachusetts Institute of Technology, Cambridge, MA 02139; and dHoward Hughes Medical Institute, Whitehead Institute, Cambridge, MA 02142 Contributed by David C. Page, March 24, 2015 (sent for review January 18, 2015; reviewed by William W. Wright) Mammalian spermatogenesis—the transformation of stem cells functionally pluripotent cells have been derived in vitro without into millions of haploid spermatozoa—is elaborately organized introduction of exogenous transcription factors or miRNAs (8). in time and space. We explored the underlying regulatory mecha- Undifferentiated spermatogonia periodically undergo spermato- nisms by genetically and chemically perturbing spermatogenesis in gonial differentiation (also known as the Aaligned-to-A1 transi- vivo, focusing on spermatogonial differentiation, which begins a tion) to become differentiating spermatogonia (also known as series of amplifying divisions, and meiotic initiation, which ends A1/A2/A3/A4/intermediate/B spermatogonia). During spermatogo- these divisions. We first found that, in mice lacking the retinoic acid nial differentiation, the spermatogonia down-regulate pluripotency- (RA) target gene Stimulated by retinoic acid gene 8 (Stra8), undif- associated genes (5, 9), lose capacity for self-renewal (4), and ac- ferentiated spermatogonia accumulated in unusually high numbers celerate their cell cycle (10) to begin a series of six transit-amplifying as early as 10 d after birth, whereas differentiating spermatogonia mitotic ivisions. At the conclusion of these mitotic divisions, were depleted. We thus conclude that Stra8, previously shown to be germ cells become spermatocytes, and undergo meiotic initiation required for meiotic initiation, also promotes (but is not strictly re- (Fig. 1A). This begins the meiotic program of DNA replication quired for) spermatogonial differentiation. Second, we found that and reductive cell divisions, ensuring that spermatozoa contribute injection of RA into wild-type adult males induced, independently, exactly one of each chromosome to the zygote. precocious spermatogonial differentiation and precocious meiotic Meiotic initiation is precisely coordinated with spermatogonial initiation; thus, RA acts instructively on germ cells at both transi- differentiation: The six mitotic divisions separating the two tions. Third, the competencies of germ cells to undergo spermato- gonial differentiation or meiotic initiation in response to RA were transitions occur over a span of exactly 8.6 d (11). Moreover, found to be distinct, periodic, and limited to particular seminiferous spermatogonial differentiation and meiotic initiation occur in stages. Competencies for both transitions begin while RA levels are close physical proximity. The testis comprises structures known low, so that the germ cells respond as soon as RA levels rise. To- as seminiferous tubules (Fig. S1A); while one generation of germ gether with other findings, our results demonstrate that periodic cells is initiating meiosis, a younger generation is simultaneously RA–STRA8 signaling intersects with periodic germ-cell competencies undergoing spermatogonial differentiation, within the same tubule to regulate two distinct, cell-type-specific responses: spermatogo- nial differentiation and meiotic initiation. This simple mechanism, Significance with one signal both starting and ending the amplifying divisions, contributes to the prodigious output of spermatozoa and to the As male sex cells mature into sperm, two pivotal transitions are elaborate organization of spermatogenesis. spermatogonial differentiation (exit from the stem cell pool) and meiotic initiation. These transitions occur in physical spermatogenesis | Stra8 | mouse | retinoic acid | testis proximity, with 8.6-d periodicity. We report that the gene Stra8, essential for meiotic initiation, also promotes (but is not he adult mammalian testis is among the body’s most pro- required for) spermatogonial differentiation. Moreover, in- Tliferative tissues, producing millions of highly specialized jected RA induces both transitions to occur precociously. We gametes, or spermatozoa, each day. Spermatogenesis (the pro- conclude that a periodic RA signal, acting instructively through gram of sperm production) is carefully regulated, ensuring that the common target Stra8, coordinates these transitions. This spermatozoa are produced at a constant rate. We used the mouse RA signal intersects with two distinct windows of sex-cell as a model to understand how mammalian spermatogenesis is competency, which both begin while RA levels are low; sex organized at the cellular and molecular level. We focused on cells respond quickly to rising RA. These mechanisms help ac- two key transitions: spermatogonial differentiation, which oc- count for the elaborate organization of sperm production, and curs cyclically and begins a series of programmed mitotic di- its prodigious output. visions, and meiotic initiation, which ends these divisions and marks the beginning of the meiotic program (Fig. 1A). Author contributions: T.E., K.A.R., E.L.A., D.G.d.R., and D.C.P. designed research; T.E., K.A.R., E.L.A., and A.E.B. performed research; T.E., K.A.R., E.L.A., and D.G.d.R. analyzed data; Like other proliferative tissues (e.g., blood, intestine, and and T.E., K.A.R., and D.C.P. wrote the paper. skin), the testis relies on a modest number of stem cells (1, 2). Reviewers included: W.W.W., Johns Hopkins Bloomberg School of Public Health. The undifferentiated spermatogonia (also known as the Asingle/ The authors declare no conflict of interest. Apaired/Aaligned spermatogonia), which encompass these stem Data deposition: The mRNA-sequencing dataset reported in this paper has been depos- cells, have a remarkable capacity for self-renewal and differen- ited in the Gene Expression Omnibus (GEO) database, www.ncbi.nlm.nih.gov/geo (acces- tiation: They can reconstitute spermatogenesis upon transplantation sion no. GSE67169). to a germ-cell-depleted testis (3, 4). In vivo, undifferentiated sper- 1T.E., K.A.R, and E.L.A. contributed equally to this work. matogonia ultimately give rise to a single cell type, spermatozoa, yet 2To whom correspondence may be addressed. Email: [email protected] or dcpage@wi. these undifferentiated spermatogonia express pluripotency-associ- mit.edu. BIOLOGY ated genes such as Lin28a (Lin-28 homolog A)(5)andPou5f/Oct4 This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. DEVELOPMENTAL (6, 7) and are the only postnatal mammalian cells from which 1073/pnas.1505683112/-/DCSupplemental. www.pnas.org/cgi/doi/10.1073/pnas.1505683112 PNAS | Published online April 20, 2015 | E2347–E2356 Both of these transitions require RA, a derivative of vitamin A A. In vitamin A-deficient (VAD) mice and rats, most germ cells Spermatids arrest as undifferentiated spermatogonia (16, 17). In VAD rat (steps 1-16) testes, some germ cells instead arrest just before meiosis, as preleptotene spermatocytes (16, 18). When VAD animals are Spermatocytes injected with RA or vitamin A, the arrested spermatogonia dif- (Pl, L, Z, P, D, SC2) ferentiate (17–19), and the arrested preleptotene spermatocytes Meiotic initiate meiosis (18). During spermatogonial differentiation, RA initiation Differentiating Cell differentiation is believed to act, at least in part, directly on germ cells: Sper- spermatogonia matogonia express RA receptors (RARs) (20), and genetic ab- (Adiff , In, B) lation of RARs in germ cells modestly impairs spermatogonial Spermatogonial Undifferentiated differentiation (21). differentiation spermatogonia To understand how RA might coregulate these two transi- (Aundiff ) tions, we needed to understand its target genes. During meiotic Mitotic cell division initiation, RA acts instructively, through the target gene Stra8 (Stimulated by retinoic acid gene 8). RA induces Stra8 expression B in germ cells—not in somatic cells—in both males and females Luminal (22, 23). Stra8 is required for meiotic initiation in both sexes: Stra8-deficient germ cells in postnatal males and fetal females arrest just before meiosis, without entering meiotic prophase (24, 1314 15 15 15 16 16 25). In contrast, no specific RA target genes have been impli- cated in spermatogonial differentiation:
Load more

Recommended publications
  • Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337855 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C- terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 58 kDa Gene Name: sperm adhesion molecule 1 Database Link: NP_694859 Entrez Gene 6677 Human P38567 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody – TA337855 Background: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1.
    [Show full text]
  • Molecular and Physiological Basis for Hair Loss in Near Naked Hairless and Oak Ridge Rhino-Like Mouse Models: Tracking the Role of the Hairless Gene
    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Doctoral Dissertations Graduate School 5-2006 Molecular and Physiological Basis for Hair Loss in Near Naked Hairless and Oak Ridge Rhino-like Mouse Models: Tracking the Role of the Hairless Gene Yutao Liu University of Tennessee - Knoxville Follow this and additional works at: https://trace.tennessee.edu/utk_graddiss Part of the Life Sciences Commons Recommended Citation Liu, Yutao, "Molecular and Physiological Basis for Hair Loss in Near Naked Hairless and Oak Ridge Rhino- like Mouse Models: Tracking the Role of the Hairless Gene. " PhD diss., University of Tennessee, 2006. https://trace.tennessee.edu/utk_graddiss/1824 This Dissertation is brought to you for free and open access by the Graduate School at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Doctoral Dissertations by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. To the Graduate Council: I am submitting herewith a dissertation written by Yutao Liu entitled "Molecular and Physiological Basis for Hair Loss in Near Naked Hairless and Oak Ridge Rhino-like Mouse Models: Tracking the Role of the Hairless Gene." I have examined the final electronic copy of this dissertation for form and content and recommend that it be accepted in partial fulfillment of the requirements for the degree of Doctor of Philosophy, with a major in Life Sciences. Brynn H. Voy, Major Professor We have read this dissertation and recommend its acceptance: Naima Moustaid-Moussa, Yisong Wang, Rogert Hettich Accepted for the Council: Carolyn R.
    [Show full text]
  • Program Nr: 1 from the 2004 ASHG Annual Meeting Mutations in A
    Program Nr: 1 from the 2004 ASHG Annual Meeting Mutations in a novel member of the chromodomain gene family cause CHARGE syndrome. L.E.L.M. Vissers1, C.M.A. van Ravenswaaij1, R. Admiraal2, J.A. Hurst3, B.B.A. de Vries1, I.M. Janssen1, W.A. van der Vliet1, E.H.L.P.G. Huys1, P.J. de Jong4, B.C.J. Hamel1, E.F.P.M. Schoenmakers1, H.G. Brunner1, A. Geurts van Kessel1, J.A. Veltman1. 1) Dept Human Genetics, UMC Nijmegen, Nijmegen, Netherlands; 2) Dept Otorhinolaryngology, UMC Nijmegen, Nijmegen, Netherlands; 3) Dept Clinical Genetics, The Churchill Hospital, Oxford, United Kingdom; 4) Children's Hospital Oakland Research Institute, BACPAC Resources, Oakland, CA. CHARGE association denotes the non-random occurrence of ocular coloboma, heart defects, choanal atresia, retarded growth and development, genital hypoplasia, ear anomalies and deafness (OMIM #214800). Almost all patients with CHARGE association are sporadic and its cause was unknown. We and others hypothesized that CHARGE association is due to a genomic microdeletion or to a mutation in a gene affecting early embryonic development. In this study array- based comparative genomic hybridization (array CGH) was used to screen patients with CHARGE association for submicroscopic DNA copy number alterations. De novo overlapping microdeletions in 8q12 were identified in two patients on a genome-wide 1 Mb resolution BAC array. A 2.3 Mb region of deletion overlap was defined using a tiling resolution chromosome 8 microarray. Sequence analysis of genes residing within this critical region revealed mutations in the CHD7 gene in 10 of the 17 CHARGE patients without microdeletions, including 7 heterozygous stop-codon mutations.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Mammalian Male Germ Cells Are Fertile Ground for Expression Profiling Of
    REPRODUCTIONREVIEW Mammalian male germ cells are fertile ground for expression profiling of sexual reproduction Gunnar Wrobel and Michael Primig Biozentrum and Swiss Institute of Bioinformatics, Klingelbergstrasse 50-70, 4056 Basel, Switzerland Correspondence should be addressed to Michael Primig; Email: [email protected] Abstract Recent large-scale transcriptional profiling experiments of mammalian spermatogenesis using rodent model systems and different types of microarrays have yielded insight into the expression program of male germ cells. These studies revealed that an astonishingly large number of loci are differentially expressed during spermatogenesis. Among them are several hundred transcripts that appear to be specific for meiotic and post-meiotic germ cells. This group includes many genes that were pre- viously implicated in spermatogenesis and/or fertility and others that are as yet poorly characterized. Profiling experiments thus reveal candidates for regulation of spermatogenesis and fertility as well as targets for innovative contraceptives that act on gene products absent in somatic tissues. In this review, consolidated high density oligonucleotide microarray data from rodent total testis and purified germ cell samples are analyzed and their impact on our understanding of the transcriptional program governing male germ cell differentiation is discussed. Reproduction (2005) 129 1–7 Introduction 2002, Sadate-Ngatchou et al. 2003) and the absence of cAMP responsive-element modulator (Crem) and deleted During mammalian male
    [Show full text]
  • Supplemental Data
    Supplementary Materials 1. Supplementary Methods 2. Supplementary Figures • Figure S1. RNA-seq measurement of kidney gene expression for known markers of acute kidney injury (Kim-1, Fgβ) and kidney fibrosis (Col1a1, Fn1). • Figure S2. Histological, biochemical and molecular characteristics of mouse models of kidney fibrosis and acute kidney injury. • Figure S3. RNA-seq vs. qRT-PCR correlation of gene expression measurement for the 11 selected candidates. • Figure S4. Histological characteristics of a normal vs. fibrotic human kidney. 3. Supplementary Tables • Table S1. List of genes identified by RNA-seq as significantly different from normal at least at one time-point in the FA nephropathy progression. • Table S2. List of peptides used for selected reaction monitoring (SRM) assays. • Table S3. List of primers used for mouse qRT-PCR. • Table S4. List of primers used for human qRT-PCR. Page 1 of 31 1. Supplementary Methods Animal studies Biospecimen collection: At the moment of sacrifice, blood was collected from the inferior vena cava under isoflurane anesthesia, and, following opening of the thoracic cavity to ensure that the animal is deceased, the kidneys were retrieved and sectioned in samples dedicated for histology and immunfluorescence (fixed in 10% neutral buffered formalin), protein and RNA analysis (flash-frozen in liquid nitrogen). Similarly, liver tissue sections from the left lateral lobe of the ANIT fed mice were fixed in neutral buffered formalin for histopathological processing, while other liver sections were flash-frozen in liquid nitrogen. Blood was collected from mice in heparinized tubes and plasma was separated following centrifugation at 7500 g for 5 minutes. Blood urea nitrogen (BUN) was measured using an InfinityUrea kit (Thermo Fisher Scientific, Wilmington, DE) and serum creatinine (SCr) was measured using a Creatinine Analyzer II (Beckman Coulter).
    [Show full text]
  • Gene Section Mini Review
    Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL AT INIST-CNRS Gene Section Mini Review SPAM1 (sperm adhesion molecule 1 (PH -20 hyaluronidase, zona pellucida binding)) Asli Sade, Sreeparna Banerjee Department of Biology, Middle East Technical University, Ankara 06531, Turkey (AS, SB) Published in Atlas Database: March 2010 Online updated version : http://AtlasGeneticsOncology.org/Genes/SPAM1ID42361ch7q31.html DOI: 10.4267/2042/44921 This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 2.0 France Licence. © 2010 Atlas of Genetics and Cytogenetics in Oncology and Haematology are clustered on chromosome 3p21.3 and the other Identity three (HYAL4, SPAM1 and HYALP1) are clustered on Other names: EC 3.2.1.35, HYA1, HYAL1, HYAL3, chromosome 7q31.3. Of the three genes on HYAL5, Hyal-PH20, MGC26532, PH-20, PH20, chromosome 7q31.3, HYALP1 is an expressed SPAG15 pseudogene. The extensive homology between the six HGNC (Hugo): SPAM1 hyaluronidase genes suggests an ancient gene duplication event before the emergence of modern Location: 7q31.32 mammals. Local order: According to NCBI Map Viewer, genes flanking SPAM1 in centromere to telomere direction Description on 7q31.3 are: According to Entrez Gene, SPAM1 gene maps to locus - HYALP1 7q31.3 hyaluronoglucosaminidase NC_000007 and spans a region of 46136 bp. According pseudogene 1 to Spidey (mRNA to genomic sequence alignment - HYAL4 7q31.3 hyaluronoglucosaminidase 4 tool), SPAM1 has 7 exons, the sizes being 78, 112, - SPAM1 7q31.3 sperm adhesion molecule 1 1160, 90, 441, 99 and 404. - TMEM229A 7q31.32 transmembrane protein 229A - hCG_1651160 7q31.33 SSU72 RNA polymerase II Transcription CTD phosphatase homolog pseudogene The SPAM1 mRNA has two isoforms; transcript Note: SPAM1 is a glycosyl-phosphatidyl inositol variant 1 (NM_003117) a 2395 bp mRNA and (GPI)-anchored enzyme found in all mammalian transcript variant 2 (NM_153189) a 2009 bp mRNA.
    [Show full text]
  • Hippo and Sonic Hedgehog Signalling Pathway Modulation of Human Urothelial Tissue Homeostasis
    Hippo and Sonic Hedgehog signalling pathway modulation of human urothelial tissue homeostasis Thomas Crighton PhD University of York Department of Biology November 2020 Abstract The urinary tract is lined by a barrier-forming, mitotically-quiescent urothelium, which retains the ability to regenerate following injury. Regulation of tissue homeostasis by Hippo and Sonic Hedgehog signalling has previously been implicated in various mammalian epithelia, but limited evidence exists as to their role in adult human urothelial physiology. Focussing on the Hippo pathway, the aims of this thesis were to characterise expression of said pathways in urothelium, determine what role the pathways have in regulating urothelial phenotype, and investigate whether the pathways are implicated in muscle-invasive bladder cancer (MIBC). These aims were assessed using a cell culture paradigm of Normal Human Urothelial (NHU) cells that can be manipulated in vitro to represent different differentiated phenotypes, alongside MIBC cell lines and The Cancer Genome Atlas resource. Transcriptomic analysis of NHU cells identified a significant induction of VGLL1, a poorly understood regulator of Hippo signalling, in differentiated cells. Activation of upstream transcription factors PPARγ and GATA3 and/or blockade of active EGFR/RAS/RAF/MEK/ERK signalling were identified as mechanisms which induce VGLL1 expression in NHU cells. Ectopic overexpression of VGLL1 in undifferentiated NHU cells and MIBC cell line T24 resulted in significantly reduced proliferation. Conversely, knockdown of VGLL1 in differentiated NHU cells significantly reduced barrier tightness in an unwounded state, while inhibiting regeneration and increasing cell cycle activation in scratch-wounded cultures. A signalling pathway previously observed to be inhibited by VGLL1 function, YAP/TAZ, was unaffected by VGLL1 manipulation.
    [Show full text]
  • Hyaluronidase PH20 (SPAM1) (NM 003117) Human Mass Spec Standard – PH305378 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH305378 Hyaluronidase PH20 (SPAM1) (NM_003117) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: SPAM1 MS Standard C13 and N15-labeled recombinant protein (NP_003108) Species: Human Expression Host: HEK293 Expression cDNA Clone RC205378 or AA Sequence: Predicted MW: 58.2 kDa Protein Sequence: >RC205378 representing NM_003117 Red=Cloning site Green=Tags(s) MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDM SLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNL GMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLL RPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRN RVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLS ATMFIWRLEVWDQGISRIGFF myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq:
    [Show full text]
  • 9Faaa2444c3ffa7b739bc49e981
    Original Article Comparison of Protamine 1 to Protamine 2 mRNA Ratio and YBX2 gene mRNA Content in Testicular Tissue of Fertile and Azoospermic Men Sahar Moghbelinejad, Ph.D.1, 2, Reza Najafipour, Ph.D.1, 2*, Amir Samimi Hashjin, M.Sc.1 1. Cellular and Molecular Research Centre, Qazvin University of Medical Sciences, Qazvin, Iran 2. Department of Medical Genetics, Qazvin University of Medical Sciences, Qazvin, Iran Abstract Background: Although aberrant protamine (PRM) ratios have been observed in infertile men, the mechanisms that implicit the uncoupling of PRM1 and PRM2 expression remain unclear. To uncover these mechanisms, in this observational study we have compared the PRM1/PRM2 mRNA ratio and mRNA contents of two regulatory factors of these genes. Materials and Methods: In this experimental study, sampling was performed by a mul- ti-step method from 50 non-obstructive azoospermic and 12 normal men. After RNA extraction and cDNA synthesis, real-time quantitative polymerase chain reaction (RT- QPCR) was used to analyze the PRM1, PRM2, Y box binding protein 2 (YBX2) and JmjC-containing histone demethylase 2a (JHDM2A) genes in testicular biopsies of the studied samples. Results: The PRM1/PRM2 mRNA ratio differed significantly among studied groups, namely 0.21 ± 0.13 in azoospermic samples and -0.8 ± 0.22 in fertile samples. The amount of PRM2 mRNA, significantly reduced in azoospermic patients. Azoospermic men exhib- ited significant under expression of YBX2 gene compared to controls (P<0.001). mRNA content of this gene showed a positive correlation with PRM mRNA ratio (R=0.6, P=0.007). JHDM2A gene expression ratio did not show any significant difference between the studied groups (P=0.3).
    [Show full text]
  • HYAL1LUCA-1, a Candidate Tumor Suppressor Gene on Chromosome 3P21.3, Is Inactivated in Head and Neck Squamous Cell Carcinomas by Aberrant Splicing of Pre-Mrna
    Oncogene (2000) 19, 870 ± 878 ã 2000 Macmillan Publishers Ltd All rights reserved 0950 ± 9232/00 $15.00 www.nature.com/onc HYAL1LUCA-1, a candidate tumor suppressor gene on chromosome 3p21.3, is inactivated in head and neck squamous cell carcinomas by aberrant splicing of pre-mRNA Gregory I Frost1,3, Gayatry Mohapatra2, Tim M Wong1, Antonei Benjamin Cso ka1, Joe W Gray2 and Robert Stern*,1 1Department of Pathology, School of Medicine, University of California, San Francisco, California, CA 94143, USA; 2Cancer Genetics Program, UCSF Cancer Center, University of California, San Francisco, California, CA 94115, USA The hyaluronidase ®rst isolated from human plasma, genes in the process of carcinogenesis (Sager, 1997; Hyal-1, is expressed in many somatic tissues. The Hyal- Baylin et al., 1998). Nevertheless, functionally 1 gene, HYAL1, also known as LUCA-1, maps to inactivating point mutations are generally viewed as chromosome 3p21.3 within a candidate tumor suppressor the critical `smoking gun' when de®ning a novel gene locus de®ned by homozygous deletions and by TSG. functional tumor suppressor activity. Hemizygosity in We recently mapped the HYAL1 gene to human this region occurs in many malignancies, including chromosome 3p21.3 (Cso ka et al., 1998), con®rming its squamous cell carcinomas of the head and neck. We identity with LUCA-1, a candidate tumor suppressor have investigated whether cell lines derived from such gene frequently deleted in small cell lung carcinomas malignancies expressed Hyal-1 activity, using normal (SCLC) (Wei et al., 1996). The HYAL1 gene resides human keratinocytes as controls. Hyal-1 enzyme activity within a commonly deleted region of 3p21.3 where a and protein were absent or markedly reduced in six of potentially informative 30 kb homozygous deletion has seven carcinoma cell lines examined.
    [Show full text]
  • Proteomic Characterization of Transcription and Splicing Factors Associated with a Metastatic Phenotype in Colorectal Cancer
    Proteomic characterization of transcription and splicing factors associated with a metastatic phenotype in colorectal cancer Sofía Torres1+, Irene García-Palmero1+, Consuelo Marín-Vicente1,2, Rubén A. Bartolomé1, Eva Calviño1, María Jesús Fernández-Aceñero3 and J. Ignacio Casal1* +. Equal authorship 1. Functional proteomics. Centro de Investigaciones Biológicas (CIB-CSIC). Ramiro de Maeztu 9. Madrid. Spain. 2. Proteomic facilities. CIB-CSIC. Madrid. Spain 3. Department of Pathology. Hospital Clínico. Madrid. Spain Running title: Transcription factors in metastatic colorectal cancer Keywords: SRSF3, transcription factors, splicing factors, metastasis, colorectal cancer *. Corresponding author J. Ignacio Casal Department of Cellular and Molecular Medicine Centro de Investigaciones Biológicas (CIB-CSIC) Ramiro de Maeztu, 9 28040 Madrid, Spain Phone: +34 918373112 Fax: +34 91 5360432 Email: [email protected] 1 ABSTRACT We investigated new transcription and splicing factors associated with the metastatic phenotype in colorectal cancer. A concatenated tandem array of consensus transcription factors (TFs)-response elements was used to pull down nuclear extracts in two different pairs of colorectal cancer cells, KM12SM/KM12C and SW620/480, genetically-related but differing in metastatic ability. Proteins were analyzed by label-free LC-MS and quantified with MaxLFQ. We found 240 proteins showing a significant dysregulation in highly- metastatic KM12SM cells relative to non-metastatic KM12C cells and 257 proteins in metastatic SW620 versus SW480. In both cell lines there were similar alterations in genuine TFs and components of the splicing machinery like UPF1, TCF7L2/TCF-4, YBX1 or SRSF3. However, a significant number of alterations were cell-line specific. Functional silencing of MAFG, TFE3, TCF7L2/TCF-4 and SRSF3 in KM12 cells caused alterations in adhesion, survival, proliferation, migration and liver homing, supporting their role in metastasis.
    [Show full text]