DOCSLIB.ORG

Characterizing Genomic Duplication in Autism Spectrum Disorder by Edward James Higginbotham a Thesis Submitted in Conformity

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Characterizing Genomic Duplication in Autism Spectrum Disorder by Edward James Higginbotham a Thesis Submitted in Conformity Characterizing Genomic Duplication in Autism Spectrum Disorder by Edward James Higginbotham A thesis submitted in conformity with the requirements for the degree of Master of Science Graduate Department of Molecular Genetics University of Toronto © Copyright by Edward James Higginbotham 2020 i Abstract Characterizing Genomic Duplication in Autism Spectrum Disorder Edward James Higginbotham Master of Science Graduate Department of Molecular Genetics University of Toronto 2020 Duplication, the gain of additional copies of genomic material relative to its ancestral diploid state is yet to achieve full appreciation for its role in human traits and disease. Challenges include accurately genotyping, annotating, and characterizing the properties of duplications, and resolving duplication mechanisms. Whole genome sequencing, in principle, should enable accurate detection of duplications in a single experiment. This thesis makes use of the technology to catalogue disease relevant duplications in the genomes of 2,739 individuals with Autism Spectrum Disorder (ASD) who enrolled in the Autism Speaks MSSNG Project. Fine-mapping the breakpoint junctions of 259 ASD-relevant duplications identified 34 (13.1%) variants with complex genomic structures as well as tandem (193/259, 74.5%) and NAHR- mediated (6/259, 2.3%) duplications. As whole genome sequencing-based studies expand in scale and reach, a continued focus on generating high-quality, standardized duplication data will be prerequisite to addressing their associated biological mechanisms. ii Acknowledgements I thank Dr. Stephen Scherer for his leadership par excellence, his generosity, and for giving me a chance. I am grateful for his investment and the opportunities afforded me, from which I have learned and benefited. I would next thank Drs. Brett Trost, Susan Walker, and Mehdi Zarrei for their considerate guidance and contributions made towards my training. A person could do far worse for friends and mentors. Drs. Fritz Roth and Mikko Taipale are role models and they have been gracious and good-humoured. Ada Chan, Lia D’Abate, and Charlotte Nguyen are good, kind friends and I am fortunate to have worked alongside all three. I give my thanks to Beverly Apresto, Dr. Lisa Bradley, Dr. Janet Buchanan, Elaine Chang, Wilson Chung, Dr. Bank Engchuan, Dr. Muhammed Faheem, Joanne Herbrick, Jen Howe, Barbara Kellam, Sylvia Lamoureux, Timothy Lau, Dr. Hin Lee, Dr. Si Lok, Miranda Lorenti, Patricia Lu, Jeff MacDonald, Dr. Roozbeh Manshaei, Dr. Christian Marshall, Dr. Karin Miron, Rohan Patel, Dr. Andrew Paterson, Dr. Tara Paton, Dr. Giovanna Pellecchia, Dr. Sergio Pereira, MyLinh Pham, Sanjeev Pullenayegum, Dr. Miriam Reuter, Dr. Marsha Speevak, Dr. James Stavropoulos, Bhooma Thiruvahindrapuram, Dr. Zhouzhi Wang, Dr. John Wei, Joseph Whitney, Dr. Richard Wintle, and Dr. Ryan Yuen. All have been generous with their time and help. I thank Dr. Bridget Fernandez who provided valuable phenotype information. And to Jingle Candelario-MacDonald, Guillermo Casallo, Emily Cornelius, and Marnita Manalo for the hard work they have contributed to my thesis. I last thank Dr. Eve J. Higginbotham, MS, MD, for her kind words at the outset of my MSc. Our chance encounter is most appreciated, and a reminder that every tree is a good tree. Finally, I am grateful to my parents, Ted and Louise, to each of my forebears, and to my spiritually-closest of their descendants: Dr. Stewart Higginbotham, DVM, Dr. Alexa Higginbotham, Charlotte Higginbotham, Nathaniel Rose, Sarah Rose, the lovely Nora York, and the Edwards family of Winnipeg, Manitoba. I love you all. iii Contents Abstract ii Acknowledgements iii List of Tables vi List of Figures vii List of Appendices vii List of Abbreviations ix 1 Introduction 1 1.1 Duplications in human evolution and disease 1 1.2 Complex duplications in human disease 12 1.3 Mechanisms of CNV formation 13 1.4 Autism Spectrum Disorder 16 1.5.1 The genetics of Autism Spectrum Disorder 18 1.5.2 Rare variation contributes significantly to ASD risk 20 1.6 The impact of CNVs on gene expression 23 1.7 Project rationale 24 2 Methods 25 2.1 Study subjects 25 2.2 CNV detection from WGS data 25 2.3 ASD gene lists 26 2.4 Characterization of duplication structures 26 2.5 Annotation of breakpoint sequences 28 2.6 Validation of predicted breakpoint junctions 28 2.7 Lymphoblastoid cell-line culture 28 2.8 Targeted gene expression analysis 29 iv 2.9 PCR-based validation of a SUPT16H-CHD8 fusion transcript 29 3 Results 33 Chapter 1 33 3.1 Cataloging complex duplication in the human genome 37 3.1.1 Characteristics of genome-wide complex duplications 37 3.1.2 Interchromosomal dispersed duplications 42 3.1.3 The functional impact of complex duplications 43 3.1.4 Transmission patterns of complex duplications 47 3.1.5 Properties of genome-wide control duplications with complex structures 50 3.1.6 The mechanistic impact of ASD-relevant duplications 52 3.1.7 Breakpoint context and mechanisms of CNV formation 60 Chapter 2 65 3.2.1 Functional characterization of five ASD-relevant duplications 67 3.2.2 Characterization of a SUPT16H-CHD8 fusion transcript 78 4 Discussion 82 4.1 Functional analysis of gene expression 82 4.2 CNV detection from WGS 84 5 Future Directions and Impact 85 5.1 Duplication mechanism/applicability to other disease 85 5.2 Data access and accessibility 86 5.3 Limitations 88 6 Appendix 90 7 Bibliography 135 v List of Tables Table 1: Examples of triplosensitive genes in human disease 2 Table 2: Functional mechanisms of select exonic duplications in human disease 5 Table 3: Examples of disease-associated duplications that result in position effect 8 Table 4: Examples of disease-associated duplications as founder mutations 9 Table 5: Primer sequences used for breakpoint junction assays 30 Table 6: Standard PCR protocol for breakpoint junction validation 31 Table 7: TaqMan assays used in targeted gene expression profiling 32 Table 8: Subjects harbouring known ASD-relevant CNVs 34 Table 9: Size distribution of ASD-relevant duplications 35 Table 10: Characteristics of complex rearrangements identified at ASD relevant loci 36 Table 11: Complex duplications impacting ASD-relevant genes 39 Table 12: The impact of ASD-relevant duplications on gene structure 53 Table 13: Tandem duplications identified at highly-penetrant ASD risk loci 57 Table 14: Sequence context of breakpoint sequences 62 Table 15: The mutational mechanisms of complex duplications 63 Table 16: Mechanisms of formation inferred from ASD-relevant tandem and NAHR-mediated duplication breakpoints 64 Table 17: Summary of associated gene expression changes in duplication carriers 71 Table 18: Genes impacted by candidate duplications 72 vi List of Figures Figure 1: Recombination-based and replication-based mechanisms of CNV formation 14 Figure 2: Characterization of structural variants using paired-end read sequencing 27 Figure 3: Transmission patterns of complex duplications identified in SPX and MPX ASD families 48 Figure 4: Duplication breakpoint junctions validated by PCR-based assays and Sanger sequencing 66 Figure 5: Gene expression alterations associated with duplications at 7q36.1, 16p13.3 and 19q13.32 68 Figure 6: Gene expression alterations associated with a 2.85 Mb duplication at 4q25 77 Figure 7: Characterization of a novel SUPT16H-CHD8 fusion gene 79 vii List of Appendices Appendix 1: List of known ASD-relevant CNVs 90 Appendix 2: Complex duplications impacting ASD-relevant genes 124 Appendix 3: Families segregating complex ASD-relevant duplications 128 Appendix 4: Families harboring tandem duplications identified at ASD risk loci 131 viii List of Abbreviations A-EJ Alternative end-joining ABA Applied behavioural analysis ADHD Attention-deficit hyperactivity disorder ADI-R Autism Diagnosis Interview-Revised ADOS Autism Diagnostic Observation Schedule AR Autosomal recessive ASD Autism spectrum disorder BAM Binary alignment map BIR Break-induced replication BP Bipolar disorder CAM Cell adhesion molecule CD Conduct disorder CF Cystic fibrosis CMA Chromosomal microarray analysis CNV Copy number variation DD Developmental delay ddPCR Droplet digital polymerase chain reaction DSM Diagnostic and Statistical Manual of Mental Disorders EGF Epidermal growth factor FoSTeS Fork-stalling and template switching GalNAcT UDP-N-acetyl-alpha-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase GEF Guanine nucleotide exchange factor IBS Irritable bowel syndrome ID Intellectual disability IGV Integrative Genomics Viewer LCL Lymphoblastoid cell line LCR Low-copy repeat LD Learning disability LINE Long interspersed element LTR Long terminal repeat MCA Multiple congenital anomalies MMBIR Microhomology-mediated break-induced replication MPX Multiplex / multiple incidence family MRI Magnetic resonance imaging NAHR Non-allelic homologous recombination NDD Neurodevelopmental disorder NHEJ Nonhomologous end-joining OCD Obsessive-compulsive disorder ODD Oppositional defiant disorder PCR Polymerase chain reaction PDD-NOS Pervasive developmental disorder not otherwise specified PSD Postsynaptic density qPCR Quantitative polymerase chain reaction ix RLCR Repetitive and low-complexity region RTK Receptor tyrosine kinase SCZ Schizophrenia SDR Short-chain dehydrogenase/reductase SINE Short interspersed element SNP Single nucleotide polymorphism SNV Single nucleotide variant SPX Simplex / single incidence family ssDNA Single-stranded DNA SV Structural variation TCAG The Centre for Applied Genomics TF Transcription factor WES Whole exome sequencing WGS Whole
Load more

Recommended publications
  • ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic
    ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic Aberrations in Canine Osteosarcoma and Their Resemblance to the Human Counterpart. (Under the direction of Dr. Matthew Breen). In the last decade the domestic dog has emerged as an ideal biomedical model of complex genetic diseases such as cancers. Cancer in the dog occurs spontaneously and several studies have concluded that human and canine cancers have similar characteristics such as presentation of disease, rate of metastases, genetic dysregulation, and survival rates. Furthermore, in the genomic era the dog genome was found more homologous in sequence conservation to humans than mice, making it a valuable model organism for genetic study in addition to pathophysiological analysis. Osteosarcoma (OS), the most commonly diagnosed malignant bone tumor in humans and dogs, is one such cancer that would benefit from comparative genomic analysis. In humans, OS is a rare cancer diagnosed in fewer than 1,000 people per year in the USA, while in the domestic dog population the annual number of new cases is estimated to far exceed 10,000. This high rate of disease occurrence in dogs provides a unique opportunity to study the genomic imbalances in canine OS and their translational value to human OS as a means to identify important alterations involved in disease etiology. OS in humans is characterized by extremely complex karyotypes which contain both structural changes (translocations and/or rearrangements) and DNA copy number changes. Metaphase and array comparative genomic hybridization (aCGH) has assisted in uncovering the genetic imbalances that are associated with human OS phenotype. In dog OS, previous low-resolution (10-20Mb) aCGH analysis identified a wide range of recurrent copy number aberrations (CNAs), indicative of a similar level of genomic instability to human OS.
    [Show full text]
  • Blueprint Genetics ANOS1 Single Gene Test
    ANOS1 single gene test Test code: S00125 Phenotype information Kallmann syndrome Alternative gene names KALIG-1, WFDC19 Some regions of the gene are duplicated in the genome leading to limited sensitivity within the regions. Thus, low-quality variants are filtered out from the duplicated regions and only high-quality variants confirmed by other methods are reported out. Read more. Panels that include the ANOS1 gene Kallmann Syndrome Panel Abnormal Genitalia/ Disorders of Sex Development Panel Test Strengths The strengths of this test include: CAP accredited laboratory CLIA-certified personnel performing clinical testing in a CLIA-certified laboratory Powerful sequencing technologies, advanced target enrichment methods and precision bioinformatics pipelines ensure superior analytical performance Careful construction of clinically effective and scientifically justified gene panels Our Nucleus online portal providing transparent and easy access to quality and performance data at the patient level Our publicly available analytic validation demonstrating complete details of test performance ~2,000 non-coding disease causing variants in our clinical grade NGS assay for panels (please see ‘Non-coding disease causing variants covered by this test’) Our rigorous variant classification scheme Our systematic clinical interpretation workflow using proprietary software enabling accurate and traceable processing of NGS data Our comprehensive clinical statements Test Limitations This test does not detect the following: Complex inversions Gene conversions
    [Show full text]
  • PRODUCT SPECIFICATION Anti-C12orf43
    Anti-C12orf43 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C12orf43 Product Number HPA046148 Gene Description chromosome 12 open reading frame 43 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEF RAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGG REKEESPQPR Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:50 - 1:200 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA046148 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions.
    [Show full text]
  • Funktionelle in Vitro Und in Vivo Charakterisierung Des Putativen Tumorsuppressorgens SFRP1 Im Humanen Mammakarzinom
    Funktionelle in vitro und in vivo Charakterisierung des putativen Tumorsuppressorgens SFRP1 im humanen Mammakarzinom Von der Fakult¨at fur¨ Mathematik, Informatik und Naturwissenschaften der RWTH Aachen University zur Erlangung des akademischen Grades einer Doktorin der Naturwissenschaften genehmigte Dissertation vorgelegt von Diplom-Biologin Laura Huth (geb. Franken) aus Julich¨ Berichter: Universit¨atsprofessor Dr. rer. nat. Edgar Dahl Universit¨atsprofessor Dr. rer. nat. Ralph Panstruga Tag der mundlichen¨ Prufung:¨ 6. August 2014 Diese Dissertation ist auf den Internetseiten der Hochschulbibliothek online verfugbar.¨ Zusammenfassung Krebserkrankungen stellen weltweit eine der h¨aufigsten Todesursachen dar. Aus diesem Grund ist die Aufkl¨arung der zugrunde liegenden Mechanismen und Ur- sachen ein essentielles Ziel der molekularen Onkologie. Die Tumorforschung der letzten Jahre hat gezeigt, dass die Entstehung solider Karzinome ein Mehrstufen- Prozess ist, bei dem neben Onkogenen auch Tumorsuppresorgene eine entschei- dende Rolle spielen. Viele der heute bekannten Gene des WNT-Signalweges wur- den bereits als Onkogene oder Tumorsuppressorgene charakterisiert. Eine Dere- gulation des WNT-Signalweges wird daher mit der Entstehung und Progression vieler humaner Tumorentit¨aten wie beispielsweise auch dem Mammakarzinom, der weltweit h¨aufigsten Krebserkrankung der Frau, assoziiert. SFRP1, ein nega- tiver Regulator der WNT-Signalkaskade, wird in Brusttumoren haupts¨achlich durch den epigenetischen Mechanismus der Promotorhypermethylierung
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Protein Identities in Evs Isolated from U87-MG GBM Cells As Determined by NG LC-MS/MS
    Protein identities in EVs isolated from U87-MG GBM cells as determined by NG LC-MS/MS. No. Accession Description Σ Coverage Σ# Proteins Σ# Unique Peptides Σ# Peptides Σ# PSMs # AAs MW [kDa] calc. pI 1 A8MS94 Putative golgin subfamily A member 2-like protein 5 OS=Homo sapiens PE=5 SV=2 - [GG2L5_HUMAN] 100 1 1 7 88 110 12,03704523 5,681152344 2 P60660 Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 - [MYL6_HUMAN] 100 3 5 17 173 151 16,91913397 4,652832031 3 Q6ZYL4 General transcription factor IIH subunit 5 OS=Homo sapiens GN=GTF2H5 PE=1 SV=1 - [TF2H5_HUMAN] 98,59 1 1 4 13 71 8,048185945 4,652832031 4 P60709 Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 - [ACTB_HUMAN] 97,6 5 5 35 917 375 41,70973209 5,478027344 5 P13489 Ribonuclease inhibitor OS=Homo sapiens GN=RNH1 PE=1 SV=2 - [RINI_HUMAN] 96,75 1 12 37 173 461 49,94108966 4,817871094 6 P09382 Galectin-1 OS=Homo sapiens GN=LGALS1 PE=1 SV=2 - [LEG1_HUMAN] 96,3 1 7 14 283 135 14,70620005 5,503417969 7 P60174 Triosephosphate isomerase OS=Homo sapiens GN=TPI1 PE=1 SV=3 - [TPIS_HUMAN] 95,1 3 16 25 375 286 30,77169764 5,922363281 8 P04406 Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 - [G3P_HUMAN] 94,63 2 13 31 509 335 36,03039959 8,455566406 9 Q15185 Prostaglandin E synthase 3 OS=Homo sapiens GN=PTGES3 PE=1 SV=1 - [TEBP_HUMAN] 93,13 1 5 12 74 160 18,68541938 4,538574219 10 P09417 Dihydropteridine reductase OS=Homo sapiens GN=QDPR PE=1 SV=2 - [DHPR_HUMAN] 93,03 1 1 17 69 244 25,77302971 7,371582031 11 P01911 HLA class II histocompatibility antigen,
    [Show full text]
  • Novel Mutations in ANOS1 and FGFR1 Genes Agnieszka Gach1* , Iwona Pinkier1, Maria Szarras-Czapnik2, Agata Sakowicz3 and Lucjusz Jakubowski1
    Gach et al. Reproductive Biology and Endocrinology (2020) 18:8 https://doi.org/10.1186/s12958-020-0568-6 RESEARCH Open Access Expanding the mutational spectrum of monogenic hypogonadotropic hypogonadism: novel mutations in ANOS1 and FGFR1 genes Agnieszka Gach1* , Iwona Pinkier1, Maria Szarras-Czapnik2, Agata Sakowicz3 and Lucjusz Jakubowski1 Abstract Background: Congenital hypogonadotropic hypogonadism (CHH) is a rare disease, triggered by defective GnRH secretion, that is usually diagnosed in late adolescence or early adulthood due to the lack of spontaneous pubertal development. To date more than 30 genes have been associated with CHH pathogenesis with X-linked recessive, autosomal dominant, autosomal recessive and oligogenic modes of inheritance. Defective sense of smell is present in about 50–60% of CHH patients and called Kallmann syndrome (KS), in contrast to patients with normal sense of smell referred to as normosmic CHH. ANOS1 and FGFR1 genes are all well established in the pathogenesis of CHH and have been extensively studied in many reported cohorts. Due to rarity and heterogenicity of the condition the mutational spectrum, even in classical CHH genes, have yet to be fully characterized. Methods: To address this issue we screened for ANOS1 and FGFR1 variants in a cohort of 47 unrelated CHH subjects using targeted panel sequencing. All potentially pathogenic variants have been validated with Sanger sequencing. Results: Sequencing revealed two ANOS1 and four FGFR1 mutations in six subjects, of which five are novel and one had been previously reported in CHH. Novel variants include a single base pair deletion c.313delT in exon 3 of ANOS1, three missense variants of FGFR1 predicted to result in the single amino acid substitutions c.331C > T (p.R111C), c.1964 T > C (p.L655P) and c.2167G > A (p.E723K) and a 15 bp deletion c.374_388delTGCCCGCAGACTCCG in exon 4 of FGFR1.
    [Show full text]
  • ARTICLE Doi:10.1038/Nature10523
    ARTICLE doi:10.1038/nature10523 Spatio-temporal transcriptome of the human brain Hyo Jung Kang1*, Yuka Imamura Kawasawa1*, Feng Cheng1*, Ying Zhu1*, Xuming Xu1*, Mingfeng Li1*, Andre´ M. M. Sousa1,2, Mihovil Pletikos1,3, Kyle A. Meyer1, Goran Sedmak1,3, Tobias Guennel4, Yurae Shin1, Matthew B. Johnson1,Zˇeljka Krsnik1, Simone Mayer1,5, Sofia Fertuzinhos1, Sheila Umlauf6, Steven N. Lisgo7, Alexander Vortmeyer8, Daniel R. Weinberger9, Shrikant Mane6, Thomas M. Hyde9,10, Anita Huttner8, Mark Reimers4, Joel E. Kleinman9 & Nenad Sˇestan1 Brain development and function depend on the precise regulation of gene expression. However, our understanding of the complexity and dynamics of the transcriptome of the human brain is incomplete. Here we report the generation and analysis of exon-level transcriptome and associated genotyping data, representing males and females of different ethnicities, from multiple brain regions and neocortical areas of developing and adult post-mortem human brains. We found that 86 per cent of the genes analysed were expressed, and that 90 per cent of these were differentially regulated at the whole-transcript or exon level across brain regions and/or time. The majority of these spatio-temporal differences were detected before birth, with subsequent increases in the similarity among regional transcriptomes. The transcriptome is organized into distinct co-expression networks, and shows sex-biased gene expression and exon usage. We also profiled trajectories of genes associated with neurobiological categories and diseases, and identified associations between single nucleotide polymorphisms and gene expression. This study provides a comprehensive data set on the human brain transcriptome and insights into the transcriptional foundations of human neurodevelopment.
    [Show full text]
  • Investigation of Candidate Genes and Mechanisms Underlying Obesity
    Prashanth et al. BMC Endocrine Disorders (2021) 21:80 https://doi.org/10.1186/s12902-021-00718-5 RESEARCH ARTICLE Open Access Investigation of candidate genes and mechanisms underlying obesity associated type 2 diabetes mellitus using bioinformatics analysis and screening of small drug molecules G. Prashanth1 , Basavaraj Vastrad2 , Anandkumar Tengli3 , Chanabasayya Vastrad4* and Iranna Kotturshetti5 Abstract Background: Obesity associated type 2 diabetes mellitus is a metabolic disorder ; however, the etiology of obesity associated type 2 diabetes mellitus remains largely unknown. There is an urgent need to further broaden the understanding of the molecular mechanism associated in obesity associated type 2 diabetes mellitus. Methods: To screen the differentially expressed genes (DEGs) that might play essential roles in obesity associated type 2 diabetes mellitus, the publicly available expression profiling by high throughput sequencing data (GSE143319) was downloaded and screened for DEGs. Then, Gene Ontology (GO) and REACTOME pathway enrichment analysis were performed. The protein - protein interaction network, miRNA - target genes regulatory network and TF-target gene regulatory network were constructed and analyzed for identification of hub and target genes. The hub genes were validated by receiver operating characteristic (ROC) curve analysis and RT- PCR analysis. Finally, a molecular docking study was performed on over expressed proteins to predict the target small drug molecules. Results: A total of 820 DEGs were identified between
    [Show full text]
  • Cell-Type–Specific Eqtl of Primary Melanocytes Facilitates Identification of Melanoma Susceptibility Genes
    Downloaded from genome.cshlp.org on November 19, 2018 - Published by Cold Spring Harbor Laboratory Press Research Cell-type–specific eQTL of primary melanocytes facilitates identification of melanoma susceptibility genes Tongwu Zhang,1,7 Jiyeon Choi,1,7 Michael A. Kovacs,1 Jianxin Shi,2 Mai Xu,1 NISC Comparative Sequencing Program,9 Melanoma Meta-Analysis Consortium,10 Alisa M. Goldstein,3 Adam J. Trower,4 D. Timothy Bishop,4 Mark M. Iles,4 David L. Duffy,5 Stuart MacGregor,5 Laufey T. Amundadottir,1 Matthew H. Law,5 Stacie K. Loftus,6 William J. Pavan,6,8 and Kevin M. Brown1,8 1Laboratory of Translational Genomics, Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institutes of Health, Bethesda, Maryland 20892, USA; 2Biostatistics Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institutes of Health, Bethesda, Maryland 20892, USA; 3Clinical Genetics Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institutes of Health, Bethesda, Maryland 20892, USA; 4Section of Epidemiology and Biostatistics, Leeds Institute of Cancer and Pathology, University of Leeds, Leeds, LS9 7TF, United Kingdom; 5Statistical Genetics, QIMR Berghofer Medical Research Institute, Brisbane, Queensland, 4006, Australia; 6Genetic Disease Research Branch, National Human Genome Research Institute, National Institutes of Health, Bethesda, Maryland 20892, USA Most expression quantitative trait locus (eQTL) studies to date have been performed in heterogeneous tissues as opposed to specific cell types. To better understand the cell-type–specific regulatory landscape of human melanocytes, which give rise to melanoma but account for <5% of typical human skin biopsies, we performed an eQTL analysis in primary melanocyte cul- tures from 106 newborn males.
    [Show full text]
  • Gene Expression Profiling of Corpus Luteum Reveals the Importance Of
    bioRxiv preprint doi: https://doi.org/10.1101/673558; this version posted February 27, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Gene expression profiling of corpus luteum reveals the 2 importance of immune system during early pregnancy in 3 domestic sheep. 4 Kisun Pokharel1, Jaana Peippo2 Melak Weldenegodguad1, Mervi Honkatukia2, Meng-Hua Li3*, Juha 5 Kantanen1* 6 1 Natural Resources Institute Finland (Luke), Jokioinen, Finland 7 2 Nordgen – The Nordic Genetic Resources Center, Ås, Norway 8 3 College of Animal Science and Technology, China Agriculture University, Beijing, China 9 * Correspondence: MHL, [email protected]; JK, [email protected] 10 Abstract: The majority of pregnancy loss in ruminants occurs during the preimplantation stage, which is thus 11 the most critical period determining reproductive success. While ovulation rate is the major determinant of 12 litter size in sheep, interactions among the conceptus, corpus luteum and endometrium are essential for 13 pregnancy success. Here, we performed a comparative transcriptome study by sequencing total mRNA from 14 corpus luteum (CL) collected during the preimplantation stage of pregnancy in Finnsheep, Texel and F1 15 crosses, and mapping the RNA-Seq reads to the latest Rambouillet reference genome. A total of 21,287 genes 16 were expressed in our dataset. Highly expressed autosomal genes in the CL were associated with biological 17 processes such as progesterone formation (STAR, CYP11A1, and HSD3B1) and embryo implantation (eg.
    [Show full text]
  • Inhibiting TG2 Sensitizes Lung Cancer to Radiotherapy Through Interfering
    bioRxiv preprint doi: https://doi.org/10.1101/597112; this version posted April 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Title page 2 3 Inhibiting TG2 sensitizes lung cancer to radiotherapy through interfering 4 TOPOIIα-mediated DNA repair 5 6 Xiao Lei#, Zhe Liu#, Kun Cao#, Yuanyuan Chen#, Jianming Cai, Fu Gao*, Yanyong 7 Yang* 8 9 #Authors contributed equally to this work. 10 11 Department of Radiation Medicine, Faculty of Naval Medicine, Second Military 12 Medical University, 800, Xiangyin Road, 200433, Shanghai, P.R. China; 13 14 *Corresponding author: Yanyong Yang, Fu Gao and Jianming Cai. 15 Address: Department of Radiation Medicine, Faculty of Naval Medicine, Second 16 Military Medical University; 800, Xiangyin Road, 200433, Shanghai, P.R. China. Fax: 17 +86-21-81871148. E-mail: [email protected], [email protected], 18 [email protected]; 19 20 Running title: Targeting TG2 sensitizes lung cancer to radiotherapy 21 22 Keywords: TG2, Radiosensitization, TOPOIIα, NSCLC, DNA repair 23 24 Conflicts of interest 25 The authors have no conflicts of interest to disclose. 26 1 bioRxiv preprint doi: https://doi.org/10.1101/597112; this version posted April 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 27 Abstract 28 Radiotherapy is an indispensable strategy for lung cancer, however, treatment failure 29 or reoccurrence is often found in patients due to the developing radioresistance.
    [Show full text]