DOCSLIB.ORG

Whole-Genome Sequencing of Finnish Type 1 Diabetic Siblings Discordant for Kidney Disease Reveals DNA Variants Associated with Diabetic Nephropathy

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Whole-Genome Sequencing of Finnish Type 1 Diabetic Siblings Discordant for Kidney Disease Reveals DNA Variants Associated with Diabetic Nephropathy BASIC RESEARCH www.jasn.org Whole-Genome Sequencing of Finnish Type 1 Diabetic Siblings Discordant for Kidney Disease Reveals DNA Variants associated with Diabetic Nephropathy Jing Guo ,1,2 Owen J. L. Rackham ,2 Niina Sandholm ,3,4,5 Bing He ,1 Anne-May Österholm,1,2 Erkka Valo ,3,4,5 Valma Harjutsalo ,3,4,5,6 Carol Forsblom,3,4,5 Iiro Toppila,3,4,5 Maija Parkkonen,3,4,5 Qibin Li,7 Wenjuan Zhu,7 Nathan Harmston ,2,8 Sonia Chothani,2 Miina K. Öhman ,2 Eudora Eng,2 Yang Sun,2 Enrico Petretto ,2,9 Per-Henrik Groop,3,4,5,10 and Karl Tryggvason1,2,11 Due to the number of contributing authors, the affiliations are listed at the end of this article. ABSTRACT Background Several genetic susceptibility loci associated with diabetic nephropathy have been documen- ted, but no causative variants implying novel pathogenetic mechanisms have been elucidated. Methods We carried out whole-genome sequencing of a discovery cohort of Finnish siblings with type 1 diabetes who were discordant for the presence (case) or absence (control) of diabetic nephropathy. Con- trols had diabetes without complications for 15–37 years. We analyzed and annotated variants at genome, gene, and single-nucleotide variant levels. We then replicated the associated variants, genes, and regions in a replication cohort from the Finnish Diabetic Nephropathy study that included 3531 unrelated Finns with type 1 diabetes. Results We observed protein-altering variants and an enrichment of variants in regions associated with the presence or absence of diabetic nephropathy. The replication cohort confirmed variants in both regulatory and protein-coding regions. We also observed that diabetic nephropathy–associated variants, when clus- tered at the gene level, are enriched in a core protein-interaction network representing proteins essential for podocyte function. These genes include protein kinases (protein kinase C isoforms « and i) and protein tyrosine kinase 2. Conclusions Our comprehensive analysis of a diabetic nephropathy cohort of siblings with type 1 di- abetes who were discordant for kidney disease points to variants and genes that are potentially caus- ative or protective for diabetic nephropathy. This includes variants in two isoforms of the protein kinase C family not previously linked to diabetic nephropathy, adding support to previous hypotheses that the protein kinase C family members play a role in diabetic nephropathy and might be attractive therapeutic targets. JASN 31: 309–323, 2020. doi: https://doi.org/10.1681/ASN.2019030289 With the increase in the incidence of diabetes worldwide, complications such as diabetic nephrop- Received March 22, 2019. Accepted October 19, 2019. athy (DN), retinopathy, neuropathy, skin ulcers, and Published online ahead of print. Publication date available at amputations have become a major global health and www.jasn.org. socioeconomic threat. In addition to intensive blood Correspondence: Prof. Karl Tryggvason or Prof. Enrico Petretto, 1 glucose control, the only drugs providing a signif- Cardiovascular and Metabolic Disorders Program, Duke-NUS Medical icant delay in progression of DN are angiotensin- School, 8 College Road Singapore 169857. Email: karl.tryggvason@ converting enzyme inhibitors or angiotensin receptor duke-nus.edu.sg or [email protected] blockers, which reduce intraglomerular pressure and Copyright © 2020 by the American Society of Nephrology JASN 31: 309–323, 2020 ISSN : 1046-6673/3102-309 309 BASIC RESEARCH www.jasn.org efferent arteriolar vasoconstriction.2 The molecular pathogene- Significance Statement sis of DN is still poorly understood. Hyperglycemia, a major risk factor for complications, causes accumulation of toxic glucose Although diabetic nephropathy is partly genetic in nature, the un- derivatives, such as methylglyoxal, that bind covalently to the side derlying pathogenetic mechanisms are obscure. The authors as- chains of amino acids, particularly arginine and lysine, and also sembled from the homogeneous Finnish population a cohort of 76 sibling pairs with type 1 diabetes who were discordant for diabetic 3,4 fi methionine and cysteine. Hyperglycemia alone is not suf cient nephropathy. Using whole-genome sequencing and multiple to trigger the development of complications, as only 30%–40% of analytic approaches, they identified DNA variants associated with individuals with type 1 diabetes (T1D) develop diabetic micro- nephropathy or its absence and validated their findings in a 3531- angiopathy.1,5,6 Independent familial studies have shown a trend member cohort of unrelated Finns with type 1 diabetes. The genes of family aggregation of DN in different populations,7,8 most strongly associated with diabetic nephropathy encode two protein kinase C isoforms (isoforms « and i) not previously impli- suggesting a genetic predisposition to DN. At least four metabolic cated in the condition. Besides providing a resource for studies on pathways have been implicated in the development of complica- diabetic complications, these findings support previous hypotheses tions: polyol flux, increased the formation of advanced glycation that the protein kinase C family plays a role in diabetic nephropathy end products, hyperactivity of the hexosamine pathway, and and suggest potential targets for treatment. activation of protein kinase C (PKC) isoforms.4,9,10 Genome-wide association studies (GWAS) and candidate Study Participants fi gene approaches have identi ed several potential genomic loci The discovery cohort consisted of sibling pairs and small fami- 11 for DN susceptibility, but no variants with a major effect on lies, whereas the replication cohort consisted of unrelated indi- the risk of complications have been found, suggesting that DN viduals, all having T1D. The renal status was on the basis of the is modulated by a number of variants in genes that cooperate albumin excretion rate (AER) in a 24-hour urine collection or the within complex pathways. It is intriguing, however, that sev- albumin-to-creatinine ratio (ACR) in a random spot-urine col- eral independent, genome-wide linkage analysis studies car- lection. The presence of ESKD was defined according to whether ried out in white Americans, Pima Indians, black Americans, patients were undergoing dialysis or had received a kidney trans- fi and Finns have identi ed the same DN susceptibility locus plant. DN was defined by (1) persistent macroalbuminuria 12–15 on chromosome 3q. The complex interaction between (AER$300 mg/24 h or ACR.30 mg/mmol) in two of three con- genetics, risk factors such as hyperglycemia and environmen- secutive measurements or the presence of ESKD; and (2)the fi fi tal components makes it more challenging to nd speci c absence of clinical or laboratory evidence of nondiabetic renal genes for DN using genetic association studies. To that end, or urinary tract disease. Control status was defined by normoal- it could be advantageous to search for DN susceptibility genes buminuria (AER,30 mg/24 h or ACR,3 mg/mmol) despite in populations such as Finns, a uniquely homogeneous European duration of diabetes for at least 15 years (range, 15–37 years). In 16 ’ 17,18 population with the world s highest incidence of T1D. the discovery cohort, all study participants had been diagnosed With a combination of founder effects and genetic isolation, with T1D for at least 15 years, with the age at onset ,30 years; the population has accumulated rare genetic traits referred to in the replication cohort, age at diabetes onset was #40 years, “ ”19 as the Finnish Disease Heritage. In addition, Finland has a with insulin dependence within 1 year after the diagnosis of di- good public health care system, including nationwide disease abetes (or age at diabetes onset #15 years). Controls in the fi and treatment registries, which facilitates identi cation of replication cohort had minimum diabetes duration of 15 years. patients and follow-up of their clinical records. The replication cohort included 2187 controls with normal AER and 1344 cases with macroalbuminuria and ESKD. METHODS Ethical Permits All patients with diabetes gave written, informed consent Experimental Design to participate in the study and the Ethical Committee of the To search for DN susceptibility genes, we have assembled a Finnish National Public Institute, the Ethical Committee of cohort of Finnish T1D siblings with extreme phenotypes re- the Helsinki and Uusimaa Health District, and Karolinska In- garding the presence (case) or absence (control) of DN. This stitutet approved the protocol for the study. The transgene discovery cohort contained 76 T1D sibling pairs discordant manipulation in zebrafish was approved by the local ethical for DN, and three T1D families with three siblings (total of committee (the North Stockholm District Court). 80 cases and 81 controls). The samples came from two sources: the Finnish National Institutes of Health and Welfare diabetes Whole-Genome Sequencing collections, as described elsewhere15; and the Finnish Diabetic Whole-genome sequencing (WGS) was carried out on the dis- Nephropathy (FinnDiane) study.20 Furthermore, 3531 unre- covery cohort using both Illumina HiSeq 2000 and Complete lated individuals with T1D (1344 cases and 2187 controls) Genomics platforms. To evaluate the quality of the two different (Figure 1A) from FinnDiane were used for replication of findings sequencing methods, we sequenced four discordant sibling made in the discovery cohort. The main clinical characteristics of pairs with both platforms and compared the difference of the patients
Load more

Recommended publications
  • Genome-Wide Analysis of 5-Hmc in the Peripheral Blood of Systemic Lupus Erythematosus Patients Using an Hmedip-Chip
    INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 35: 1467-1479, 2015 Genome-wide analysis of 5-hmC in the peripheral blood of systemic lupus erythematosus patients using an hMeDIP-chip WEIGUO SUI1*, QIUPEI TAN1*, MING YANG1, QIANG YAN1, HUA LIN1, MINGLIN OU1, WEN XUE1, JIEJING CHEN1, TONGXIANG ZOU1, HUANYUN JING1, LI GUO1, CUIHUI CAO1, YUFENG SUN1, ZHENZHEN CUI1 and YONG DAI2 1Guangxi Key Laboratory of Metabolic Diseases Research, Central Laboratory of Guilin 181st Hospital, Guilin, Guangxi 541002; 2Clinical Medical Research Center, the Second Clinical Medical College of Jinan University (Shenzhen People's Hospital), Shenzhen, Guangdong 518020, P.R. China Received July 9, 2014; Accepted February 27, 2015 DOI: 10.3892/ijmm.2015.2149 Abstract. Systemic lupus erythematosus (SLE) is a chronic, Introduction potentially fatal systemic autoimmune disease characterized by the production of autoantibodies against a wide range Systemic lupus erythematosus (SLE) is a typical systemic auto- of self-antigens. To investigate the role of the 5-hmC DNA immune disease, involving diffuse connective tissues (1) and modification with regard to the onset of SLE, we compared is characterized by immune inflammation. SLE has a complex the levels 5-hmC between SLE patients and normal controls. pathogenesis (2), involving genetic, immunologic and envi- Whole blood was obtained from patients, and genomic DNA ronmental factors. Thus, it may result in damage to multiple was extracted. Using the hMeDIP-chip analysis and valida- tissues and organs, especially the kidneys (3). SLE arises from tion by quantitative RT-PCR (RT-qPCR), we identified the a combination of heritable and environmental influences. differentially hydroxymethylated regions that are associated Epigenetics, the study of changes in gene expression with SLE.
    [Show full text]
  • Old Data and Friends Improve with Age: Advancements with the Updated Tools of Genenetwork
    bioRxiv preprint doi: https://doi.org/10.1101/2021.05.24.445383; this version posted May 25, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Old data and friends improve with age: Advancements with the updated tools of GeneNetwork Alisha Chunduri1, David G. Ashbrook2 1Department of Biotechnology, Chaitanya Bharathi Institute of Technology, Hyderabad 500075, India 2Department of Genetics, Genomics and Informatics, University of Tennessee Health Science Center, Memphis, TN 38163, USA Abstract Understanding gene-by-environment interactions is important across biology, particularly behaviour. Families of isogenic strains are excellently placed, as the same genome can be tested in multiple environments. The BXD’s recent expansion to 140 strains makes them the largest family of murine isogenic genomes, and therefore give great power to detect QTL. Indefinite reproducible genometypes can be leveraged; old data can be reanalysed with emerging tools to produce novel biological insights. To highlight the importance of reanalyses, we obtained drug- and behavioural-phenotypes from Philip et al. 2010, and reanalysed their data with new genotypes from sequencing, and new models (GEMMA and R/qtl2). We discover QTL on chromosomes 3, 5, 9, 11, and 14, not found in the original study. We narrowed down the candidate genes based on their ability to alter gene expression and/or protein function, using cis-eQTL analysis, and variants predicted to be deleterious. Co-expression analysis (‘gene friends’) and human PheWAS were used to further narrow candidates.
    [Show full text]
  • LDB3 Monoclonal Antibody (M06), Gene Alias: CYPHER, FLJ35865, KIAA01613, Clone 3C8 KIAA0613, ORACLE, PDLIM6, ZASP, Ldb3z1, Ldb3z4
    LDB3 monoclonal antibody (M06), Gene Alias: CYPHER, FLJ35865, KIAA01613, clone 3C8 KIAA0613, ORACLE, PDLIM6, ZASP, ldb3z1, ldb3z4 Gene Summary: This gene encodes a PDZ Catalog Number: H00011155-M06 domain-containing protein. PDZ motifs are modular Regulatory Status: For research use only (RUO) protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins Product Description: Mouse monoclonal antibody interact with each other in cytoskeletal assembly or with raised against a full-length recombinant LDB3. other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene Clone Name: 3C8 interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM Immunogen: LDB3 (AAH10929, 1 a.a. ~ 283 a.a) domains. The LIM domain is a cysteine-rich motif full-length recombinant protein with GST tag. MW of the defined by 50-60 amino acids containing two GST tag alone is 26 KDa. zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this Sequence: gene have been associated with myofibrillar myopathy MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSK and dilated cardiomyopathy. Alternatively spliced AAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASY transcript variants encoding different isoforms have been NLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKVVVNSP identified; all isoforms have N-terminal PDZ domains ANADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHA while only longer isoforms (1 and 2) have C-terminal
    [Show full text]
  • Targeted Genes and Methodology Details for Neuromuscular Genetic Panels
    Targeted Genes and Methodology Details for Neuromuscular Genetic Panels Reference transcripts based on build GRCh37 (hg19) interrogated by Neuromuscular Genetic Panels Next-generation sequencing (NGS) and/or Sanger sequencing is performed Motor Neuron Disease Panel to test for the presence of a mutation in these genes. Gene GenBank Accession Number Regions of homology, high GC-rich content, and repetitive sequences may ALS2 NM_020919 not provide accurate sequence. Therefore, all reported alterations detected ANG NM_001145 by NGS are confirmed by an independent reference method based on laboratory developed criteria. However, this does not rule out the possibility CHMP2B NM_014043 of a false-negative result in these regions. ERBB4 NM_005235 Sanger sequencing is used to confirm alterations detected by NGS when FIG4 NM_014845 appropriate.(Unpublished Mayo method) FUS NM_004960 HNRNPA1 NM_031157 OPTN NM_021980 PFN1 NM_005022 SETX NM_015046 SIGMAR1 NM_005866 SOD1 NM_000454 SQSTM1 NM_003900 TARDBP NM_007375 UBQLN2 NM_013444 VAPB NM_004738 VCP NM_007126 ©2018 Mayo Foundation for Medical Education and Research Page 1 of 14 MC4091-83rev1018 Muscular Dystrophy Panel Muscular Dystrophy Panel Gene GenBank Accession Number Gene GenBank Accession Number ACTA1 NM_001100 LMNA NM_170707 ANO5 NM_213599 LPIN1 NM_145693 B3GALNT2 NM_152490 MATR3 NM_199189 B4GAT1 NM_006876 MYH2 NM_017534 BAG3 NM_004281 MYH7 NM_000257 BIN1 NM_139343 MYOT NM_006790 BVES NM_007073 NEB NM_004543 CAPN3 NM_000070 PLEC NM_000445 CAV3 NM_033337 POMGNT1 NM_017739 CAVIN1 NM_012232 POMGNT2
    [Show full text]
  • Imm Catalog.Pdf
    $ Gene Symbol A B 3 C 4 D 9 E 10 F 11 G 12 H 13 I 14 J. K 17 L 18 M 19 N 20 O. P 22 R 26 S 27 T 30 U 32 V. W. X. Y. Z 33 A ® ® Gene Symbol Gene ID Antibody Monoclonal Antibody Polyclonal MaxPab Full-length Protein Partial-length Protein Antibody Pair KIt siRNA/Chimera Gene Symbol Gene ID Antibody Monoclonal Antibody Polyclonal MaxPab Full-length Protein Partial-length Protein Antibody Pair KIt siRNA/Chimera A1CF 29974 ● ● ADAMTS13 11093 ● ● ● ● ● A2M 2 ● ● ● ● ● ● ADAMTS20 80070 ● AACS 65985 ● ● ● ADAMTS5 11096 ● ● ● AANAT 15 ● ● ADAMTS8 11095 ● ● ● ● AATF 26574 ● ● ● ● ● ADAMTSL2 9719 ● AATK 9625 ● ● ● ● ADAMTSL4 54507 ● ● ABCA1 19 ● ● ● ● ● ADAR 103 ● ● ABCA5 23461 ● ● ADARB1 104 ● ● ● ● ABCA7 10347 ● ADARB2 105 ● ABCB9 23457 ● ● ● ● ● ADAT1 23536 ● ● ABCC4 10257 ● ● ● ● ADAT2 134637 ● ● ABCC5 10057 ● ● ● ● ● ADAT3 113179 ● ● ● ABCC8 6833 ● ● ● ● ADCY10 55811 ● ● ABCD2 225 ● ADD1 118 ● ● ● ● ● ● ABCD4 5826 ● ● ● ADD3 120 ● ● ● ABCG1 9619 ● ● ● ● ● ADH5 128 ● ● ● ● ● ● ABL1 25 ● ● ADIPOQ 9370 ● ● ● ● ● ABL2 27 ● ● ● ● ● ADK 132 ● ● ● ● ● ABO 28 ● ● ADM 133 ● ● ● ABP1 26 ● ● ● ● ● ADNP 23394 ● ● ● ● ABR 29 ● ● ● ● ● ADORA1 134 ● ● ACAA2 10449 ● ● ● ● ADORA2A 135 ● ● ● ● ● ● ● ACAN 176 ● ● ● ● ● ● ADORA2B 136 ● ● ACE 1636 ● ● ● ● ADRA1A 148 ● ● ● ● ACE2 59272 ● ● ADRA1B 147 ● ● ACER2 340485 ● ADRA2A 150 ● ● ACHE 43 ● ● ● ● ● ● ADRB1 153 ● ● ACIN1 22985 ● ● ● ADRB2 154 ● ● ● ● ● ACOX1 51 ● ● ● ● ● ADRB3 155 ● ● ● ● ACP5 54 ● ● ● ● ● ● ● ADRBK1 156 ● ● ● ● ACSF2 80221 ● ● ADRM1 11047 ● ● ● ● ACSF3 197322 ● ● AEBP1 165 ● ● ● ● ACSL4 2182 ●
    [Show full text]
  • A Novel Approach to Identify Driver Genes Involved in Androgen-Independent Prostate Cancer
    Schinke et al. Molecular Cancer 2014, 13:120 http://www.molecular-cancer.com/content/13/1/120 RESEARCH Open Access A novel approach to identify driver genes involved in androgen-independent prostate cancer Ellyn N Schinke1, Victor Bii1, Arun Nalla1, Dustin T Rae1, Laura Tedrick1, Gary G Meadows1 and Grant D Trobridge1,2* Abstract Background: Insertional mutagenesis screens have been used with great success to identify oncogenes and tumor suppressor genes. Typically, these screens use gammaretroviruses (γRV) or transposons as insertional mutagens. However, insertional mutations from replication-competent γRVs or transposons that occur later during oncogenesis can produce passenger mutations that do not drive cancer progression. Here, we utilized a replication-incompetent lentiviral vector (LV) to perform an insertional mutagenesis screen to identify genes in the progression to androgen-independent prostate cancer (AIPC). Methods: Prostate cancer cells were mutagenized with a LV to enrich for clones with a selective advantage in an androgen-deficient environment provided by a dysregulated gene(s) near the vector integration site. We performed our screen using an in vitro AIPC model and also an in vivo xenotransplant model for AIPC. Our approach identified proviral integration sites utilizing a shuttle vector that allows for rapid rescue of plasmids in E. coli that contain LV long terminal repeat (LTR)-chromosome junctions. This shuttle vector approach does not require PCR amplification and has several advantages over PCR-based techniques. Results: Proviral integrations were enriched near prostate cancer susceptibility loci in cells grown in androgen- deficient medium (p < 0.001), and five candidate genes that influence AIPC were identified; ATPAF1, GCOM1, MEX3D, PTRF, and TRPM4.
    [Show full text]
  • Regulation of Cdc42 and Its Effectors in Epithelial Morphogenesis Franck Pichaud1,2,*, Rhian F
    © 2019. Published by The Company of Biologists Ltd | Journal of Cell Science (2019) 132, jcs217869. doi:10.1242/jcs.217869 REVIEW SUBJECT COLLECTION: ADHESION Regulation of Cdc42 and its effectors in epithelial morphogenesis Franck Pichaud1,2,*, Rhian F. Walther1 and Francisca Nunes de Almeida1 ABSTRACT An overview of Cdc42 Cdc42 – a member of the small Rho GTPase family – regulates cell Cdc42 was discovered in yeast and belongs to a large family of small – polarity across organisms from yeast to humans. It is an essential (20 30 kDa) GTP-binding proteins (Adams et al., 1990; Johnson regulator of polarized morphogenesis in epithelial cells, through and Pringle, 1990). It is part of the Ras-homologous Rho subfamily coordination of apical membrane morphogenesis, lumen formation and of GTPases, of which there are 20 members in humans, including junction maturation. In parallel, work in yeast and Caenorhabditis elegans the RhoA and Rac GTPases, (Hall, 2012). Rho, Rac and Cdc42 has provided important clues as to how this molecular switch can homologues are found in all eukaryotes, except for plants, which do generate and regulate polarity through localized activation or inhibition, not have a clear homologue for Cdc42. Together, the function of and cytoskeleton regulation. Recent studies have revealed how Rho GTPases influences most, if not all, cellular processes. important and complex these regulations can be during epithelial In the early 1990s, seminal work from Alan Hall and his morphogenesis. This complexity is mirrored by the fact that Cdc42 can collaborators identified Rho, Rac and Cdc42 as main regulators of exert its function through many effector proteins.
    [Show full text]
  • Differentiation-Defective Phenotypes Revealed by Large-Scale Analyses of Human Pluripotent Stem Cells
    Differentiation-defective phenotypes revealed by large-scale analyses of human pluripotent stem cells Michiyo Koyanagi-Aoia,1, Mari Ohnukia,1, Kazutoshi Takahashia, Keisuke Okitaa, Hisashi Nomab, Yuka Sawamuraa, Ito Teramotoa, Megumi Naritaa, Yoshiko Satoa, Tomoko Ichisakaa, Naoki Amanoa, Akira Watanabea, Asuka Morizanea, Yasuhiro Yamadaa,c, Tosiya Satod, Jun Takahashia,e, and Shinya Yamanakaa,f,2 aCenter for iPS Cell Research and Application, eDepartment of Biological Repair, Institute for Frontier Medical Sciences, and cInstitute for Integrated Cell- Material Sciences, Kyoto University, Kyoto 606-8507, Japan; bDepartment of Data Science, The Institute of Statistical Mathematics, Tokyo 190-8562, Japan; dDepartment of Biostatistics, Kyoto University School of Public Health, Kyoto 606-8501, Japan; and fGladstone Institute of Cardiovascular Disease, San Francisco, CA 94158 Contributed by Shinya Yamanaka, October 30, 2013 (sent for review September 13, 2013) We examined the gene expression and DNA methylation of 49 at least three passages. In addition, we analyzed the original somatic human induced pluripotent stem cells (hiPSCs) and 10 human cells, two human embryonic carcinoma cell (hECC) lines (NTera2 embryonic stem cells and found overlapped variations in gene cloneD1 and 2102Ep 4D3), and three cancer cell lines (HepG2, expression and DNA methylation in the two types of human MCF7, and Jurkat). pluripotent stem cell lines. Comparisons of the in vitro neural The mRNA microarray analyses (Fig. 1A) identified 61 probes fi differentiation of 40 hiPSCs and 10 human embryonic stem cells with signi cant differences in expression between hESCs and < showed that seven hiPSC clones retained a significant number of hiPSCs [t test, false discovery rate (FDR) 0.05].
    [Show full text]
  • Datasheet Blank Template
    SAN TA C RUZ BI OTEC HNOL OG Y, INC . LRP3 (E-13): sc-109956 BACKGROUND APPLICATIONS Members of the LDL receptor gene family, including LDLR (low density lipo- LRP3 (E-13) is recommended for detection of All LRP3 isoforms 1-3 of mouse, protein receptor), LRP1 (low density lipoprotein related protein), Megalin rat and human origin by Western Blotting (starting dilution 1:200, dilution (also designated GP330), VLDLR (very low density lipoprotein receptor) and range 1:100-1:1000), immunofluorescence (starting dilution 1:50, dilution ApoER2 are characterized by a cluster of cysteine-rich class A repeats, epi - range 1:50-1:500) and solid phase ELISA (starting dilution 1:30, dilution dermal growth factor (EGF)-like repeats, YWTD repeats and an O-linked sugar range 1:30-1:3000); non cross-reactive with other LRP family members. domain. Low-density lipoprotein receptor-related protein 3 (LRP3) is a 770 LRP3 (E-13) is also recommended for detection of All LRP3 isoforms 1-3 in amino acid protein that contains two CUB domains and four LDL-receptor additional species, including equine, canine, bovine and porcine. class A domains. LRP3 is widely expressed with highest expression in skele - tal muscle and ovary and lowest expression in testis, colon and leukocytes. Suitable for use as control antibody for LRP3 siRNA (h): sc-97441, LRP3 LRP3 is potentially a membrane receptor involved in the internalization of siRNA (m): sc-149048, LRP3 shRNA Plasmid (h): sc-97441-SH, LRP3 shRNA lipophilic molecules and/or signal transduction. Plasmid (m): sc-149048-SH, LRP3 shRNA (h) Lentiviral Particles: sc-97441-V and LRP3 shRNA (m) Lentiviral Particles: sc-149048-V.
    [Show full text]
  • Propranolol-Mediated Attenuation of MMP-9 Excretion in Infants with Hemangiomas
    Supplementary Online Content Thaivalappil S, Bauman N, Saieg A, Movius E, Brown KJ, Preciado D. Propranolol-mediated attenuation of MMP-9 excretion in infants with hemangiomas. JAMA Otolaryngol Head Neck Surg. doi:10.1001/jamaoto.2013.4773 eTable. List of All of the Proteins Identified by Proteomics This supplementary material has been provided by the authors to give readers additional information about their work. © 2013 American Medical Association. All rights reserved. Downloaded From: https://jamanetwork.com/ on 10/01/2021 eTable. List of All of the Proteins Identified by Proteomics Protein Name Prop 12 mo/4 Pred 12 mo/4 Δ Prop to Pred mo mo Myeloperoxidase OS=Homo sapiens GN=MPO 26.00 143.00 ‐117.00 Lactotransferrin OS=Homo sapiens GN=LTF 114.00 205.50 ‐91.50 Matrix metalloproteinase‐9 OS=Homo sapiens GN=MMP9 5.00 36.00 ‐31.00 Neutrophil elastase OS=Homo sapiens GN=ELANE 24.00 48.00 ‐24.00 Bleomycin hydrolase OS=Homo sapiens GN=BLMH 3.00 25.00 ‐22.00 CAP7_HUMAN Azurocidin OS=Homo sapiens GN=AZU1 PE=1 SV=3 4.00 26.00 ‐22.00 S10A8_HUMAN Protein S100‐A8 OS=Homo sapiens GN=S100A8 PE=1 14.67 30.50 ‐15.83 SV=1 IL1F9_HUMAN Interleukin‐1 family member 9 OS=Homo sapiens 1.00 15.00 ‐14.00 GN=IL1F9 PE=1 SV=1 MUC5B_HUMAN Mucin‐5B OS=Homo sapiens GN=MUC5B PE=1 SV=3 2.00 14.00 ‐12.00 MUC4_HUMAN Mucin‐4 OS=Homo sapiens GN=MUC4 PE=1 SV=3 1.00 12.00 ‐11.00 HRG_HUMAN Histidine‐rich glycoprotein OS=Homo sapiens GN=HRG 1.00 12.00 ‐11.00 PE=1 SV=1 TKT_HUMAN Transketolase OS=Homo sapiens GN=TKT PE=1 SV=3 17.00 28.00 ‐11.00 CATG_HUMAN Cathepsin G OS=Homo
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Supplementary Materials
    1 Supplementary Materials: Supplemental Figure 1. Gene expression profiles of kidneys in the Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice. (A) A heat map of microarray data show the genes that significantly changed up to 2 fold compared between Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice (N=4 mice per group; p<0.05). Data show in log2 (sample/wild-type). 2 Supplemental Figure 2. Sting signaling is essential for immuno-phenotypes of the Fcgr2b-/-lupus mice. (A-C) Flow cytometry analysis of splenocytes isolated from wild-type, Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice at the age of 6-7 months (N= 13-14 per group). Data shown in the percentage of (A) CD4+ ICOS+ cells, (B) B220+ I-Ab+ cells and (C) CD138+ cells. Data show as mean ± SEM (*p < 0.05, **p<0.01 and ***p<0.001). 3 Supplemental Figure 3. Phenotypes of Sting activated dendritic cells. (A) Representative of western blot analysis from immunoprecipitation with Sting of Fcgr2b-/- mice (N= 4). The band was shown in STING protein of activated BMDC with DMXAA at 0, 3 and 6 hr. and phosphorylation of STING at Ser357. (B) Mass spectra of phosphorylation of STING at Ser357 of activated BMDC from Fcgr2b-/- mice after stimulated with DMXAA for 3 hour and followed by immunoprecipitation with STING. (C) Sting-activated BMDC were co-cultured with LYN inhibitor PP2 and analyzed by flow cytometry, which showed the mean fluorescence intensity (MFI) of IAb expressing DC (N = 3 mice per group). 4 Supplemental Table 1. Lists of up and down of regulated proteins Accession No.
    [Show full text]