Global Journal of Human Social Science Mental Health Services in Hong Kong

Total Page:16

File Type:pdf, Size:1020Kb

Load more

OnlineISSN:2249-460X PrintISSN:0975-587X DOI:10.17406/GJHSS LessonsLearnedfromthePandemicAboriginalEcoconsciousness EmployeeswithVisualImpairmentSelf-EfficacyofPhysicalEducation PublicServiceEmploymentinUgandaMentalHealthServicesinHongKong LightaboutColorortheSchizophrenicAnHeuristicStudyonPuratchiThalaivi VOLUME21ISSUE5VERSION1.0VOLUME21ISSUE1VERSION1.0 Global Journal of Human-Social Science: A Arts & Humanities - Psychology Global Journal of Human-Social Science: A Arts & Humanities - Psychology Volume 21 Issue 5 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2021. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Glo bal Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU Packaging & Continental Dispatching FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG Global Journals Pvt Ltd (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ E-3130 Sudama Nagar, Near Gopur Square, ULVN Indore, M.P., Pin:452009, India 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG Find a correspondence nodal officer near you &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ To find nodal officer of your country, please email us at [email protected] %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH eContacts UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH ERXQGE\WKHWHUPVWKHUHRI Press Inquiries: [email protected] $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG Investor Inquiries: [email protected] RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ Technical Support: [email protected] SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Media & Releases: [email protected] Incorporation No.: 0423089 License No.: 42125/022010/1186 Registration No.: 430374 Import-Export Code: 1109007027 Pricing (E xcluding Air Parcel Charges): Employer Identification Number (EIN): USA Tax ID: 98-0673427 Yearly Subscription (Personal & Institutional) 250 USD (B/W) & 350 USD (Color) Editorial Board Global Journal of Human-Social Science Dr. Arturo Diaz Suarez Dr. Adrian Armstrong Ed.D., Ph.D. in Physical Education Professor at BSc Geography, LSE, 1970 Ph.D. Geography University of Murcia, Spain (Geomorphology) Kings College London 1980 Ordained Priest, Church of England 1988 Taunton, Somerset, United Kingdom Dr. Prasad V Bidarkota Dr. Gisela Steins Ph.D., Department of Economics Florida International Ph.D. Psychology, University of Bielefeld, Germany University United States Professor, General and Social Psychology, University of Duisburg-Essen, Germany Dr. Alis Puteh Dr. Stephen E. Haggerty Ph.D. (Edu.Policy) UUM Sintok, Kedah, Malaysia M.Ed Ph.D. Geology & Geophysics, University of London (Curr. & Inst.) University of Houston, United States Associate Professor University of Massachusetts, United States Dr. André Luiz Pinto Dr. Helmut Digel Doctorate in Geology, PhD in Geosciences and Ph.D. University of Tbingen, Germany Honorary President Environment, Universidade Estadual Paulista Julio of German Athletic Federation (DLV), Germany de Mesuita Filho, UNESP, Sao Paulo, Brazil Dr. Tanyawat Khampa Dr. Hamada Hassanein Ph.d in Candidate (Social Development), MA. in Social Ph.D, MA in Linguistics, BA & Education in English, Development, BS. in Sociology and Anthropology, Department of English, Faculty of Education, Mansoura Naresuan University, Thailand University, Mansoura, Egypt Dr. Gomez-Piqueras, Pedro Dr. Asuncin Lpez-Varela Ph.D in Sport Sciences, University Castilla La Mancha, BA, MA (Hons), Ph.D. (Hons) Facultad de Filolog?a. Spain Universidad Complutense Madrid 29040 Madrid Spain Dr. Faisal G. Khamis Dr. Mohammed Nasser Al-Suqri Ph.D in Statistics, Faculty of Economics & Ph.D., M.S., B.A in Library and Information Management, Administrative Sciences / AL-Zaytoonah University of Sultan Qaboos University, Oman Jordan, Jordan Dr. Giaime Berti Dr. Vesna Stankovic Pejnovic Ph.D. School of Economics and Management University Ph. D. Philosophy Zagreb, Croatia Rusveltova, Skopje of Florence, Italy Macedonia Dr. Valerie Zawilski Dr. Raymond K. H. Chan Associate Professor, Ph.D., University of Toronto MA - Ph.D., Sociology, University of Essex, UK Associate Ontario Institute for Studies in Education, Canada Professor City University of Hong Kong, China Dr. Edward C. Hoang Dr. Tao Yang Ph.D., Department of Economics, University of Ohio State University M.S. Kansas State University B.E. Colorado United States Zhejiang University, China Dr. Intakhab Alam Khan Mr. Rahul Bhanubhai Chauhan Ph.D. in Doctorate of Philosophy in Education, King B.com., M.com., MBA, PhD (Pursuing), Assistant Professor, Abdul Aziz University, Saudi Arabia Parul Institute of Business Administration, Parul University, Baroda, India Dr. Kaneko Mamoru Dr. Rita Mano Ph.D., Tokyo Institute of Technology Structural Ph.D. Rand Corporation and University of California, Los Engineering Faculty of Political Science and Economics, Angeles, USA Dep. of Human Services, University of Haifa Waseda University, Tokyo, Japan Israel Dr. Joaquin Linne Dr. Cosimo Magazzino Ph. D in Social Sciences, University of Buenos Aires, Aggregate Professor, Roma Tre University Rome, 00145, Argentina Italy Dr. Hugo Nami Dr. S.R. Adlin Asha Johnson Ph.D.in Anthropological Sciences, Universidad of Ph.D, M. Phil., M. A., B. A in English Literature, Bharathiar Buenos Aires, Argentina, University of Buenos Aires, University, Coimbatore, India Argentina Dr. Luisa dall’Acqua Dr. Thierry Feuillet Ph.D. in Sociology (Decisional Risk sector), Master MU2, Ph.D in Geomorphology, Master’s Degree in College Teacher, in Philosophy (Italy), Edu-Research Geomorphology, University of Nantes, France Group, Zrich/Lugano Contents of the Issue i. Copyright Notice ii. Editorial Board Members iii. Chief Author and Dean iv. Contents of the Issue 1. Lessons Learned from the Pandemic: The Need for Further Development of Information and Communication Technology Enhanced Mental Health Services in Hong Kong. 1-4 2. Curatorial Processes in the Network Environment: Practice and Contexts from the 1980s. 5-14 3. Self-Efficacy of Physical Education Student Interns in to Engage their Pupil's after Training in "Body Language and Public Speaking". 15-20 4. Conflict and Reconciliation Beween Orient and Occident in A Passage to India and A Passage to England. 21-26 5. The Demographics Procedure to Enhance the Inherent Skills for Competitive Endurance – Patterned from Android Gaming Application. 27-30 6. Biblical Women’s Involvement in Ancient Israel’s National Security and its Implications on Nigerian Society. 31-37 7. Nationalism in R.K Narayan’s The Guide’ and Syed Waliullah's ‘The Ugly Asian’: A Comparative Study . 39-59 8. Africasian Democracy: A Political Prescription for Good Governance in Nigeria. 61-65 9. An heuristic Study on Pur atchi Thalaivi Dr. Jayaraman Jayalalitha Who h ad Acted as Heroine with Bharat Ratna Dr. Marudur Gopala Menon Ramachandran in the 28 Classical Tamil Movies, Many of Which Are Reflecting Dravidian Ideology – Whether Such an Association Resulted in Developing Leadership Qualitites to Become an Unparalled Women Political Leader. 67-173 v. Fellows vi. Auxiliary Memberships vii. Preferred Author Guidelines viii. Index Global Journal of HUMAN-SOCIAL SCIENCE: A Arts & Humanities - Psychology Volume 21 Issue 5 Version 1.0 Year 2021 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X Lessons Learned from the Pandemic: The Need for Further Development of Information and Communication Technology Enhanced Mental Health Services in Hong Kong By Hong Wang Fung & Henry Wai-Hang Ling The Hong Kong Polytechnic University Abstract- The COVID-19 pandemic not only leads to more mental health problems because of its stressful nature, but it also increases the challenges of providing services for people with mental health needs in the community. This paper discusses the limitations of conventional mental health services and the potential use of information and communication technology (ICT) to increase service accessibility in the context of Hong Kong. We review some of the local studies and services and explain why ICT-enhanced services should play a more important role in the local service system, especially when there is a lack of resources and a need for social (physical) distancing. Some future
Recommended publications
  • Vividh Bharati Was Started on October 3, 1957 and Since November 1, 1967, Commercials Were Aired on This Channel

    Vividh Bharati Was Started on October 3, 1957 and Since November 1, 1967, Commercials Were Aired on This Channel

    22 Mass Communication THE Ministry of Information and Broadcasting, through the mass communication media consisting of radio, television, films, press and print publications, advertising and traditional modes of communication such as dance and drama, plays an effective role in helping people to have access to free flow of information. The Ministry is involved in catering to the entertainment needs of various age groups and focusing attention of the people on issues of national integrity, environmental protection, health care and family welfare, eradication of illiteracy and issues relating to women, children, minority and other disadvantaged sections of the society. The Ministry is divided into four wings i.e., the Information Wing, the Broadcasting Wing, the Films Wing and the Integrated Finance Wing. The Ministry functions through its 21 media units/ attached and subordinate offices, autonomous bodies and PSUs. The Information Wing handles policy matters of the print and press media and publicity requirements of the Government. This Wing also looks after the general administration of the Ministry. The Broadcasting Wing handles matters relating to the electronic media and the regulation of the content of private TV channels as well as the programme matters of All India Radio and Doordarshan and operation of cable television and community radio, etc. Electronic Media Monitoring Centre (EMMC), which is a subordinate office, functions under the administrative control of this Division. The Film Wing handles matters relating to the film sector. It is involved in the production and distribution of documentary films, development and promotional activities relating to the film industry including training, organization of film festivals, import and export regulations, etc.
  • Current Affairs December – 2016

    Current Affairs December – 2016

    Current Affairs December – 2016 Current Affairs December 2016 This is a guide to provide you a precise summary and big collection of Multiple Choice Questions (MCQs) covering national and international current affairs for the month of December 2016. This guide helps you in preparation for Indian competitive examinations like Bank PO, Banking, Railway, IAS, PCS, UPSC, CAT, GATE, CDS, NDA, MCA, MBA, Engineering, IBPS, Clerical Grade, Officer Grade etc. Audience Aspirants who are preparing for different competitive exams like Bank PO, Banking, Railway, IAS, PCS, UPSC, CAT, GATE, CDS, NDA, MCA, MBA, Engineering, IBPS, Clerical Grade, Officer Grade etc. Even though you are not preparing for any exams but are willing to have news encapsulated in a roll which you can walk through within 30 minutes, then we have put all the major points for the whole month in a precise and interesting way. Copyright and Disclaimer Copyright 2016 by Tutorials Point (I) Pvt. Ltd. All the content and graphics published in this e-book are the property of Tutorials Point (I) Pvt. Ltd. The user of this e-book is prohibited to reuse, retain, copy, distribute or republish any contents or a part of contents of this e-book in any manner without written consent of the publisher. We strive to update the contents of our website and tutorials as timely and as precisely as possible, however, the contents may contain inaccuracies or errors. Tutorials Point (I) Pvt. Ltd. provides no guarantee regarding the accuracy, timeliness or completeness of our website or its contents including this tutorial. If you discover any errors on our website or in this tutorial, please notify us at [email protected] 1 Current Affairs December – 2016 Table of Contents Current Affairs December 2016.......................................................................................................................
  • Some Principles of the Use of Macro-Areas Language Dynamics &A

    Some Principles of the Use of Macro-Areas Language Dynamics &A

    Online Appendix for Harald Hammarstr¨om& Mark Donohue (2014) Some Principles of the Use of Macro-Areas Language Dynamics & Change Harald Hammarstr¨om& Mark Donohue The following document lists the languages of the world and their as- signment to the macro-areas described in the main body of the paper as well as the WALS macro-area for languages featured in the WALS 2005 edi- tion. 7160 languages are included, which represent all languages for which we had coordinates available1. Every language is given with its ISO-639-3 code (if it has one) for proper identification. The mapping between WALS languages and ISO-codes was done by using the mapping downloadable from the 2011 online WALS edition2 (because a number of errors in the mapping were corrected for the 2011 edition). 38 WALS languages are not given an ISO-code in the 2011 mapping, 36 of these have been assigned their appropri- ate iso-code based on the sources the WALS lists for the respective language. This was not possible for Tasmanian (WALS-code: tsm) because the WALS mixes data from very different Tasmanian languages and for Kualan (WALS- code: kua) because no source is given. 17 WALS-languages were assigned ISO-codes which have subsequently been retired { these have been assigned their appropriate updated ISO-code. In many cases, a WALS-language is mapped to several ISO-codes. As this has no bearing for the assignment to macro-areas, multiple mappings have been retained. 1There are another couple of hundred languages which are attested but for which our database currently lacks coordinates.
  • Nigeria: Ending Unrest in the Niger Delta

    Nigeria: Ending Unrest in the Niger Delta

    NIGERIA: ENDING UNREST IN THE NIGER DELTA Africa Report N°135 – 5 December 2007 TABLE OF CONTENTS EXECUTIVE SUMMARY AND RECOMMENDATIONS................................................. i I. INTRODUCTION .......................................................................................................... 1 II. FALTERING ATTEMPTS TO ADDRESS THE DELTA UNREST........................ 1 A. REACHING OUT TO THE MILITANTS?.....................................................................................1 B. PROBLEMATIC PEACE AND CONFLICT RESOLUTION COMMITTEES.........................................3 C. UNFULFILLED PROMISES.......................................................................................................4 III. THE RISING TOLL....................................................................................................... 7 A. CONTINUING VIOLENCE ........................................................................................................7 1. Attacks on expatriates and oil facilities .....................................................................7 2. Politicians, gangs and the Port Harcourt violence .....................................................7 3. The criminal hostage-taking industry ........................................................................8 B. REVENUE LOSS AND ECONOMIC DESTABILISATION ..............................................................9 C. EXPATRIATE AND INVESTMENT FLIGHT ..............................................................................10 IV. GOVERNMENT
  • Psyphil Celebrity Blog Covering All Uncovered Things..!! Vijay Tamil Movies List New Films List Latest Tamil Movie List Filmography

    Psyphil Celebrity Blog Covering All Uncovered Things..!! Vijay Tamil Movies List New Films List Latest Tamil Movie List Filmography

    Psyphil Celebrity Blog covering all uncovered things..!! Vijay Tamil Movies list new films list latest Tamil movie list filmography Name: Vijay Date of Birth: June 22, 1974 Height: 5’7″ First movie: Naalaya Theerpu, 1992 Vijay all Tamil Movies list Movie Y Movie Name Movie Director Movies Cast e ar Naalaya 1992 S.A.Chandrasekar Vijay, Sridevi, Keerthana Theerpu Vijay, Vijaykanth, 1993 Sendhoorapandi S.A.Chandrasekar Manorama, Yuvarani Vijay, Swathi, Sivakumar, 1994 Deva S. A. Chandrasekhar Manivannan, Manorama Vijay, Vijayakumar, - Rasigan S.A.Chandrasekhar Sanghavi Rajavin 1995 Janaki Soundar Vijay, Ajith, Indraja Parvaiyile - Vishnu S.A.Chandrasekar Vijay, Sanghavi - Chandralekha Nambirajan Vijay, Vanitha Vijaykumar Coimbatore 1996 C.Ranganathan Vijay, Sanghavi Maaple Poove - Vikraman Vijay, Sangeetha Unakkaga - Vasantha Vaasal M.R Vijay, Swathi Maanbumigu - S.A.Chandrasekar Vijay, Keerthana Maanavan - Selva A. Venkatesan Vijay, Swathi Kaalamellam Vijay, Dimple, R. 1997 R. Sundarrajan Kaathiruppen Sundarrajan Vijay, Raghuvaran, - Love Today Balasekaran Suvalakshmi, Manthra Joseph Vijay, Sivaji - Once More S. A. Chandrasekhar Ganesan,Simran Bagga, Manivannan Vijay, Simran, Surya, Kausalya, - Nerrukku Ner Vasanth Raghuvaran, Vivek, Prakash Raj Kadhalukku Vijay, Shalini, Sivakumar, - Fazil Mariyadhai Manivannan, Dhamu Ninaithen Vijay, Devayani, Rambha, 1998 K.Selva Bharathy Vandhai Manivannan, Charlie - Priyamudan - Vijay, Kausalya - Nilaave Vaa A.Venkatesan Vijay, Suvalakshmi Thulladha Vijay 1999 Manamum Ezhil Simran Thullum Endrendrum - Manoj Bhatnagar Vijay, Rambha Kadhal - Nenjinile S.A.Chandrasekaran Vijay, Ishaa Koppikar Vijay, Rambha, Monicka, - Minsara Kanna K.S. Ravikumar Khushboo Vijay, Dhamu, Charlie, Kannukkul 2000 Fazil Raghuvaran, Shalini, Nilavu Srividhya Vijay, Jyothika, Nizhalgal - Khushi SJ Suryah Ravi, Vivek - Priyamaanavale K.Selvabharathy Vijay, Simran Vijay, Devayani, Surya, 2001 Friends Siddique Abhinyashree, Ramesh Khanna Vijay, Bhumika Chawla, - Badri P.A.
  • UCLA Electronic Theses and Dissertations

    UCLA Electronic Theses and Dissertations

    UCLA UCLA Electronic Theses and Dissertations Title Performative Geographies: Trans-Local Mobilities and Spatial Politics of Dance Across & Beyond the Early Modern Coromandel Permalink https://escholarship.org/uc/item/90b9h1rs Author Sriram, Pallavi Publication Date 2017 Peer reviewed|Thesis/dissertation eScholarship.org Powered by the California Digital Library University of California UNIVERSITY OF CALIFORNIA Los Angeles Performative Geographies: Trans-Local Mobilities and Spatial Politics of Dance Across & Beyond the Early Modern Coromandel A dissertation submitted in partial satisfaction of the requirements for the degree Doctor of Philosophy in Culture and Performance by Pallavi Sriram 2017 Copyright by Pallavi Sriram 2017 ABSTRACT OF DISSERTATION Performative Geographies: Trans-Local Mobilities and Spatial Politics of Dance Across & Beyond the Early Modern Coromandel by Pallavi Sriram Doctor of Philosophy in Culture and Performance University of California, Los Angeles, 2017 Professor Janet M. O’Shea, Chair This dissertation presents a critical examination of dance and multiple movements across the Coromandel in a pivotal period: the long eighteenth century. On the eve of British colonialism, this period was one of profound political and economic shifts; new princely states and ruling elite defined themselves in the wake of Mughal expansion and decline, weakening Nayak states in the south, the emergence of several European trading companies as political stakeholders and a series of fiscal crises. In the midst of this rapidly changing landscape, new performance paradigms emerged defined by hybrid repertoires, focus on structure and contingent relationships to space and place – giving rise to what we understand today as classical south Indian dance. Far from stable or isolated tradition fixed in space and place, I argue that dance as choreographic ii practice, theorization and representation were central to the negotiation of changing geopolitics, urban milieus and individual mobility.
  • Curriculum Vitae

    Curriculum Vitae

    Curriculum vitae Dr. (Mrs.) Jamuna Prakash Professor, Department of Food Science and Nutrition, University of Mysore, Manasagangotri, Mysore, 570006, INDIA Phone : 0821-2419634 Email: [email protected] ACADEMIC QUALIFICATIONS: Degree Year Subject Institution/ University Class Ph.D. 1992 Food Science Univ. of Mysore, Mysore. -- M.Sc. 1976 Foods & Nutrition Univ. of Mysore, Mysore. First, First Rank B.Sc. 1974 Home Science Bangalore University. First (Title of Ph.D. thesis: "Studies on rice bran proteins and their use in food formulation”) Teaching and research experience : 34 Years. Research guidance for Post Doctoral research - 1, Ph.D. :- Completed - 9, Working - 7. Research guidance for M.Sc. dissertation/ Project :- 80. Research Interests Food Science - Compositional analysis of foods, product formulation, sensory evaluation, nutrient digestibility and bioavailability, functional properties of foods. Nutrition - Nutrition status of population, food behaviour, diet surveys, nutrition and cognition, nutrition education. Specialized training (International courses) 1. Fundamentals of Nutrigenomics and Its Applications. 19 th ICN Pre-Congress Symposium. International Life Science Institute & Commonwealth Scientific and Industrial Research Organization. Bangkok, Thailand, 4 th Oct. 2009. 2. Enhancing the efficiency of nutritional investigations – Improving priorities, design, management and application of nutrition research. 18-22 June, 2006. International Nutrition Foundation, USA, and United Nation’s University, Japan, C.F.T.R.I., Mysore. 3. Metrological concepts for strengthening food and nutritional measurements. 26-30 June, 2006. International Nutrition Foundation, USA, and United Nation’s University, Japan, C.F.T.R.I., Mysore. Medals/Prizes/Awards: • Gold Medal for securing I rank in M.Sc.,1976. • Prizes (19 for presented papers) – 1991, 1995, 1998, 2000, 2002, 2004, 2006, 2007,2009.
  • Unni Menon…. Is Basically a Malayalam Film Playback Singer

    Unni Menon…. Is Basically a Malayalam Film Playback Singer

    “FIRST ICSI-SIRC CSBF MUSICAL NITE” 11.11.2012 Sunday 6.05 p.m Kamarajar Arangam A/C Chennai In Association With Celebrity Singers . UNNI MENON . SRINIVAS . ANOORADA SRIRAM . MALATHY LAKSHMAN . MICHAEL AUGUSTINE Orchestra by THE VISION AND MISSION OF ICSI Vision : "To be a global leader in promoting Good Corporate Governance” Mission : "To develop high calibre professionals facilitating good Corporate Governance" The Institute The Institute of Company Secretaries of India(ICSI) is constituted under an Act of Parliament i.e. the Company Secretaries Act, 1980 (Act No. 56 of 1980). ICSI is the only recognized professional body in India to develop and regulate the profession of Company Secretaries in India. The Institute of Company Secretaries of India(ICSI) has on its rolls 25,132 members including 4,434 members holding certificate of the practice. The number of current students is over 2,30,000. The Institute of company Secretaries of India (ICSI) has its headquarters at New Delhi and four regional offices at New Delhi, Chennai, Kolkata and Mumbai and 68 Chapters in India. The ICSI has emerged as a premier professional body developing professionals specializing in Corporate Governance. Members of the Institute are rendering valuable services to the Government, Regulatory `bodies, Trade, Commerce, Industry and society at large. Objective of the Fund Financial Assistance in the event of Death of a member of CBSF Upto the age of 60 years • Upto Rs.3,00,000 in deserving cases on receipt of request subject to the Guidelines approved by the Managing
  • Tamil Nadu Government Gazette

    Tamil Nadu Government Gazette

    © [Regd. No. TN/CCN/467/2012-14. GOVERNMENT OF TAMIL NADU [R. Dis. No. 197/2009. 2018 [Price : Rs. 21.60 Paise. TAMIL NADU GOVERNMENT GAZETTE PUBLISHED BY AUTHORITY No. 40] CHENNAI, WEDNESDAY, OCTOBER 3, 2018 Purattasi 17, Vilambi, Thiruvalluvar Aandu – 2049 Part VI—Section 4 Advertisements by private individuals and private institutions CONTENTS PRIVATE ADVERTISEMENTS Pages. Change of Names .. 1645-1697 Notice .. 1697 NOTICE NO LEGAL RESPONSIBILITY IS ACCEPTED FOR THE PUBLICATION OF ADVERTISEMENTS REGARDING CHANGE OF NAME IN THE TAMIL NADU GOVERNMENT GAZETTE. PERSONS NOTIFYING THE CHANGES WILL REMAIN SOLELY RESPONSIBLE FOR THE LEGAL CONSEQUENCES AND ALSO FOR ANY OTHER MISREPRESENTATION, ETC. (By Order) Director of Stationery and Printing. CHANGE OF NAMES 23935. My daughter, Seebhana Begam, born on 23938. I, M. Madhan, son of Thiru R. Murugesan, 9th September 2003 (native district: Sivagangai), born on 7th May 1988 (native district: Madurai), residing residing at No. 5/19, N. Manakudi, Sekkudi Post, at No. 31A/64, Indira Nagar North Street, Munichalai Devakottai Taluk, Sivagangai-630 408, shall henceforth be Road, Kamarajapuram, Madurai-625 009, shall henceforth be known as J. SHIBANA BEGAM known as M. MATHANAMATHAV S. JAHIR HUSSAIN M. MADHAN Sivagangai, 24th September 2018. (Father) Madurai, 24th September 2018. 23936. My daughter, P. Jyothika, born on 10th June 2001 23939. My son, S Ruban, born on 1st December 2013 (native district: Madurai), residing at Old No. 11B, New (native district: Theni), residing at No. 143/85, Solaimalai, No. 37, Theetchather Kollai, Rameswaram, Ramanathapuram- Ayyanar Kovil Street, Banglowmedu, Allinagaram, Theni- 623 526, shall henceforth be known as S RUTRAN 625 531, shall henceforth be known as P.
  • Top 10 Male Indian Singers

    Top 10 Male Indian Singers

    Top 10 Male Indian Singers 001asd Don't agree with the list? Vote for an existing item you think should be ranked higher or if you are a logged in,add a new item for others to vote on or create your own version of this list. Share on facebookShare on twitterShare on emailShare on printShare on gmailShare on stumbleupon4 The Top Ten TheTopTens List Your List 1Sonu Nigam +40Son should be at number 1 +30I feels that I have goten all types of happiness when I listen the songs of sonu nigam. He is my idol and sometimes I think that he is second rafi thumbs upthumbs down +13Die-heart fan... He's the best! Love you Sonu, your an idol. thumbs upthumbs down More comments about Sonu Nigam 2Mohamed Rafi +30Rafi the greatest singer in the whole wide world without doubt. People in the west have seen many T.V. adverts with M. Rafi songs and that is incediable and mind blowing. +21He is the greatest singer ever born in the world. He had a unique voice quality, If God once again tries to create voice like Rafi he wont be able to recreate it because God creates unique things only once and that is Rafi sahab's voice. thumbs upthumbs down +17Rafi is the best, legend of legends can sing any type of song with east, he can surf from high to low with ease. Equally melodious voice, well balanced with right base and high range. His diction is fantastic, you may feel every word. Incomparable. More comments about Mohamed Rafi 3Kumar Sanu +14He holds a Guinness World Record for recording 28 songs in a single day Awards *.
  • CII-ITC Sustainability Awards 2008 Chemplast Sanmar Gets Recognition in the Large Business Category Awards

    CII-ITC Sustainability Awards 2008 Chemplast Sanmar Gets Recognition in the Large Business Category Awards

    1 Sanmar Holdings Limited Sanmar Chemicals Corporation Sanmar Engineering Corporation Chemplast Sanmar Limited BS&B Safety Systems (India) Limited PVC Flowserve Sanmar Limited Chlorochemicals Sanmar Engineering Services Limited Trubore Piping Systems Fisher Sanmar Limited TCI Sanmar Chemicals LLC (Egypt) Regulator Valves Tyco Sanmar Limited Sanmar Metals Corporation Xomox Sanmar Limited Sanmar Foundries Limited Pacific Valves Division Sand Foundry Investment Foundry Sanmar Speciality Chemicals Limited Machine Shop ProCitius Research Matrix Metals LLC Intec Polymers Keokuk Steel Castings Company (USA) Performance Chemicals Richmond Foundry Company (USA) Bangalore Genei Acerlan Foundry (Mexico) Cabot Sanmar Limited NEPCO International (USA) Sanmar Ferrotech Limited Eisenwerk Erla GmBH (Germany) Sanmar Shipping Limited The Sanmar Group 9, Cathedral Road, Chennai 600 086. Tel.: + 91 44 2812 8500 Fax: + 91 44 2811 1902 2 In this issue... Momentous Moments MNC Flying to the Moon 4 MNC Celebrates 19th Anniversary 28 5th National Workshop on Early Intervention for Cover Story Mental Retardation 29 Sanmar’s Egyptian Sojourn 8 Social Responsibility Guest Column India’s Environment Ambassador Bata by Choice -Thomas G Bata 12 Voyages to the Arctic 30 A New Financial World Order - Arvind Subramanian 15 CII-Tsunami Rehabilitation Scorecard 32 Celebrating Art Chemplast Sanmar Distributes Rice in Hurricane- ravaged Villages in Cuddalore & Karaikal 34 Strumming to Spanish Music 19 Renovation of Park at Karaikal 35 Sruti Magazine Celebrates Silver Jubilee 20 The First Mrs Madhuram Narayanan Endowment Lecture 36 Pristine Settings Around Sanmar 22 Events Awards Sanmar Stands Tall 37 Flowserve Sanmar’s Training Centre 24 Trubore Dealers’ Meet 25 Legends from the South The 9th AIMA-Sanmar National Management Quiz 26 Padmini 42 Matrix can be viewed at www.sanmargroup.com Designed and edited by Kalamkriya Limited, 9, Cathedral Road, Chennai 600 086.
  • Chevalior Sivaji Ganesan‟S Tamil Film Songs Not Only Emulated the Quality of the Movie but Also Contains Ethical Imports That

    Chevalior Sivaji Ganesan‟S Tamil Film Songs Not Only Emulated the Quality of the Movie but Also Contains Ethical Imports That

    Global Journal of HUMAN-SOCIAL SCIENCE: A Arts & Humanities - Psychology Volume 20 Issue 10 Version 1.0 Year 2020 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X Chevalior Sivaji Ganesan‟S Tamil Film Songs Not Only Emulated the Quality of the Movie but also Contains Ethical Imports that can be Compared with the Ethical Theories – A Retrospective Reflection By P.Sarvaharana, Dr. S.Manikandan & Dr. P.Thiyagarajan Tamil Nadu Open University Abstract- This is a research work that discusses the great contributions made by Chevalior Shivaji Ganesan to the Tamil Cinema. It was observed that Chevalior Sivaji film songs reflect the theoretical domain such as (i) equity and social justice and (ii) the practice of virtue in the society. In this research work attention has been made to conceptualize the ethical ideas and compare it with the ethical theories using a novel methodology wherein the ideas contained in the film song are compared with the ethical theory. Few songs with the uncompromising premise of patni (chastity of women) with the four important charateristics of women of Tamil culture i.e. acham, madam, nanam and payirpu that leads to the great concept of chastity practiced by exalting woman like Kannagi has also been dealt with. The ethical ideas that contain in the selection of songs were made out from the selected movies acted by Chevalier Shivaji giving preference to the songs that contain the above unique concept of ethics. GJHSS-A Classification: FOR Code: 190399 ChevaliorSivajiGanesanSTamilFilmSongsNotOnlyEmulatedtheQualityoftheMoviebutalsoContainsEthicalImportsthatcanbeComparedwiththeEthicalTheo riesARetrospectiveReflection Strictly as per the compliance and regulations of: © 2020.