Limiting Factors in ATP Synthesis
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Uncoupling Proteins: Functional Characteristics and Role in the Pathogenesis of Obesity and Type II Diabetes
Diabetologia 2001) 44: 946±965 Ó Springer-Verlag 2001 Uncoupling proteins: functional characteristics and role in the pathogenesis of obesity and Type II diabetes L. T.Dalgaard, O.Pedersen Steno Diabetes Center, Gentofte, Denmark Abstract obesity. The three uncoupling protein homologue genes UCP1, UCP2, and UCP3 have been investigat- Uncoupling proteins are mitochondrial carrier pro- ed for polymorphisms and mutations and their impact teins which are able to dissipate the proton gradient on Type II diabetes mellitus, obesity, and body weight of the inner mitochondrial membrane. This uncou- gain or BMI. The main conclusion is that variation in pling process reduces the amount of ATP generated the UCP1, UCP2 or UCP3 genes is not associated through an oxidation of fuels. The hypothesis that un- with major alterations of body weight gain. The con- coupling proteins UCPs) are candidate genes for hu- tribution of UCP genes towards polygenic obesity man obesity or Type II non-insulin-dependent) dia- and Type II diabetes is evaluated and discussed. [Dia- betes mellitus is based on the finding that a chemical betologia 2001) 44: 946±965] uncoupling of the mitochondrial membrane reduces body adiposity, and that lower metabolic rates predict Keywords Uncoupling proteins, Type II diabetes weight gain. It is straightforward to hypothesize that mellitus, obesity, genetics, body weight regulation, common polymorphisms of UCP1, UCP2 and UCP3 energy expenditure, metabolic rate, brown adipose genes lower metabolic rate by a more efficient energy tissue, white adipose tissue, reactive oxygen species, coupling in the mitochondria. Furthermore, geneti- polymorphism, mutation, transgenics, gene knock- cally engineered mice over expressing different UCP out. -
Nrg4 and Gpr120 Signalling in Brown Fat Anthony Chukunweike OKOLO
Nrg4 and Gpr120 Signalling in Brown Fat Anthony Chukunweike OKOLO Institute of Reproductive and Developmental Biology Department of Surgery and Cancer Faculty of Medicine Imperial College London A thesis submitted in fulfilment of the requirements for award of the degree of Doctor of Philosophy 1 Statement of Originality All experiments included in this thesis were performed by me unless otherwise stated in the text. 2 Copyright statement The copyright of this thesis rests with the author and is made available under a Creative Commons Attribution Non-Commercial No Directive Licence. Researchers are free to copy, distribute or transmit the thesis on the condition that they attribute it, and they do not use it for commercial purposes, and they do not alter, transform or build upon it. For any re-use or re-distribution, researchers must make clear to others the licence terms of this work. 3 Acknowledgments I would like to thank my supervisors Dr Aylin Hanyaloglu and Dr Mark Christian for giving me the great opportunity to work in their labs. Aylin put in a great deal of effort especially in area of Gpr120 signalling, including having to guide me through the critical imaging procedures. Aylin and Mark contributed a great deal towards the final edition of this thesis. I would also like to thank Dr Mark Christian for bringing me to Imperial College London to start off my PhD in his laboratory, and for being a great mentor and a continuous source of knowledge for me. I am grateful for your enduring patience in trying to bring out the best in me and ensuring that I develop the ‘critical thinking’ that is needed as a scientist. -
Multivariate Analysis Reveals Genetic Associations of the Resting Default
Multivariate analysis reveals genetic associations of PNAS PLUS the resting default mode network in psychotic bipolar disorder and schizophrenia Shashwath A. Medaa,1, Gualberto Ruañob,c, Andreas Windemuthb, Kasey O’Neila, Clifton Berwisea, Sabra M. Dunna, Leah E. Boccaccioa, Balaji Narayanana, Mohan Kocherlab, Emma Sprootena, Matcheri S. Keshavand, Carol A. Tammingae, John A. Sweeneye, Brett A. Clementzf, Vince D. Calhoung,h,i, and Godfrey D. Pearlsona,h,j aOlin Neuropsychiatry Research Center, Institute of Living at Hartford Hospital, Hartford, CT 06102; bGenomas Inc., Hartford, CT 06102; cGenetics Research Center, Hartford Hospital, Hartford, CT 06102; dDepartment of Psychiatry, Beth Israel Deaconess Hospital, Harvard Medical School, Boston, MA 02215; eDepartment of Psychiatry, University of Texas Southwestern Medical Center, Dallas, TX 75390; fDepartment of Psychology, University of Georgia, Athens, GA 30602; gThe Mind Research Network, Albuquerque, NM 87106; Departments of hPsychiatry and jNeurobiology, Yale University, New Haven, CT 06520; and iDepartment of Electrical and Computer Engineering, The University of New Mexico, Albuquerque, NM 87106 Edited by Robert Desimone, Massachusetts Institute of Technology, Cambridge, MA, and approved April 4, 2014 (received for review July 15, 2013) The brain’s default mode network (DMN) is highly heritable and is Although risk for psychotic illnesses is driven in small part by compromised in a variety of psychiatric disorders. However, ge- highly penetrant, often private mutations such as copy number netic control over the DMN in schizophrenia (SZ) and psychotic variants, substantial risk also is likely conferred by multiple genes bipolar disorder (PBP) is largely unknown. Study subjects (n = of small effect sizes interacting together (7). According to the 1,305) underwent a resting-state functional MRI scan and were “common disease common variant” (CDCV) model, one would analyzed by a two-stage approach. -
Perspectives in Diabetes Uncoupling Proteins 2 and 3 Potential Regulators of Mitochondrial Energy Metabolism Olivier Boss, Thilo Hagen, and Bradford B
Perspectives in Diabetes Uncoupling Proteins 2 and 3 Potential Regulators of Mitochondrial Energy Metabolism Olivier Boss, Thilo Hagen, and Bradford B. Lowell Mitochondria use energy derived from fuel combustion fuels and oxygen are converted into carbon dioxide, water, to create a proton electrochemical gradient across the and ATP (Fig. 1). The key challenge for the organism is to reg- mitochondrial inner membrane. This intermediate form ulate these many steps so that rates of ATP production are of energy is then used by ATP synthase to synthesize equal to rates of ATP utilization. This is not a small task given AT P. Uncoupling protein-1 (UCP1) is a brown fat–spe- that rates of ATP utilization can quickly increase severalfold cific mitochondrial inner membrane protein with proton (up to 100-fold in muscle during contraction). transport activity. UCP1 catalyzes a highly regulated proton leak, converting energy stored within the mito- Fuel metabolism and oxidative phosphorylation consist chondrial proton electrochemical potential gradient to of many tightly coupled enzymatic reactions (Fig. 1), which heat. This uncouples fuel oxidation from conversion of are regulated, in part, by ADP availability. Control by ADP is ADP to AT P. In rodents, UCP1 activity and brown fat accounted for by the chemiosmotic hypothesis of Mitchell (1). contribute importantly to whole-body energy expendi- Oxidation of fuels via the electron transport chain generates ture. Recently, two additional mitochondrial carriers a proton electrochemical potential gradient ( µH+) across with high similarity to UCP1 were molecularly cloned. the mitochondrial inner membrane. Protons reenter the In contrast to UCP1, UCP2 is expressed widely, and mitochondrial matrix via ATP synthase (F0F1-A TPase) in a UCP3 is expressed preferentially in skeletal muscle. -
ATPAF2 CRISPR/Cas9 KO Plasmid (M): Sc-434234
SANTA CRUZ BIOTECHNOLOGY, INC. ATPAF2 CRISPR/Cas9 KO Plasmid (m): sc-434234 BACKGROUND APPLICATIONS The Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and ATPAF2 CRISPR/Cas9 KO Plasmid (m) is recommended for the disruption of CRISPR-associated protein (Cas9) system is an adaptive immune response gene expression in mouse cells. defense mechanism used by archea and bacteria for the degradation of foreign genetic material (4,6). This mechanism can be repurposed for other 20 nt non-coding RNA sequence: guides Cas9 functions, including genomic engineering for mammalian systems, such as to a specific target location in the genomic DNA gene knockout (KO) (1,2,3,5). CRISPR/Cas9 KO Plasmid products enable the U6 promoter: drives gRNA scaffold: helps Cas9 identification and cleavage of specific genes by utilizing guide RNA (gRNA) expression of gRNA bind to target DNA sequences derived from the Genome-scale CRISPR Knock-Out (GeCKO) v2 library developed in the Zhang Laboratory at the Broad Institute (3,5). Termination signal Green Fluorescent Protein: to visually REFERENCES verify transfection CRISPR/Cas9 Knockout Plasmid CBh (chicken β-Actin 1. Cong, L., et al. 2013. Multiplex genome engineering using CRISPR/Cas hybrid) promoter: drives expression of Cas9 systems. Science. 339: 819-823. 2A peptide: allows production of both Cas9 and GFP from the 2. Mali, P., et al. 2013. RNA-guided human genome engineering via Cas9. same CBh promoter Science 339: 823-826. Nuclear localization signal 3. Ran, F.A., et al. 2013. Genome engineering using the CRISPR-Cas9 system. Nuclear localization signal SpCas9 ribonuclease Nat. Protoc. 8: 2281-2308. -
Irisin As a Multifunctional Protein: Implications for Health and Certain Diseases
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Jagiellonian Univeristy Repository medicina Review Irisin as a Multifunctional Protein: Implications for Health and Certain Diseases Paulina Korta 1 , Ewa Poche´c 1,* and Agnieszka Mazur-Biały 2 1 Department of Glycoconjugate Biochemistry, Institute of Zoology and Biomedical Research, Faculty of Biology, Jagiellonian University, Gronostajowa 9, 30-387 Krakow, Poland 2 Department of Ergonomics and Exercise Physiology, Faculty of Health Sciences, Jagiellonian University, Medical College, Grzegorzecka 20, 31-531 Krakow, Poland * Correspondence: [email protected]; Tel.: +48-12-664-64-67 Received: 29 June 2019; Accepted: 12 August 2019; Published: 15 August 2019 Abstract: Sedentary life style is considered to be an independent risk factor for many disorders, including development of type 2 diabetes, obesity, immune dysfunction, asthma, and neurological or coronary heart disease. Irisin is released from myocytes during physical activity, and acts as a link between muscles and other tissues and organs. This myokine is produced as a result of proteolytic cleavage of FNDC5 protein present in the membrane of myocytes. Secretion of irisin is regulated by N-linked oligosaccharides attached to the protein molecule. The two N-glycan molecules, which constitute a significant part of the irisin glycoprotein, regulate the browning of adipocytes, which is the most important function of irisin. A receptor specific for irisin has still not been discovered. In some tissues irisin probably acts via integrins, which are widely expressed transmembrane receptors. Many studies have confirmed the multifunctional role of irisin and the beneficial effects of this molecule on body homeostasis. -
Anti-ATPAF2 (Aa 159-289) Polyclonal Antibody (DPABH-12101) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Anti-ATPAF2 (aa 159-289) polyclonal antibody (DPABH-12101) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description ATPAF2 belongs to the ATP12 family. It may play a role in the assembly of the F1 component of the mitochondrial ATP synthase (ATPase). Defects in ATPAF2 are the cause of complex V mitochondrial respiratory chain ATPAF2 subunit deficiency (ATPAF2 deficiency) [MIM:604273]; also called ATP synthase deficiency or ATPase deficiency. ATPAF2 deficiency seems to be an early presenting disease in which lactic acidosis, dysmorphic features, and methyl glutaconic aciduria can be major clues in the diagnosis. Dysmorphic features include a large mouth, prominent nasal bridge, micrognathia, rocker-bottom feet and flexion contractures of the limbs associated with camptodactyly. Patients are hypertonic and have an enlarged liver, hypoplastic kidneys and elevated lactate levels in urine, plasma and cerebro spinal fluid (CSF). Immunogen Recombinant fragment corresponding to Human ATPAF2 aa 159-289 (C terminal). (BC004114).Sequence: DPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYNTWALQGIE FVAAQLKSMVLTLGLIDLRLTVEQAVLLSRLEEEYQIQKWGNIEWAHDYE LQELRARTAAGTLFIHLCSESTTVKHKLLKE Database link: Q8N5M1 Isotype IgG Source/Host Rabbit Species Reactivity Human Purification Immunogen affinity purified Conjugate Unconjugated Applications WB, IHC-P Format Liquid Size 100 μg Buffer pH: 7.20; Constituents: 98% PBS, 1% BSA Preservative 0.02% Sodium Azide Storage Shipped at 4°C. Store at 4°C short term (1-2 -
Exclusive Occurrence of Thermogenin Antigen in Brown Adipose Tissue
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Volume 150, number 1 FEBS LETTERS December 1982 Exclusive occurrence of thermogenin antigen in brown adipose tissue Barbara Cannon, Anders Hedin* and Jan Nedergaard Departments of Metabolic Research and *Immunology, The Wenner-Gren Institute, University of Stockholm, Norrtullsgatan 16, 113 45 Stockholm, Sweden Received 25 October 1982 Thermogenin is the purine-nucleotide binding polypeptide in brown adipose tissue mitochondria (Mr 32000) which confers upon these mitochondria the ability to produce heat. An enzyme-linked immunosorbent assay (ELISA) has been developed to demonstrate and quantitate the occurrence of thermogenin antigen in small amounts of tissue, and thus to characterize different depots of fat tissue as white or brown. The extreme sensitivity of the method allows determination of thermogenin in samples equivalent to < 1 mg tissue. The results indicate that thermogenin seems to be exclusively localised in brown fat mitochondria (as compared to white fat, liver or heart muscle mitochondria), and thermogenin antigen could only be found in brown adipocytes (as compared to white adipocytes). Thus, brown and white adipose tissue are probably ontogenetically different Brown adipose tissue ELISA Mitochondria Nonshivering thermogenesis Thermogenin White adipose tissue 1. INTRODUCTION form of white adipose tissue, or whether it should be considered as a bona fide organ in itself, with its The demonstration that the thermogenic func- own ontogeny [lo]. tion of brown adipose tissue is directly related to The present interest in the connection between the presence in the mitochondria of a specific poly- the activity of brown adipose tissue and the ten- peptide - thermogenin - with a subunit A4, 32000 dency to evolve obesity in animals and man (review has made it possible to study thermogenesis at the [l 11) has made it necessary to be able to charac- molecular level [1,2], (reviews [3-51). -
The Uncoupling Protein Homologues: UCP1, UCP2, UCP3, Stucp
Biochem. J. (2000) 345, 161–179 (Printed in Great Britain) 161 REVIEW ARTICLE The uncoupling protein homologues: UCP1, UCP2, UCP3, StUCP and AtUCP Daniel RICQUIER1 and Fre! de! ric BOUILLAUD Centre de Recherche sur l’Endocrinologie Mole! culaire et le De! veloppement (CEREMOD), Centre National de la recherche Scientifique (CNRS – Unit 9078), 9 rue Jules Hetzel, 92190 Meudon, France Animal and plant uncoupling protein (UCP) homologues form a energy expenditure in humans. The UCPs may also be involved subfamily of mitochondrial carriers that are evolutionarily re- in adaptation of cellular metabolism to an excessive supply of lated and possibly derived from a proton}anion transporter substrates in order to regulate the ATP level, the NAD+}NADH ancestor. The brown adipose tissue (BAT) UCP1 has a marked ratio and various metabolic pathways, and to contain superoxide and strongly regulated uncoupling activity, essential to the production. A major goal will be the analysis of mice that either maintenance of body temperature in small mammals. UCP lack the UCP2 or UCP3 gene or overexpress these genes. Other homologues identified in plants are induced in a cold environment aims will be to investigate the possible roles of UCP2 and UCP3 and may be involved in resistance to chilling. The biochemical in response to oxidative stress, lipid peroxidation, inflammatory activities and biological functions of the recently identified processes, fever and regulation of temperature in certain specific mammalian UCP2 and UCP3 are not well known. However, parts of the body. recent data support a role for these UCPs in State 4 respiration, respiration uncoupling and proton leaks in mitochondria. -
Energy Flow and Metabolic Efficiency Attributed to Brown Adipose Tissue
DWWULEXWHGWR ! ! " # $% &' ()*' ) % " $ + &,$( - + "$ . ,$" $ ! &/!() + ) ) $ 0 "/ ,$"1 + ) + /!) " 2 )2 ,$ "$ + /! " ,$ +) " 3 "4 ) /! /! - ) + + ) "$ /! "$ ) /! "1 + ) " ! ! 566 "" 6 7 8 55 5 5 !9 !: 2,*:;:!<9:=9 2,*:;:!<9:=> !"# )! <:! DOCTORAL THESIS Energy flow and metabolic efficiency attributed to brown adipose tissue Gabriella von Essen Energy flow and metabolic efficiency attributed to brown adipose tissue Gabriella von Essen The present thesis is based on the following enclosed papers: Paper I Adaptive Facultative Diet-induced Thermogenesis in Wild-type but not in UCP1-ablated Mice Gabriella von Essen, Erik Lindsund, Barbara Cannon and Jan Nedergaard Submitted for publication Paper II Highly recruited brown adipose tissue does not in itself protect against obesity Gabriella von Essen, Elaina Maldonado, Erik Lindsund, Barbara Cannon and Jan Nedergaard Under revision for Cell Metabolism Paper III At thermoneutrality, medium-chain fatty acids totally protect against diet-induced obesity in a UCP1-independent manner Gabriella von Essen, Petter Englund, Barbara Cannon and Jan Nedergaard Submitted for publication Paper IV No insulating -
Mitochondrial Uncoupling Proteins in the Central Nervous System Jeong Sook Kim-Han Washington University School of Medicine in St
Washington University School of Medicine Digital Commons@Becker Open Access Publications 2005 Mitochondrial uncoupling proteins in the central nervous system Jeong Sook Kim-Han Washington University School of Medicine in St. Louis Laura L. Dugan Washington University School of Medicine in St. Louis Follow this and additional works at: https://digitalcommons.wustl.edu/open_access_pubs Recommended Citation Kim-Han, Jeong Sook and Dugan, Laura L., ,"Mitochondrial uncoupling proteins in the central nervous system." Antioxidants & Redox Signaling.7,9-10. 1173-1181. (2005). https://digitalcommons.wustl.edu/open_access_pubs/3159 This Open Access Publication is brought to you for free and open access by Digital Commons@Becker. It has been accepted for inclusion in Open Access Publications by an authorized administrator of Digital Commons@Becker. For more information, please contact [email protected]. 14024C09.pgs 8/11/05 10:32 AM Page 1173 ANTIOXIDANTS & REDOX SIGNALING Volume 7, Numbers 9 & 10, 2005 © Mary Ann Liebert, Inc. Forum Review Mitochondrial Uncoupling Proteins in the Central Nervous System JEONG SOOK KIM-HAN1 and LAURA L. DUGAN1,2,3 ABSTRACT Mitochondrial uncoupling proteins (UCPs), a subfamily of the mitochondrial transporter family, are related by sequence homology to UCP1. This protein, which is located in the inner mitochondrial membrane, dissi- pates the proton gradient between the intermembrane space and the mitochondrial matrix to uncouple elec- tron transport from ATP synthesis. UCP1 (thermogenin) was first discovered in brown adipose tissue and is responsible for non-shivering thermogenesis. Expression of mRNA for three other UCP isoforms, UCP2, UCP4, and BMCP1/UCP5, has been found at high levels in brain. -
Beta 3 Adrenergic Receptors: Molecular, Histological, Functional and Pharmacological Approaches
Romanian Journal of Morphology and Embryology 2009, 50(2):169–179 REVIEW Beta 3 adrenergic receptors: molecular, histological, functional and pharmacological approaches OANA ANDREIA COMAN1), H. PĂUNESCU1), ISABEL GHIŢĂ1), L. COMAN2), ANCA BĂDĂRĂRU2), I. FULGA1) 1)Department of Pharmacology and Pharmacotherapy 2)Department of Physiology Faculty of Medicine, “Carol Davila” University of Medicine and Pharmacy, Bucharest Abstract Different classes of receptors mediate norepinephrine and epinephrine effects, one of the most recently discovered being the beta 3 adrenergic ones. The paper has proposed itself to present the history of the discovery of beta 3 adrenergic receptors, different techniques for their identification, their structure, localization, genetic data and also the mechanism of regulation of their functions. It also contains an exhaustive approach regarding the histological localization and functions of beta 3 adrenergic receptors in different apparatus and systems, making evident their effect on glucidic, lipidic and energetic metabolism. The substances that influence beta 3 adrenergic receptors activities, especially the agonists, have been studied regarding their practical applications in the treatment of diabetes mellitus and of the disturbances of lipid metabolism. Keywords: beta 3 adrenergic receptors, discovery, histology, molecular biology, physiology, pharmacology. Discovery of beta 3 adrenergic receptors Methods of identification and characterization of adrenergic A class of membrane proteins called adrenergic receptors mediates the multiple metabolic and receptors’ structure and localization neuroendocrine effects of epinephrine and Adrenergic receptors are membranous proteins. norepinephrine. These receptors are coupled with G The discovery of the genes that encode membranous proteins, which in turn interact with intracellular proteins was made by identifying some nucleotide effectors (secondary messengers) such as adenylyl sequences in the structure of these genes, which cyclase or phospholipase C.