NEWS AND TECHNOLOGY • INSTALLATION • SERVICING • DEVELOPMENTS TE1.111 S AND CONSU MER ELECTR O NICS JUNE 2004 £3.20

Test report: Towards the Horizon digital signal-strength meters

1- , ::: , /' I

, \,tillilli1111 \ ,, c.... ,., ' M. , • _____, çi- • ::: 1 :::e I. _ a um -. 7! a le t

O The Sale of Goods Act explained gita Servicing the 0 6> Hitachi A7 chassis 9 7(0032 64 7 39

FAULT FINDING FOR TV AUDIO SATELLITE VIDEO IT IUM etWetellteneNtn 1*‘,

It all the r

e didn't mean for it to be so big, it's just that when we asked you what was needed by the industry the answer was - the most definitive remote control cross reference available in the European market.

We listened to you and the result is our latest 2004/2005 remote control catalogue. It is big! classic 456 pages listing over 15,000 models, 22,000 part numbers/handset numbers and 4,400 original • Fernb edie handset illustrations. It is the most complete guide • nungen Remote Controls to remote controls ever produced. Telec ommand • Teiern _, es ',moos As new models are being added to our range every Tel day even a catalogue such as this will not contain the new additions to our range since printing. No problem! Simply check for the model you require on our website www.classic-electronics.co.uk

Over the next two months your Classic distributor will be sending you your very own copy of the catalogue. If you do not receive your copy or you need an additional copy contact your usual Classic distributor, phone us on 01635 278678 or email us at [email protected].

rctas-Èi

Technical helpline 01635 278678 CONTENTS June 2004 Vol. 54, No. 8

451 Comment 476 The digital home Editor Public-service broadcasting. High-street gloom. The government has set up a Digital Action Plan John A Reddihough Sony's loss of focus. with the aim of moving TV broadcasting to an all- [email protected] digital basis by the year 2010. Various issues still 452 News have to be resolved however before homes can be Deputy Editor converted to the all-digital dream. These involve Ofcom on the digital transition. Dixons to close Tessa Winford stores. TV via your mobile. Video news. Pay-per- aerial standards, signal distribution within the view TV from BT. home, video recording and set-top boxes. J. Production Editor LeJeune reports on the current situation. Jane Massey 454 Test report: Horizon digital signal meters 480 Letters Production Executive Eugene Trundle checks out a pair of digital-TV Days of DC. Digital picture quality. Naiko spares. Dean Turner reception testers for satellite and DTT work. Sharp probes. An unusual aerial rotator. 01322 611206 [email protected] 458 The Sale of Goods Act 481 Help wanted The Sale of Goods Act, which originally came into Advertisement Sales effect in 1979 and was supplemented by 482 DX and Satellite Reception Luke Baldock Regulations introduced in 2003, affects everyone who has commercial dealings with the public. You Terrestrial DX and satellite TV reception reports. 01322 611 289 Broadcast and satellite TV news. VHF TV aerial can get into difficulties that could involve expense Fax 01322 616 376 and wasted time if you are not familiar with its construction and mysteries. Roger Bunney reports. requirements. Michael Maurice provides a guide Editorial Assistant to how it affects our trade 486 Audio faults Caroline Fisher

462 Servicing the Hitachi A7 chassis 488 DVD and home cinema 01322 611 274 Glyn Dickinson provides a repair guide for this fault reports Managing Editor chassis, which was introduced in 1998 and remained in production for several years. It was Bill Evett used in a wide range of models. both 4:3 aspect 489 Test Case 498 ratio and widescreen. Publishing Director 490 VCR clinic Tony Grey' Ile 468 A holiday at Murphys 492 TV fault finding Ron Boume recalls train- Note that we are unable to ing back in the Fifties, 496 Books to buy when he attended a answer technical queries over course on TV at the The Television book service, with details of some the telephone and cannot Murphy Radio factory in of the titles you can order. provide information on spares Welwyn Garden City. other than that given in our 498 Satellite notebook Spares Guide. 475 Bench notes Recording satellite radio on CD. Digital channel Engineers are occasionally tempted to tackle a update. TV from Express AM22 at 53°E. Digibox Disclaimer repair that's obviously going to be uneconomic. fault reports. We work hard to ensure that the Adrian Gardiner describes such a job, with a information presented in Television Panasonic home cinema system. is accurate. However, Television's 502 Service casebook publisher - Highbury Business - Michael Maurice on problems he's encountered in will not take responsibility for any injury or loss of earnings that may the field and the workshop. result from applying information presented in the magazine It is 503 Web service your responsibility to familiarise yourself with the laws relating to dealing with your customers and 504 What a Life! suppliers, and with safety practices relating to working with From a pool-side idyll to a surprise interview, all electrical/electronic circuitry - in a day's work. Donald Bullock's servicing com- particularly as regards electric mentary. shock fire. hozorcis and explosions.

506 Monitor faults Next issue, dated July, on sale June 16 507 Next month in Television

TELEVISION June 2004 ; RDs8o SOLDERING

A N Y NOTExcerpt of 8 2 JUST OLD soldering tip *roles 832 BD 4r es it" :

832 VD 46 IRON e

46 OS

_T2 O42 BD "

842 YD

DIGITAL DISPLAY • LEAD FREE CO MPATIBLE • 290 WATT HEAT-UP RATE FREE

• VAST LOW COST TIP SELECTION DELIV ERY • VARIABLE TEMPERATURE SOLDERING • ALL TIPS ARE LONG LIFE • CLOSED LOOP SYSTEM î MAKE THE CHANGE • CHANGE THE MAKE BLUNDELL PRODUCTION EQUIP MENT 203 Torrington Avenue, Coventry CV4 9UT, England Telephone: 024 7647 3003 Fax: 024 7669 4155 email: [email protected] w w w.blundell.co.uk COMMENT

COPYRIGHT Highbury Business, 2004. All rights reserved. No part of this publication may be reproduced, stored or transmitted in any Public-service form or by any means without the written permission of the publishers. All reasonable precautions are taken by Television to ensure that the advice and data broadcasting published are reliable. We cannot however guarantee it and we cannot accept legal he new regulator Ofcom seems to be don't pay much attention to them. In fact in responsibility for it. operating in overdrive. In one month a democracy it is vital that the public has T we have had its report on the digital access to impartial and accurate information. CORRESPONDENCE ti anqtion (see over page) and, subsequent- The licence fee can provide the means for All correspondence regarding advertisements ly, its initial views on the future of public- this, and is thus essential. But a significant should be addressed to the Advertisement service broadcasting. The latter have, Manager, Television, Highbury Business, question Ofcom has raised is whether the fee Media House, Azalea Drive, Swanley, Kent, understandably, caused a bit of a stir. They should be used exclusively to fund the BBC, BR8 8HU. Editorial correspondence should be nevertheless serve to highlight the changes or be used by several broadcasters. It's an addressed to Television, Editorial Department, that are taking place in the world of TV, interesting point and a bit of a conundrum. Highbury Business, Media House, Azalea and the role that public-service broadcast- There is clearly a danger that if the funding Drive, Swanley, Kent, BR8 8HU. ing should play in this new world. is spread around too widely it will lose its The situation that's developing is not effectiveness. A strong, independent public- INDEXES AND BINDERS Indexes for Vols. 38 to 53 are available at £.50 all that healthy. Lots, more channels service broadcaster is essential, and the BBC each from SoftCopy Ltd., who can also should mean lots more choice. In practice has traditionally fulfilled this role. Does it supply an fifteen-year consolidated index on it can mean more and more rubbish. matter that it also provides entertainment and computer disc. For further details see page 507. Channels cost money to run, but available seeks a mass audience? To remain a force in Binders that hold twelve issues of Television are finance is limited. Thus many channels available for £6.50 each from Modern the TV world, it has to be more than a glori- Bookbinders, Pringle Street, Blackburn, BB1 1SA. can mean that resources are spread too fied newsdesk and purveyor of culture. Telephone: 01254 59 371 thinly. The public, for its part, has made There's a danger that Ofcom, concentrat- Make cheques payable to "Television Binders". its preferences clear. The main interests ing more on change than the need to pre- seem to be soap, reality TV and of course serve essential services, could cause a lot of Nevvstrade Enquiries sport. It is disheartening that there has damage. One has only to think of the chaos Seymour Distribution Ltd. been a 47 per cent increase in soap broad- that has been caused to the railway system ISSN 0032-647X casting over the past five years. by ill-considered meddling. Ofcom should Most people are content to pay the TV realise that it has very heavy responsibili- SUBSCRIPTIONS licence fee and appreciate the value of news ties. It doesn't give the impression of being Highbury Fulfilment Services, Link and current-affairs programmes, even if they mindful of this. House, 8 Bartholomew's Walk, Ely, Cambridge CB7 4ZD. Telephone 01353 654 431 Sony's loss of focus Fax 01353 654 400 ony, which is rightly renowned for its electronics and Hollywood have little in Email [email protected] uk video and audio technology, seems to common. Sony found it difficult to work Please notify change of address. S have lost its way in recent times. In the last with Columbia, and the joint company has financial year Sony's profits fell by almost never operated smoothly. So the news that Subscription rates: a quarter. In comparison, Sharp and Sanyo it is considering a bid worth some $5bn for UK 1 year £33.80 have been doing very well. At Sony the talk Metro-Goldwyn-Mayer, albeit in 2 years £54.00 3 years £71.00 is about cost-cutting, restructuring and conjunction with two private-equity investment to regain profitability. The investors, comes as something of a Republic of Ireland 1 year £38.95 company seemed to lose its ability to focus surprise. It could only distract Sony's 2 years £62.00 on the latest electronic opportunities when, 3 years £81.85 management from the task of increasing its some fifteen years ago, it bought Columbia profit margin from the present dismal 1-9 Mainland Europe 1 year £49.00 Pictures, the idea being to be able to back per cent. Getting involved with MGM 2 years £78.40 its video products with programme seems to be about the last thing that Sony 3 years £102.90 material. But the worlds of consumer should be contemplating. Rest of World 1 year £63.50 2 years £101.00 3 years £133.00 Cheques should be made payable to High-street gloom Television. hat's gone wrong with the traditional supermarkets, so shoppers are offered less W shopping high street? Stalwarts such choice at higher prices. The way things are BACK NUMBERS as Boots and WH Smith have been doing going, the high street will soon consist of If available issues are £4.00 each poorly, and Marks & Spencer has its mainly coffee shops and estate agents, problems. Now Dixons has announced store which is hardly an enticing prospect. The closures and plans to pull out altogether main problem is that rents are far too high, over the next ten years. The basic facts are the result of ever-upwards rent revisions. that retailing has become intensely Something will have to be done about this if HIGHBURY competitive while high-street costs are high. we are not to lose the convenience of high- BUSINESS • .14111.0“0.1 .raduiff NW, F. M M . Outlets are small in comparison with the street shopping.

TELEVISION June 2004 451 NEWS Ofcom on the digital transition

In early April the new media reg- with provision of information and charges could for the first time be would require the co-operation of ulator Ofcom issued a report on assistance continuing for some applied to the BBC, Channel 4 manufacturers and retailers. the transition from analogue to months after completion of the and S4C, from say 2006. Ofcom Ofcom recommends that a digital TV, with recommenda- switchover. recommends that as part of the body should be set up to co-ordi- tions on how the analogue Policy recommendations BBC's Royal Charter review the nate the switchover. It could be switch-off might be implement- include giving viewers advance government should insist on obli- called SwitchCo and would high- ed. The report states that over notice of the switchover date so gations to roll-out digital trans- light the benefits of the half of UK households already that they can make plans about missions nationwide, ensure that switchover, inform about and have digital TV reception facili- buying digital reception equip- viewers can continue to receive promote the timetable, advise ties and that the government's ment without uncertainty about its channels via the current free- about the practicalities, ensure target of an analogue switch-off the switchover date. But Ofcom to-view satellite services, and clear labelling and description of by 2010 is possible if certain con- recognises that this could rein- provide information on and pro- relevant consumer products, and ditions are met. It recommends force viewer resistance to the mote the switchover. provide liaison between the gov- switchover on a region-by-region switchover before it is generally Ofcom wants improved MT ernment, Ofcom, the transmis- basis in order to limit the scale of recognised as being a technologi- coverage, and suggests that satel- sion companies and the broad- viewer disruption. Ofcom sug- cal necessity. It adds however lite transmissions could play an casters. It could work to max- gests that a rolling programme of that with most households important role in increasing digi- imise the range of digital options regional switchovers would be already having wress to digital tal take-up by those who don't available to viewers. practical, taking about four years TV the foundations for want pay TV. It points out that What's going to happen to all to complete after two years of announcement of a timetable FTV arrPss to some public serv- those analogue VCRs? Ofcom initial preparation. The regional have already been laid. Ofcom ice broadcasters is currently not simply says that people will approach would enable technical believes that the announcement available via digital satellite "either have to convert their preparations to be undertaken would significantly increase digi- transmission, and considers that video recorders or purchase new area by area, spreading the costs tal TV reception and would help this might have to be remedied recording devices with integrated and avoiding the risks inherent in enable the final switchover to be by regulatory intervention, the digital tuners". A great help! a national switchover. If the completed by the end of 2010. cost falling on the broadcasters. switchover were to take place Research conducted by the DTI Ofcom recommends that the gov- between 2007 and the end of indicates that many analogue ernment should continue its en riper-view 2010, a decision would be viewers would be prepared to efforts to overcome impediments required in early 2005. buy digital equipment once they to other forms of digital recep- TV from BT On the basis of the switchover knew that a digital switchover tion, for example planning in Berlin, Ofcom suggests that it was imminent. restrictions on satellite dishes. It BT has announced plans to would be helpful for some ana- No mention is made of the adds that MT signals can be offer pay-per-view video via a logue channels to be switched off possible supply of free set-top boosted once the switchover is broadband connection. It has before others. One or more ana- converters for those unwilling to under way, but recognises that set up BT Rich Media, which logue channels could be switched buy digital receiving equipment. international agreements to avoid will provide end-to-end off say six months ahead of the The government would under- interference will impose limita- production facilities for small others, enabling digital tenestrial standably be reluctant to contem- tions in some areas. It seems pos- companies and organisations. signals to be boosted to full plate such a step. What could sible that to achieve maximum This will enable them to strength. Switching off one or cause problems is the realisation DTI' coverage it will be neces- provide audio and videc two analogue channels would by viewers that new, expensive sary to operate some multiplexes content online. Next year BT enable areas currently without aerials will also required in many at a lower transmission capacity. plans to offer customers a any MT signals to begin receiv- areas for reliable reception. Ofcom notes the difficult trade- number of media services via ing them. It would also bring Ofcom suggests the possibili- off between coverage and effi- the internet, including live home to viewers the imminence ty of imposing spectrum pricing ciency and whether to use video, having developed a new of the switchover and the need to as an incentive to promote the 16QAM or 64QAM modulation. broadband technology that purchase appropriate receiving switchover. Channel 3 licensees Ofcom adds that the guarantees high downbad equipment. Remaining analogue and Channel Five already pay for switchover will not be possible speeds: BT's 'flexible- transmissions would be switched their licences to broadcast: with unless viewers are convinced of bandwidth' technology off at the date set for each region, spectrum pricing introduced, its benefits, and recommends a provides downloading at mass national advertising cam- 2Mbits/sec, which equates to paign to bring home the advan- almost OVO quality video. This Institutions remain separate tages, followed by the provision should lead to a pay-per-view Talks on merging the Institution of Electrical Engineers (IEE), the Institution of of information to each household TV service starting next year. Mechanical Engineers (IMechE) and the Institution of Incorporated on the switchover timetable in the BT has been working with Engineers (11E) to form a combined Institute of Engineering with a area. It also recommends a Netgem and SetPal to develop membership of some 250,000 have been called off. It seems that labelling scheme to warn con- set-top boxes for interfacing differences in ways of working and structures have made the effort and cost sumers that unconverted ana- TV sets with a broadband involved too great For the time being the Institutions will remain separate. logue equipment would not be internet connection. usable after a set date. This

June 2004 TELEVISION NEWS New Hitachi DVD camcorders Hitachi has launched two quick-menu option for easy card slot for easy capture and 'fourth-generation' DVD cam- operation. Simple disc navi- transfer of still photographs. corders, Models DZ-MV550E gation gives instant access The high-resolution (120kpixel) and DZ-MV580E (see photo to clips: you simply 2•5in. colour LCD screen above). Model DZ-580E pro- select the thumbnail that makes filming and on-camera vides higher resolution with a represents the beginning editing simple. An extensive 1Megapixel CCD image sensor. of the required scene range of PC software is sup- It has a 10x optical zoom and then play it back. plied for quick and easy video 240x digital zoom. Model DZ- The camcorders have a editing. When recording on a MV550E has lower resolution high-speed USB2.0 inter- DVD-RAM disc the advanced but the powerful 18x optical face for fast uploading menu features can be used for zoom lens offers greater flexi- to and downloading editing. bility for everyday use. The from a PC, and an SD- For further information go camcorders have a simplified, type flash-memory to: www.hitachi.co.uk

Dixons to close stores Video news

Dixons has announced that the staff affected will be Following the news that dual- Philips has released a 17in. 106 of its 320 high-street deployed to other retail outlets layer DVD+R discs with widescreen LCD monitor with stores are to be closed within a within the group (Currys, PC increased storage capacity (see built-in tuner, Model 170T4. It matter of weeks, affecting World, the Link). News last month) are to be has multiple video inputs, some 1,000 staff. It intends to John Clare, Dixons Group launched this year, there has including S-video and composite, move to larger, new-format chief executive, envisages that been an announcement that to provide displays with a PC, stores, referred to as xL, that the remaining 214 high-street dual-layter DVD-R discs will TV set, DVD player or VCR. will be at least five times larg- Dixons stores will be closed become available in late 2004 or There is also a VGA input. er than the current typical over the next ten years, with a early 2005. Philips claims that the monitor is high-street store - Dixons at move to some 130 xL stores at Sanyo has launched its first future-proof, being compatible present has five xL stores. All edge of town centre or out-of- DVD recorder, Model DVR- with 1,080-line interlaced and the stores to be closed have town retail park locations 500. It records on DVD+RW 720-line progressive signals as been trading at a loss, the where space is less expensive. and DVD+R discs and can also well as current 576p and 480p result of escalating costs (rents The immediate closures read DVD-R, Super Video CD, sources. There's an autostore etc.) and savage price competi- amount to just two per cent of Video CD, CD and CD-R discs with 100 preset channels. Price is tion. It is hoped that many of the company's trading space. with MP3, WMA or JPEG files. about £500. TV via your mobile Mobile phone users could operators, handset makers and has a large screen and battery: before long be able to watch broadcasters have been future TV-compatible handsets DTT via their handsets. involved. Trials in the UK are expected to be smaller. During the past eighteen may be held later this year, Welcoming the prospect months trials of the technolo- with DTT chipsets incorporat- David Chance, chairman of gy have been taking place in a ed in mobile phones. Top-Up TV, hoped that phones number of countries, including Nokia's first TV compati- would incorporate a condition- Korea, Japan, Finland and ble phone, Model 7700, is due al-access chipset. Well he Germany. Mobile network to be released later this year. It would, wouldn't he?! Sanyo's upmarket LCD TVs Sanyo is to launch a new range 'of upmarket LCD 7V sets, Models New digital-ready aerials from Philex 30L03, 27LC3, 20LC3 and 15LC3 - the first two figures indi- cate screen size. Model 30LC3 Philex has launched a new range (maximum) and a noise figure of range being completed with an is expected to sell for about of indoor and outdoor wideband, 6dB. It can be adjusted through entry-level five-element model. 122,000. It has a built-in Freevievv digital-ready aerials. There are 360° laterally and 90° vertically For outdoor use there are two tuner, a viewing angle of 170' three indoor and two outdoor for optimum reception, and has log-periodic aerials, Models and active 3D surround, which models. The Orbit is an indoor adjustable gain. Powering can be LPw30 and LPw40. These pro- gives o cinematic surround-sound aerial with built-in amplifier for 230V AC or 12V DC - a blue vide a gain of 10.5 and 12.5dBd effect. There is also an Eco mode set-top or wall mounting. LED power indicator is includ- respectively. Model LPw40 car- far reduced power consumption, Frequency range is 470- ed. The Kobra is similar but ries the CAI benchmark for digi- child lock and a sleep timer. 680MHz with a gain of 22dB without an amplifier, the indoor tal TV.

TELEVISION June 2004 .1 ; TEST REPORT: Horizon digital signal meters

Eugene Trundle checks out a pair of digital-TV reception testers

ong gone are the days when an ana- adequate, perhaps, for the most basic ter is especially important as the terrestri- logue signal-strength meter sufficed installations — and caravanners. The next al broadcast bands and satellite slots Lwhen aligning TV aerials and dishes. class consists of hand-held or neck-slung become ever more crowded. Some top- Signal-strength meters have now gone meters that can identify the end instruments can operate on two or digital, like the signals they receive and transmitter/satellite from which a signal more systems — satellite, terrestrial and the boxes these signals feed. There are comes and gives a readout of signal- or cable. The most sophisticated can range several classes of instrument in this mar- carrier-to-noise ratio and the received bit- in price up to £2,500, with a colour dis- ket, each with a fairly well-defined price error ratio (BER). These cost about £00. play and every possible bell, whistle and point. Beyond this, ranging in price from £800 hooter. At the bottom there are the simplest to about £1,200, there are instruments, What you choose will depend on the types that merely provide an overall- still portable but heavier and more com- type of work you do, which of the three strength reading based on all the signals plex, with a screen on which the transmit- transmission modes you normally work that come from a transmitter or satellite. ted picture or, much more significant, a with, and where in the installation market These cost about 00-£60 and are just band spectrum can be displayed. The lat- you pitch yourself. If you confine your-

HORIZON DIGITAL TERRESTRIAL METER

454 June 2004 TELEVISION self to contract work with Sky dishes, Up the ladder V readouts enable you to check on cable you won't need the top-end Promax I started with the satellite meter which, at loss. This is more laborious than with a Prolink 4. At the other extreme, if you switch on, defaults to the UK's most-used spectrum-analyser instrument, because of undertake SMATV installations a £40 satellite slot, Astra at 28-2°E - whence the need to check on strength and quality SatMax WonderWave will not do for you! come all those highbrow Sky pro- at two or three points in the first IF band, The instruments I'm reviewing here are grammes. 1 found that Turksat, Hispasat, i.e. low, medium and high. in the middle category: hand-held or Telecom 2A and 2C, Thor, Sirius, In the wind and rain while I was evalu- neck-slung alignment/installation meters Eutelsat W1/2/3, Hot Bird, Astra at ating this meter I found that the neck-strap with a digital readout, non-volatile soft- 19.2°E and Arabsat were also prepro- suspension is convenient and the weather- ware programming for relevant signal grammed. This is more than enough for proofing at least as good as my own! If the sources, and a rechargeable battery power most installers, without need to go to instrument was mine I would keep a little supply. These Horizon meters use Ni-MH Horizon's database. During my tests I extension lead permanently connected to batteries and are priced at £250 + VAT confined myself to the two Astra slots the F-type input socket, to prevent wear on for the satellite version and £299 + VAT and Hot Bird. For alignment you of the socket and permit 'flap-down' operation for the terrestrial (Freeview) type. course need a start point: a compass and in wet weather. I certainly had no doubt an inclinometer of some sort, or great when a dish was correctly aligned using Description familiarity with the local topography rela- this meter: with a little experience one soon The two meters have much in common tive to the satellite you are seeking. gets to know what to expect in terms of sig- but are readily identifiable by their With each satellite setting the meter nal strength and quality. I also found that colour - yellow for the satellite version, scans the vertically- then the horizontal- the instrument provides about fifty per cent red for the terrestrial one. They come ly-polarised transponders, stopping at longer running time per battery charge than with a lined, Welcroed' and reasonably each match with its internal database and its otherwise similar competitor, the Lacuna weatherproof leather-look case that has a switching to a strength reading (S) to Sat Meter 2, along with a physically easier neck strap and a viewing window, and enable you to peak the alignment of the fitting for the F connector. contain a 2.4Ah Ni-MH battery pack dish. The 'searching' caption is soon The bright red terrestrial meter, Model that gives over six hours' use with the replaced by a 'found' one, and a second HDTM, is much more likely to need a terrestrial version and, because of the (Q) bar-graph that represents the inverse download feed of your local Freeview DTV current drain taken by the LNB, about of the bit-error ratio. At the point where transmitters, because of their greater num- half that with the satellite version. An these readings peak, usually together I ber and the fast rate at which they are com- 'intelligent' mains charger is built in, found, the dish can be tightened up, leav- ing on stream. Armed with the downloaded arranged for a four-hour charging cycle ing you to see how you (and the programs for my local transmitters, I first and trickle-charging thereafter. There's a dish/LNB) have done in terms of the C/N climbed to the roof of Trundle Towers. I car cigar-lighter cord for charging on the (carrier-to-noise) ratio, indicated in dB, found that my aerial, which had been move, and the battery condition is and V, which represents the corrected installed many years ago, presumably with shown in the front panel readout Viterbi BER, given as a percentage. the aid of a simple analogue meter, was off- throughout its charge and discharge In practice I found that this works beam by a few degrees. The before and cycles. The meters have an RF loop- smoothly and well. The S and Q readouts, after alignment carrier strengths and BER through facility and a simple to under- with quick response, are the main ones at readings differed considerably: my DTV stand operating system that's based on the dish. In the living room the S, Q and reception, good before, was better for the four membrane-type keys and a four-line backlit LCD panel. The accompanying picture shows the front face of the ter- Table 1: Horizon digital signal meter specifications restrial version, Model HDTM. Both units are software programmed, Model HDTM in flash memory via an RS232 serial data port, for the transmitters/transpon- RF input range -72dBmV to +20dBmV ders of interest - up to 32 of them, each Frequency coverage 167-862MHz with up to 16 multiplexes for the Memory capacity 32 transmitters, 16 multiplexes each Freeview Model HDTM, or from 16 RF booster supply 12V, 200mA selected satellites for Model HDSM. Battery life Over six hours They can, on request, be custom-pro- grammed before delivery (and even per- Model HDSM sonalised with your name!). Alternatively you can carry out pro- RF input range -65dBmV to +25dBmV gramming by downloading from Memory capacity 16 satellites, 32 transponders Horizon's website via the PC lead sup- LNB supply 13V V, 18V H plied: the system is compatible with LNB short-circuit protection Automatic at 500mA Windows 98 to XP and requires Winzip Battery life Over three hours software to run - this is easily down- loaded from the Web if required. General The menu-key-led data readouts give indication of four basic parameters: sig- Dimensions 170 x 123 x 58mm (w/d/h) nal source; signal strength in bar-graph Weight 900g with batteries and quantitative (dBµV) form; pre-BER Power source Internal 2.4Ah Ni-MH battery, with 'pass' and 'fail' measurements; and internal mains charger post-BER. The latter two indicate the Mains lead, car cord, PC lead bit-error ratio before and after internal Supplied accessories error correction of the type that takes PC interface Serial via RS232 place inside a set-top box or IDTV. For Battery discharge time (idle) 24 days TV aerial/dish alignment the pre-BER is Warranty One year the most important factor.

TELEVISION June 2004 455 directional tweak of the aerial. In this and ing, and for checking adjacent analogue are kept in their protective cases. They are several subsequent installation and align- transmissions. more than adequate for their purpose, and ment jobs, I found that the six-hour bat- With Freeview signals the pass/fail compare well with other instruments in tery charge got me through a lot of work. indication is again given in the pre-BER the same class and price range. As with the satellite version, at switch mode. This takes about twenty seconds to I found a reasonable, but not exact, on the HDTM defaults to the top of the appear. The post-BER (WIT') reading has correspondence between the meter's fail stored transmitter list, which can then be a rather longer sampling time, about one indication and signal shutdown with satel- stepped through sequentially by scrolling minute, and is not available in the step- lite receivers. There's more variation with down. Aerial siting and alignment are car- through-channel mode. Freeview boxes, certain more recent mod- ried out in terms of RF level readouts per This meter's RF terminals are of the els being much better at coping with a multiplex: the difference in multiplex sig- BNC type, no doubt in preference to the poor and noisy signal. Take a bow, Philips nal strengths at some sites was very less secure and more wear-prone Belling- and Nokia . . . noticeable. Analogue transmissions are Lee type. So I again made a short exten- In choosing what to buy however it's also catered for, in terms of signal der/adapter lead for each. This also permits important to appreciate the other types of strength, but there are obviously no BER flap-down operation where necessary, and instrument that are available in this field. It readings with these. The preloaded data solves the problem of the undersized hole could, for example, be that a dual (satel- knows the channels used for digital trans- in the flap. lite/terrestrial) instrument would be more mission at each programmed site, but there convenient than a system-dedicated one, or is also a step-through-channels facility. Conclusion that a spectrum-display type would better This is useful when you don't have data These meters both worked well for me, suit your needs — horses for courses, but loaded for the transmissions you are seek- and appear to be rugged as long as they these options both come at a premium. •

AVAILABILITY

The meters are available from Horizon Global Electronics Ltd., 27 Pennant Terrace, Walthamstow, London, E17 5BD.

Phone 020 8281 3777. You can order by email from [email protected] There's a website at www.horizonhge.com EXPORT ENQUIRY'S WELCOME!! WE SELL IV'S,DVD'S,VCR'S,NIFI MIDIO SMALL APPUMCES AND liffitTE GOODS HITACHI SONY BEKO PANASONIC BUSH LG PHILIPS SVA TRADEX DU. DAEWOO MORPHY RICHARDS AKURA LUKER AND MANY MORE TOP NAME BRANDS!! 14" CTV R/C BASIC MICROWAVE BASIC MULTIREGION DVD From om . om 9 £14:à9F £1.99 Trade 30134 River street Dig_beth B'ham 85 5SA Te1:0121 773 3300 Fax 0121 773 2300 ElectroniX WWW.TRADEELECTRONIX.CO.UK [email protected]

, June 2004 TELEVISION °LOUR TRADE

— P O S SIRL Y www.colourtrade.com LAPGEST 1 OI_O r ST WHOLESALE MADE EASY ON LINE, SIGN UP EST. IN NOW FOR OUR WHOLESALE PRICES. T HE 0 V rIST FO P nID Y E A P S ALL ORDERS DISPATCHED ON THE SAME DAY. N o w Available Wholesaler Distributors & Expert Agents of T V's, D V D's, V C R & A U DI O Domestic Electronics & Appliances Over 40 years of genuine experience Experts on: - FULL RANGE OF FACTORY T ho mso n • Sa nyo • B eko • LG • Tatun g • Ferg us on B us h • Fu nai • Pacific • D a nsai • Sa msu ng & m ore GRADED TV's DVD / VIDEOS TE C H NIC AL SU PP O RT HI-FI SMALL & LARGE DO MESTIC GOODS 0 9 0 7 0 7 6 7 0 8 0

MAIN DEALER Thompson San o Be

Tel: 0121 359 7020 Fax: 0121 359 6344 Phoenix House, 190 Bridge St. West, Newtown, Birmingham B19 2YT E mail: [email protected] m

WE WILL BE MOVING SHORTLY - CHECK WEBSITE www.stewart-of-reading.co.uk FOR GENERAL STOCK MISCELLANEOUS CLEARANCE STOCK

OSCILLOSCOPES EM A7 DC Ron an Amplifier £50 Weinschei ,Marcond 4300 Sweep Us‘ 12 4•18u,12 IOC W&G LO-30 Group Delay & Attenuabon Measuring Set MHZ- Tektronix 4658 Dual Trace 100MHZ Delay Idled into 19 rack AWA F2426 Distortion 6 Noise Meter £40 M U M 6610.0 Programmable Sweep Gen I-GHZ £150 20KHZ .f75 frame £125 Exact 121 Sweep Function Generator £50 HP 50060 Signature Analyser £50 HP 75000 Senos B £100 HP 1740A Dual Trace 100MHZ delay £100 Tele Caption 4000 Closed Caption Decoder 1270 £25 Crop« 002 Digdal Ohmmeter £40 Racal Store 4 .£50 Crotech 3030 Single Trace 15MHZ £50 Wizard Power Supply 13 8V 32MAP Unused £40 Racal.Dana 4002 Digital Millimeter £50 RS 550-381 PCB Spray Wash Tank .£40 MARCONI EQUIPMENT Sorenson DCR40206 (1-40V 0-20A £50 HP 34380 Digital Muldneter £40 Joel 71370 Safety Light 6W £15 112300 FM/AM Modulateon Meter £30 HP 3495A Scanner £40 Eaton 7175 Noise Generator Power SupPly £75 Thender TM351 Bench Multmeter 3 12 Digit Battery only £0 TF1073A/2S Variable Attenuate, 750 am DC•150MHZ £15 HP 141S Mt, 8553L 8 8552A Spectrum Analyser 110MH2 £150 HP 51809, Wavelorm Recorder £75 kegs 3 Decade Capacitance Bo. £20 TF260013 AC Milli Von Meter lmV-100V ES() 10H2•10MHZ £20 TekiSony 39061) Programmable Digitmer £30 HP 8016A Word Generator £40 Lionmount COI-3 Decade Capamtance Bo. KO loyG•XO 000mG TF2162 MF Attenuate, DC-1MHZ 600 ohm 0.111d8 £20 TektrOnix 851 N U Tester . £35 SULLIVAN InduCtance 1 Henry £30 020 £25 TF2163 UHF Anenuator DC-1GHZ 50 ohm £50 Tektronix DA59100 Series Digital Malys's System £40 SULLIVAN Premsron lied Air Condensor 1000uur £40 RP 109296 Loge Comoar 31 . 6464V1 Power Meter Mt, Head £95 Wayne Kerr ST10 Standard Capacitor 10uut £30 SULLIVAN Premmon hoed Air Condenser 100uul £40 Tektrono 148 Inserltor, £125 Tf 2331 Distortion Meter £50 Time 505 DC Current Source 0 190 £40 SULLIVAN C1855 Precision Mica Capacitor 001ut £40 TF2173 Synchronise, or TF2016 Sig Gen No linking cables £50 Fluke 8025A Multimeter £20 SULLIVAN C1802 Precision Mica Capacdor 0 1 ul £40 SPECIAL OFFERS 1120059 Two Tone Source £30 HP 3710611438 Transmitter with 37160 B.8 Transminer £50 SULLIVAN £1812 Precision Mica Capacttor tut £40 OSCILLOSCOPES 112100 Bridge Battery Operated £75 HP 3712A IF/B8 Receiver with 32930 Chtf Phase Detector £S0 Bruel A Kiaer 5996 Deltatron Amplifier £50 LECROY MU Due Tract 175MHZ 5610 -- £500 6049/1 Frequency Meter 26 8 2 GHZ £25 HP 37110 IF/138 Transmitter Henrik RT-2M Raped Test Computer Controlled • Audio £50 10CRSn 9400 Dual Trace 125MHZ Fluke 88006 Digital Multimeter • Bench £30 Singer Stoddart NM37/57 EMI/Field Intensity Meter £75 Neutrik RT-1,6 Raped Test Computer Controlled • Audio £50 TEKTRONIX 468 Dual Trace 100MHZ Neal Storage caw Fluke 86006 Digital Muitimeter Bench £20 Exact 170 Ambler £30 Gould M024-15C PSU Module 24V 150 £30 TEKTRONIX 475 Dual Trace 200MHZ Delay Sweep £250 Vinculum M6I3 Ultrasonic Switching Unit £20 H H Speakers Disco Type MID/BASS 2012'1500 Wansi - sold as Gould MG5•100 PSU Module 5V 100A £30 TEKTRONIX 4656 Dual Trace 100MHZ Delay Sweep £50 HP 49516 Protocol Analyser £60 a parr £150 Gould PMG t 5-1 2 PSU Module .15 1 2A £20 TEKTRONIX 465 Dual Trace 100MHZ Delay Sweep £175 HP 4951C Protocol Analyser wrth HP 18179A Interlace £75 HP 8755C Swept Arnphtude Analyser Plug-in - No Probes £20 Gould 1384012.2 7 Pal Module •12V 27A £25 PHILLIPS PM3217 Dual Trace 501ANZ Delay SweeP £150 HP 8709A Synchronizer £40 Gallen Kamp Thermostat Hotplate 0-300 C £20 Gould PMG12-5 5 PSU Module .12V 5 5A £30 THURLBY P13200610 0-300 0-2A Twee 0,906 PSU £160 HP 8742A Reflection Test Und 2-12 4GHZ £30 Ealing Photomultipher Supply with EMI 979813/04 Pflotormiltiplier Selec MIS 248118 PSU Module 240 1 80 fixed £20 HP 66312A 0-20V 0-2A Commuscations PSU £203 HP 87410 Reflection Test Unit 0 1-2GHZ £30 £30 CoutaM LM50/30 0-300 005 Amp £20 HP 6623A 3 Outputs PSU 0-7V 0-5A or 0-20V 626 £425 HP 84134 Phase-Gen Indicator £40 Datapulse 101 Pulse Generator £20 HP 37640 Digital Transmission Analyser opt 001 £150 0-20V 0-2A or 0-50\10-0 BS HP 85041A Transistor Test Froture rgoes with 8510 Network Global 4001A Pulse Generator 0 5HZ-5MHZ £20 Mltutoyo Analogue Micrometer 200mm £20 0-7V 0-10A or 0-2000-4A Analyser) £100 HP 8411A Harmonic Freq Convenor 12 4 GHZ £50 Sylvac Dertal Micrometer 20Ornrn £30 P 6626A %omen High Resolution PSU 4 Outputs £500 HP 64108 Network Analyser Accessories Kit £100 Tes MC6615 Feld Strength Meter UHF/VHF • needs clurger.E40 Tesa 0rgr1a1 Mrcrometer 0-250m £50 0-7V 0-151M or 0-50V 0-0 SA hence HP 1335A Display in 19' rack £25 HP 415E SWR Meter Stag SE15 Prom Eraser £20 0.16V 0-0 28 w 0-50V 0-2A Twrce HP 116040 Umversal Extension £20 Time 202 DC Microvolt Null £30 HP 31106 1E138 Transminer with HP 3710A 1F/B8 Receiver CIRRUS CR1254 Sound Level Meter retti Calibrator 80.12000 LED £95 HP 4437A Attenuate, £20 RS 635-381 Break-out Boa £20 £150 WAYNE KERR 8424 Component Bridge HP 400E AC Voltmeter £20 Marconi 8936 AF Power Meter wrth Salad Fitter . . £30 HP 3711A 1F,BB Transminer with HP 3712A 1F/13B Recerver RACAL 9300 True OMS Voltmeter 5HZ•20MHZ usable to 60MHZ 105- HP 5383A Fred Counter 520MHZ £40 HP 5316A Universal Counter 100MHZ HPI8 .£40 £200 016V £50 HP 62366 Triple Output PSU 0-60 2 50 • - 0-0 50 £40 Racal 9911 VHF Frequency Meter 10HZ•120MHZ £r25 Racal 9913 Frequency Meter 200MHZ £40 RACAL 93008 True OMS Vonmeer 5HZ.29MHZ usable to 60MHZ »Mon 6100 Sweep Gen with 6219 211GHZ 8 61200 7 9• Racal Dana 4008 Bench Degnal Multmeler we, Adapto • £30 Edgeumbe 317-0 Clamp Meter - Analogue £15 105•316V £75 12 4GHZ Plug-ms £100 Thandar 10201 Digital Storage Und • Battery £30 General Electric H-10B Halogen Leak Detector £15 AVO DA116 Neel Avometer wrth Battery and Leads £20 Micro-Tel kASR903 Microwave Receiver £150 Thurtby 1503/10 Deal Mutineer Bench rneMs adaptor) £20 HP 32008 VHF Oscillator 10•500MHZ £60 FARRELL LIMA Sine:Si) Oscillator 10HZ-1MHZ low distorben TIL Output Blicro-Te 1200 Wee Range Receiver £150 Racal Dana F47 Interstate High Voltage Log-Lin Sweep Gen Leader 1008230 Counter 250MHZ £40 Amplitude Meter £75 FAO 25005£1 ,26017S112650SD VHF RecerverfDrive Unit £50 O 0004HZ•4MHZ 40V Peak £75 Comark MS11394 Temperature Simulator £30 FARRELL J38 Sinesq OsalLator 10HZ•103KHZ Low Distortion . £60 Marconi 012357 wall TF2356 Selective Level Meter/Level Racal Dana F41 Hen Voltage Function Generator 0 0004HZ-4MHZ Microsystems MEW Prom Eraser £20 HEME 1000 LCD Clamp Meter 0-10000 In Carrying Case OS Oscillator 20MHZ • Priced per pair £50 £75 AMT RPS3000 RF Power Source 3GHZ 115V Input £200 FLUKE 77 Mulerneter 3 12 Digit handheld eh Battery 8 Leads . £45 Ling Dynamic PO 300 Vibrator Drive and Power OsmIlalor £100 notch 06100 Delay Generator £10 AMT RPS2000 RF Power Source 2GHZ 115V Input £2017 KENW000 011762 Channel Mullivoltneter £50 Plrrllps PM2519 Automatic Multimeter £35 Telequipment C3 Caere!. . £30 AMT RPS1000 RF Power Source 1682 115V Input £200 KENWOOD FL140 WOW 8 Flutter Meter .. £50 Leader LOC 7005 Oscilloscope Callbrator £30 HP 50056 Signature Millimeter £50 AMT RPS50 RF Power Source 50MH2 115V Input £100 XENWOOD EL180A WOW 8 Flutter Meter £75 HP 16300/G Logic Analysers yeah Pods • No Grabbers £75 Hameg HM8001 Main Frame £30 Arnencan Mwave Tech RPS500 RF Power Source 500MHZ 115v XENWOOD EL1130A WOW & Flutter Meter Unused £125 HP 86169 Signal Generator 1 8-4 5GHZ £50 Hameg HM8011 3 Digital Multrnmeter Plug In £60 Input £150 MARCONI 69608 Power Meter wrth 6920 Head 108012 • 20GHZ .£450 Marconi 67000/8 Sweep Oscillator Main Frame only £40 Hameg HM8030 3 Function Generator Plug In Comark 9007 Thermometer £20 SOLARTRON 7150 DAIM 612 Mod True RIM IEEE £75 £75 Wernschel/Marconi 4300 Sweep Oscillator 12 4.18GHZ Plugrn FMI 4510 Signal Source 12•18GHZ R S Component RS232-C Intertace Test Set £15 SOLARTRON 7150 Plus As 7150 . Temperature Measurement . £100 £95 Mid•Cenlury 6626030 Gun Diode Power Supply £25 Lyons PG28 Pulse Generator £30 IEEE Cables Oltrono 832-306 Power Supply 40V 300 £50 HP 33126 Function Gen 0 111Z•13MHZ 01071.1 SereeP/Sqlraurs1 60 Wavetek 1726 Programmable Signal Source No Front Panel Polar 550 Tone Ohm Meter £50 Image Video 6010 10 Channel £30 .£300 Controls £50 Gay Milano IVA Line Voltage Analyser £50 TOA EPP100A Electronrc Polyrecorder £35 HP 3310A Function Gen 0 005HZ•5M2 Sine/Ser1PRebleule4..••- •£80 bocal 0060 Signal Generator 1•1000MHZ £150 Ikegarm Mondor 9' Black & White £30 Datacheck 6110 Senal Analyser £40 RACAL 9008 Automabc Modulation Meter 1 5MHZ2GH2 £60 Tee m SMO Attenuate, 50olvn 1 122d8 £15 Cropmo NEI4 DC Null Detector in wooden boo £40 nata ordse al n quumm Frio, Gon 2MH7 £75 ISOLATING Transformer Input 250V Output 50006 Unused . £30 STEWART OF READING Marconi 2828A Digital Simulator (so RACAL 1792 Rece Ise 110 W Y KE H A M RO A D, RE A DIN G, BE A K S RG6 1PL laSA USED EQUIP MENT - GU ARANTEED. Manuals supplied. Telephone: (0118) 9268041 Fax: (0118) 9351696 www.stewart-ot-reading.co.uk This is a VERY SMALL SAMPLE OF STOCK. SAE or telephone for lists. Please check availability before Callers welcome 9am-5.30pm Monday to Friday (other times by arrangement) ordering. CARRIAGE all units £16. VAT to be added to total of goods and carriage.

TELEVISION June 2004 457 The Sale of Goods Act

The Sale of Goods Act, which originally came into effect in 1979 and was supplemented by Regulations introduced in 2003, affects everyone who has commercial dealings with the public. You can get into difficulties that could involve expense and wasted time if you are not familiar with its requirements. Michael Maurice provides a guide to how it affects our trade

he aim of the Sale of Goods ring to the Trader's Guide. It is users and are therefore not covered Act, which originally came supplemented by information I've by the Act. A consumer is consid- Tinto effect in 1979, is to give gathered in the course of business. ered to be someone who has the consumer greater protection Some points consist of my careful- bought goods for his or her person- against faulty goods and rogue ly considered opinion. I must al use, i.e. not for use in connec- traders. On 31 March 2003 the Sale emphasise that this is a general tion with a business. & Supply of Goods to Consumers guide and that neither I nor the When a consumer buys a prod- Regulations 2002 were introduced publishers can be held responsible uct from a trader/retailer he to supplement the Act. They set a for any inaccuracies. invokes a contract between himself minimum standard throughout and the retailer. In law, the con- Europe, and give the consumer Rights sumer's legal comeback is with the greater rights when buying across According to the Act a product retailer, not the manufacturer. borders. To put it another way, the should be of satisfactory quality If a manufacturer or supplier new regulations and laws effective- and fit for the purpose for which it states that a product will do X, Y ly set in stone the existing laws and is bought. Thus if the customer and Z and it is subsequently found rights of the consumer. Much of tells the retailer that the product he that the product doesn't, it is still what is contained in the following requires must be capable of doing the retailer's responsibility to ensure article is available in a document X, Y and Z, should he subsequent- that the description of the product is called A Trader's Guide, published ly find that it doesn't do what he accurate. The retailer might be able by the DTI (Department of Trade wants he is entitled to return the to argue that he was unaware that a and Industry). This is available goods and receive a full refund. If, manufacturer's claims were false: from the DTI and local Trading however, the customer does not tell but the customer's rights are always Standard Offices. the salesperson his requirements with the retailer. The Act and the new and then, having made the pur- Consumers are entitled to Regulations are quite complex. I chase, finds that the product does receive products of satisfactory will try to explain the various parts not meet his expectations, the quality, taking into account pur- as clearly as I can, especially those retailer is under no obligation to chase price and other relevant fac- that relate to our trade, but must accept the goods back. tors. If an item has a fault that was point out that I am not a lawyer Certain provisions of the Act do present at the time of purchase, and don't have any legal training. not apply to businesses, traders and sometimes called a 'latent' or The information in this article has people who use goods in connec- 'inherent' defect, the customer can been obtained primarily by refer- tion with their business: these are complain when this is discovered. implied rights as to fitness and quality and are covered by the con- What's reasonable? The retailer should tract between the two parties. Thus The word 'reasonable crops up in a customer who finds that a prod- many parts of this article and the either exchange the uct he has bought from you is legislation. But there is no statuto- product, repair it or repeatedly faulty may be entitled to ry definition of what is reasonable a refund or a replacement, but the and what isn't. Dictionaries pro- arrange for the retailer may not have the right to vide a number of definitions. 'Fair manufacturer's demand the same from his supplier. and sensible' and 'fairly good but service department Another example is someone who not especially good' are most like- buys a car for business use, say as ly to be relevant here. There is to repair it. a mini cab. And it could be argued however case law as to what 'rea- that we, as engineers, are not end sonable' means.

I June 2004 TELEVISION Legal remedies the purchaser, on returning it to the Conforming to contract When a product is faulty, the first retailer, is legally entitled to: (a) a When a customer buys a product course of action on the part of the full refund if this is within a rea- he enters into a contract with the customer is to return it to the sonable time of the sale (a reason- seller. The contract usually consists retailer or, if it's a large item like a able time is not defined by law, but of a sales or till receipt. Should the TV set, call the service department. is usually quite short); or (b) a rea- customer subsequently complain If the product is virtually new, i.e. sonable amount of compensation that the product is faulty, what he under 14-28 days old, a replace- (or damages) at up to six years means in legal terms is that it does ment can be requested as it should (five in Scotland) from the date of not conform to contract, though be obvious that there was an inher- the sale. members of the public would ent fault from new. The Act does not mean or imply rarely put it that way. Products do The retailer should either that all products have to last for six not conform to contract when they exchange the product, repair it or years or shouldn't go wrong within are defective at the time of sale or arrange for the manufacturer's six years: it's the limit for making a they fail to work later, even after a service department to repair it. claim against the retailer in respect number of years, because of an There are circumstances under of a fault that was present at the inherent fault, i.e. one that could be which a consumer cannot expect time of sale. It is not the equivalent said to exist at the time of sale. legal redress. These are as follows. of a guarantee. There are a number Products do not conform to con- First, fair wear and tear. In days of implications to this, which I will tract if they do not comply with gone by for example a manufactur- be discussing later. any description given by the retail- er would exclude bulbs and styli Most electrical and mechanical er prior to the sale. from a guarantee or, in the case of goods are covered by a manufac- The Sale of Goods Act 1979 a car, wear to brake linings. These turer's warranty. This often says determines whether there is lack of are considered to be service items. that the goods are guaranteed to be conformity with the contract. It lays Secondly misuse or accidental free of defects for a stated period, down the following requirements. damage, for example if a customer usually one year. What usually The product should match any drops the product or spills water happens is that if a product fails description given to it. It should be into it. In such circumstances the within a short time after purchase, of satisfactory quality, i.e. it should customer cannot expect the product usually 14-28 days, the retailer will meet what any reasonable person to be rectified as though there was exchange it, or will send someone would regard as being satisfactory, a defect. If you are unfortunate to repair it, or will have an agree- taking into account any description enough to be involved in an acci- ment with the manufacturer or a provided, the price paid and all rel- dent while driving a new car, you specialist service agent to carry out evant circumstances. For example, cannot expect the dealer or the the repair. you wouldn't expect a £25 radio to manufacturer's agent to repair it Under the Regulations the con- provide high-fidelity performance under the terms of the warranty, sumer can, when a fault is discov- but, if the description said the fre- the exception being if you could ered, choose to request a replace- quency response was 20Hz to show that a mechanical defect, e.g. ment, especially if the fault devel- 20kHz, then it should conform to complete brake failure, was the ops within a short period of time; a this specification. Even without cause of the accident. repair; or a full or partial refund. such a description, a certain clarity Thirdly, when the purchaser of sound would be expected. And simply decides that he no longer Proving the fault the product should be reasonably fit wants the product. The retailer is Consumers generally have to prove for the purpose made known to the under no obligation to accept a that the product was faulty at the retailer at the time of sale (unless product back simply because the time of sale. This is especially so the retailer disputed the appropri- purchaser, having got it home, when the consumer requests a ateness for the purpose at the time decides he doesn't want it after all refund or compensation. There is of sale). or it doesn't fit — assuming that any an exception to this. When the cus- If a customer says, or it should dimensions quoted are accurate. tomer returns a product to the be obvious to the retailer, that a Indeed if the retailer does accept a retailer within six months of the product is wanted for a particular product back it can no longer be date of sale, the law assumes that purpose, even if this is not the pur- considered as new for the purpose the fault was present at the time, pose for which the product is nor- of a future sale. An exception to the onus being on the retailer to mally supplied, and the retailer this is goods bought by mail order prove otherwise. This is usually agrees that the product is suitable for or over the internet. quite obvious: either the product this purpose, the product must be Neither can a consumer expect works correctly or it doesn't! The relatively fit for this purpose. If the legal redress if an item had a exception here is when the fault is retailer is unsure that the product defect that was pointed out at the intermittent, showing up only on will meet this requirement he should time of sale, or has a defect that rare occasions. make it clear to the customer, should have been evident on rea- preferably in writing (perhaps on the sonable inspection. If you buy a Servicing and repairs sales receipt), to protect himself product that was on display and The Supply of Goods and Services against future claims. Similarly I later find that it's scratched, the Act 1982 requires a service to be would suggest to a customer that if retailer is under no obligation to carried out with reasonable care he wants the product for a particular accept it back. Or, if the product and skill within a reasonable time purpose this should be put on paper has a part missing and this was and, where no price is agreed, the which the retailer should sign before pointed out at the time of sale, charge should be reasonable. This the transaction is completed. In this there is again no obligation to does not apply in Scotland, where way there can be no argument about accept the product back. common law prevails. Again that whether or not the product is suit- When a product is found to word reasonable keeps cropping able for the intended purpose. Here have been faulty at the time of sale up, but has no legal definition. are some examples.

TELEVISION June 2004 459 A customer of mine went to a are compatible with, the onus able', there is no precise definition well-known national retailer to buy being on the consumer to check in law. It is somewhat subjective, a camera and told the salesperson for suitability. but can be taken into account when that he wanted to use it to photo- A customer buys a VCR for the trying to determine whether goods graph sporting events, so it should sole purpose of recording the out- conform to contract. Price is a rele- be able to react and operate put from a CCTV system. He does- vant factor here, so is suitability extremely quickly. He subsequently n't say this, only that he wants a for the use intended. Grounds for found that the camera he bought cheap VCR. If, after nine months, arguing about durability include didn't operate fast enough: by the the heads fail because of the price; inappropriate use; and con- time it had zoomed and focused, amount of use, the retailer can struction and the suitability of the the event was over. When he took hardly be held responsible for what materials used. An expensive prod- the camera back to the shop he would be considered fair wear and uct that uses inferior parts may was, after a lengthy discussion with tear in the circumstances. If how- well fail the durability test, for the manager, sold another one that ever the customer had asked for a example a top-of-the-range VCR performed equally poorly. On VCR to be used specifically for that uses the same mechanism as a returning this one the retailer was this purpose, it would be up to the basic model, or an expensive TV not interested and would not return retailer to ensure that the VCR he set that uses a common, inferior the purchaser's money. Under the sold would stand up to this use. component. Act however the customer was entitled to a refund, as the camera Fair wear and tear Remedies didn't meet the requirements made The law does not state nor assume There are several remedies that a known to the retailer. Had the cus- that products are expected to work consumer can use where a product tomer got the retailer to sign to the fault-free. Indeed it allows for the is considered to have failed to con- effect that he knew the customer's fact that products can and will form to contract, two long-estab- requirements, the customer could break down at some time during lished legal remedies and four addi- have expected to have won his case normal use. Consumers cannot tional requirements introduced in if taken to the Small Claims Court. hold the seller responsible for fail- March 2003. These are as follows. If a customer buys some soft- ure as a result of fair wear and ware to load on to an Apple Mac tear: there needs to be a fault that (1) Rejection of goods. This long- PC and makes it known that the was present at the time of sale. If standing remedy enables a PC is of this type, he has the legal for example a customer uses his customer to reject a product and right to return the software if it's VCR for an excessive number of ask for his money back provided not compatible with an Apple Mac hours and the result is what might the complaint is made within a — because the software does not be considered premature head reasonable time. The Sale of Goods conform to contract. If however wear, he has no legal redress with Act does not provide a definition of the customer does not mention the retailer. If however the cus- what is a reasonable time, but it's that the PC is an Apple Mac, and tomer could prove that the back quite short. A court would, after A set that the retailer had no reason to sus- tension was set at the factory at a taking all relevant factors into obviously pect this, the retailer could dispute higher level than specified by the account, determine what a doesn't conform the unsuitability of the product for manufacturer, then he would have reasonable time should be. to contract. the purpose. Furthermore most a legal right against the retailer. To implement this course of software packages state on the Sometimes a sales contract action, the consumer must advise box the operating system(s) they excludes items that are considered the retailer of his intention to reject

Consumers cannot hold the seller responsible for failure as a result of fair wear and tear: there needs to be a fault that was present at the time of sale.

'service items'. A car manufacturer the product. The consumer is not for example cannot give a warranty obliged to return it, but must make as to how long the brake linings or it available for collection by the the clutch plate will last, as this retailer. The customer would will vary with the driver and the usually return a product, but this way in which the car is driven. If may be difficult where the item is the brake calliper or cylinder bulky or heavy. leaked fluid on to the brake linings however the customer could expect (2) The other long-standing remedy to have the linings replaced under is a claim for compensation, the terms of the warranty. otherwise known as damages. This Many items are not expected to can be used where the customer is last for six or more years. A £60 not entitled to reject the product or VCR cannot be expected to have chooses to do otherwise. the same life expectancy, build Compensation is designed to quality and durability as one that compensate for losses that arise costs £200. from a defective product. The But durability can be a difficult customer may also seek matter. As with the word 'reason- consequential losses. For example

460 June 2004 TELEVISION the customer may seek to have the cost of any postage and packing he incurs reimbursed by the seller or may, having had a repair carried out by a third party, seek reimbursement for this repair. If the customer does the latter however it may make it difficult for him to prove that the fault was present at the time of sale, while the retailer could argue that he should have been given the opportunity to rectify the fault himself and that, by going to a third party, the customer is not mitigating his losses.

(3) Repair and replacement. Retailers and manufacturers have for many years voluntarily provided a guarantee for goods The Sale of Goods Act states that repairs sold. This normally takes the form should be carried out within a reasonable of agreement to repair or, when the product cannot be quickly and time and without significant inconvenience easily repaired, the offer of a to the customer. replacement. This now has legal status, and consumers can quote the Regulations in force since 31 the VCR. Conversely where a 5p cassette recorder wouldn't neces- March 2003 to demand repair or fuse in a £1,000 TV set has failed it sarily be expected to last for eight replacement where the product would be unreasonable for the years, while a 32in. widescreen TV does not conform to contract. customer to demand a new set. set should be usable for eight years or so though not necessarily with- (4) Reasonable time and significant (6) Partial or full refund. If neither out failures. If, after a couple of inconvenience. The Sale of Goods repair nor replacement is practical, years, a spare part is no longer Act states that repairs should be the Regulations provide alternative available, the consumer can claim carried out within a reasonable remedies in the form of either a full damages against the retailer for the time and without significant or a partial refund. To determine remaining part of what might be inconvenience to the customer. whether a full or a partial refund is considered the normal lifespan of Once again these requirements are appropriate or, in the latter case, the set. It is no defence for the vague and would be assessed in what proportion is to be given, the retailer to suggest that the product law on a case-by-case basis. A retailer takes into account the should last for only say three years. reasonable time could be about five benefit the customer has had from If that is proposed, I suggest the working days, but this could vary the product. If, for example, the retailer makes this clear at the time and circumstances such as the product has a normal life span of of sale — though I doubt whether availability of spare parts would say eight years, and breaks down he would sell many products on have to be taken into account. But after five years because of an that basis! the retailer is obliged to minimise inherent fault for which there is no the amount of inconvenience to the remedy, the customer cannot expect Sales receipts customer. He may do this by a full refund as he has had the When a consumer complains that a attempting to speed up the repair or benefit of the product for five product is faulty and seeks a reme- by the loan of a similar product. If years. Thus a reasonable refund dy, the retailer is entitled to satisfy the supplier is made aware that the would be three eighths of the himself that the consumer did pur- product is required for use on a original price. chase the product from him on the certain day, he should ensure that it date claimed. The best way for a is ready for use on that day. To give Supply of spare parts customer to provide this proof is to an obvious example, if a customer There is also a legal obligation on produce the sales receipt that bought a wedding dress and found suppliers, retailers and manufactur- should have been obtained when a fault with it a week prior to her ers to make spare parts available the product was bought. In the wedding, it would be of little use if for at least seven years from the absence of such proof, the onus is the supplier said he would have it time of selling a product to the on the customer to prove that the ready two days after the big day! consumer. If a manufacturer is product was bought from the retail- unable to supply a spare part with- er on the date claimed. A detailed (5) Disproportionate cost. It would out which a product is unusable, credit-card statement is often be unreasonable to demand that a the consumer has a legal right acceptable as proof. retailer pays for repairs that would against the dealer who supplied it If the consumer can offer no exceed the cost of the product. For for the remaining time during proof that he bought the product example the cost of new heads for a which he could have expected it to from the retailer on the date budget VCR costing £70 could, last. claimed, he would be unlikely to along with the cost of labour for This depends to a certain extent be able to pursue a legal remedy. II fitting them, cost say £90. In this on the original cost of the product. case the retailer could opt to replace It might be argued that a £25 radio- Continued next month

TELEVISION June 2004 461 SERVICING the Hitachi A7 chassis Glyn Dickinson provides a repair guide for this chassis, which was introduced in 1998 and remained in production for several years. It was used in a wide range of models, both 4:3 aspect ratio and widescreen

implode spectacularly. So take care he Hitachi A7 chassis was screws. These can be found by introduced in 1998 and was reaching above the video shelf. A over the replacement. Tthe company's first one for chubby screwdriver is handy here! If a Panasonic CRT is fitted you widescreen models. A pared-down can usually heave a sigh of relief! version was used in Hitachi's last Switch-on sequence UK-produced (pre-Vestel) large- In common with most modern sets, Dismantling screen 4:3 aspect-ratio sets, the set carries out a check at switch Even though the 32in. sets are a bit Hitachi's smaller-screen models on run by the microcontroller chip. awkward to handle, I don't recom- being supplied by Daewoo then First the power supply comes on mend trying to service them in the Tatung. The A7 chassis is well- and voltages develop. The standby customer's house. The cabinet front designed, most problems arising light is then illuminated dimly for a can become alarmingly floppy, because of assembly problems or second, after which it becomes especially if the stand's screws poor components. Picture quality is bright. On early models it should haven't been fitted! reasonably good — provided the then dim and the degaussing relay For virtually all repairs it's nec- digital noise-reduction circuit is will click. Software checks are in essary to remove the plastic chassis switched off and the sharpness con- progress at this time. Once these frame. To do this, remove the back trol is set at less than fifty per cent. have been completed (about ten and one black screw by the phono Breathing is quite noticeable with seconds, though it seems much sockets, the extension speaker 14:9 and 4:3 pictures: most people longer) another relay clicks (early socket panel (two screws) if fitted, seem to use the panoramic models again) and, hopefully, the the VGA interface panel if fitted, `Michelin-man' ratio however and on-screen display will appear, fol- and the white plastic rivet by the so don't complain about this. lowed by the sound and then a pic- line output transformer. If this rivet Hitachi has a department whose ture. It's important to remember puts up a fight, cut it off rather than job it is to provide confusing model that the set will return to standby if risk a crack in the PCB. Be careful numbers. They certainly got to any of the checks fail. Something of the electrolytic mounted beside work with the A7 chassis. Models as simple as an over-advanced AI the rivet. Remove the CRT base C2X56TN, C2567TN (Nicam), control will cause this. There can, and the two purse clips that secure C2X86TN (Dolby), C2966 and as a result, be all sorts of difficul- the speaker wires. On later models C2986 are 4:3 aspect-ratio sets. The ties with fault diagnosis. there may be a sub-power PCB — department was then given a W to remove this. play with, so we got the widescreen Tube troubles Remove the tape that holds a Models C24W1TN, C28W1TN, Before any work is carried out I blue wire away from the high- C28W2TN and C32WD2TN. These recommend one thing. If the set is wattage resistors (don't forget to were superseded by the similar fitted with the dreaded Philips tube replace it when reassembling), turn TN2 models, which had the VGA with the middle letters ESF, inspect the chassis over, and cut the transit panel deleted and became the the CRT base. If any components cable tie by the chopper trans- C2X/32W410/430TN (Nicam) and here are burnt the CRT has an former if this hasn't already been C2X/32W510/530TN (Dolby Pro- internal short and, unless the cus- done. Inspect the chassis for 'after- Logic). An S in the model number tomer is a bank manager, repair thought' components, and check simply means a silver cabinet. As will be uneconomic. This might that they won't be fouled by the many CRT variations were used just save you some time. chassis — if they come off, you and the chassis was in production GoldStar tubes fitted in larger- won't ever find out where they for four years' there were numerous screen sets have their own quirk: came from! Mark the position of circuit additions and deletions. This they can suffer from the 'purple- the Al control, then slide the chas- article concentrates on the 28in. neck syndrome', which will trip the sis a couple of inches to the front. widescreen Nicam set. set. It seems to be an inherent Disengage the left-hand side and The sets came with a stand or an weakness with the CRT. Here's a remove the frame. optional video cabinet on to which warning from a tube man. Even the set is located with two pegs and though a purple neck usually means Power supply operation is secured (hopefully!) by two air in the CRT, this tube can still The Hitachi designers work on an

462 June 2004 TELEVISION RL900 AAA II Y Y

I Degaussing 11-1900 4 a EM2A F902 coils 2AT e 7685 D901 0903

in II 0902 in e R901 T900 FBI' 22k cm C905 2W 7220 400V D905 MPG06G

C911jj D910 5202vI MPG06G 0911 C912 1 BYD33J R928 330p 1 33k 1W 114 cls C913 12 C915 1. C926 C910 011, 220 I 470 op 0.1 L904 7 , on I 4170p 16V 50V 1 0905 R924 BF422 0906 FB MPG06G R930 1k5 R903 120k 18 0906 2W C906 JC548B 0903 I100 R914 BUT12AF 16V 1k

R902 ZD903 5k6 27V

R909 22k

0.22 1C900 R912 UC3844 R918 R905 39 56k 100k 2% 0909 1N4148 R911 0902 12k 5589 C909 0907 330p 1N4148 FB 2kV • ,• 0908 e BYV10-40 R908 R907 R917 .1. C917 ..C924 18k 1% 3k3 f 215k 100k 2% um 155 1 353 % IF 0917 C922 • BYD33.1 220p 353 ZD9021 R900 R910 R904 — 1 II— . 18V 330 05 1k2 F-- 1.3W 2w 3W F901 10M 1W 3.15AT

ZD904 10V R920 3k3 2% R922 Mains 5% R919 150 AC 5% 560 au C929 0907 0915 um 3,3 C918 JC548B MA723 IC901 R918 0908 220 I- 1VR923 CNY17F 1k2 JC5488 16V 200

Fig. 1: The power supply circuitry, primary side. Circuit and component-value variations will be found in different versions/models. and F902 are not fitted when RL900 is used.

If it ain't broke' basis, so the used to this end. Once this has been D901-4 rectifiers the mains supply, power supply will be vaguely stripped away (not literally!) you and pin 7 of the UC3844 chopper familiar to those who remember the will see that the power-supply control chip IC900 receives a start- CF72198 series. Thermistors aside, design is fairly conventional. Figs. up supply, about 16V, via R901, this was a good basic design that 1 and 2 show the circuitry on the D905 and Q905. IC900 produces a was refined during the Nineties, the primary and secondary sides of the squarewave drive output at pin 6. result being a very reliable circuit. chopper transformer T900 respec- This is fed to the gate of the I'm not sure whether the Vestel tively. BUK452-60A FET Q901, which is chassis Hitachi is now using will In early models the degaussing connected in series with a continue this tradition .. . circuit uses a relay to isolate the BUT12AF bipolar transistor, Q903. Two factors that are typical of coils completely once they have Thus Q901 drives Q903 at its emit- Hitachi design are low power con- been activated. The main power ter. The purpose of Q903 is to pro- sumption and lots of protection cir- supply uses an optocoupler, IC901, vide a cleaner and more rapid cuits. Much additional circuitry is for regulation. Bridge rectifier switch-off than the FET on its own

TELEVISION June 2004 463 -

can, and seems to help increase its Traditionalists will applaud the preset for the voltage shown in life. Once the power supply is run- inclusion of a good old-fashioned Table 1. The voltage is critical to within 0.2V, so an accurate digital ning the start-up feed is disabled by avalanche diode, ZD970 meter should be used — no AVOs Q906 switching off Q905. This (PGKE180), across the HT supply. here, please! Adjust the voltage reduces consumption. The current that passes through Dead set, fuse blown with the set cold, displaying an the primary winding of T900 is This is an unusual fault but, if the average picture, then recheck half monitored by R910 (0-50, 2W), the mains fuse has failed, you will an hour later. If a test pattern is not voltage developed across this resis- probably find that Q903 is short- available, I find that a text page is next best. With widescreen models tor being fed to pin 3 of IC900. If circuit. Replace the following items the voltage is excessive, IC900 — use genuine Hitachi parts: Q903 the voltage will decrease slightly as shuts down. Q907 and Q908 alter (BUT12AF), Q901 (BUK452- the set warms up. Hopefully the set will now no the operating frequency in the 60A), IC900 (UC3844), R910 standby mode. Q902 protects (0.5Q), R950 (68162 metal film) longer trip. If it still does, there are IC900 when there's an under-volt- and ZD903 (27V). Check all the various possibilities. A noisy IR age condition. other diodes in this area. preamplifier (metal type) may cause noise spikes. An over- The secondary side of the power advanced Al can also cause this — supply is quite complicated, mainly Set trips intermittently because of the protection circuitry By tar the most common complaint check the black level with text. If a (see Fig. 3). IC950 is a quad com- is the set reverting to standby, or GoldStar CRT is fitted, a very parator that monitors various volt- tripping out then reverting to chan- slight reduction may be needed. If ages and shuts down the power nel 1. Although the cause is usually the trip operates at high volume supply, via the microcontroller dry-joints, to avoid recalls it is and contrast levels, it's permissible chip, should a fault develop. worth carrying out the following to reduce the sensitivity slightly by Comparator 1 monitors the 26V procedure. turning VR923 anticlockwise. audio supply at pin 6; comparator 3 Resolder the HT preset VR950. If the set still trips, panic. monitors the conditions in the line Resolder the line driver transistor Recheck for dry-joints and monitor output stage at pin 8, i.e. current Q701 and the transformer and the HT to try to isolate the fault. through the line output transistor capacitors in the line output stage. We've had a faulty HT preset and a Q751; while comparator 4 monitors Trim any leads in this area — the loose core in the chopper trans- the 200V supply produced from a shears didn't always cut these dur- former cause this, also the CRT — tap on the line output transformer, ing manufacture — and check the the trip is so quick that we didn't and hence the EHT, at pin 10. LT soldering here. see the red flash at first, but flicking protection relies on reverse-biased Next to the middle of the PCB. in and out of text provoked it. A diodes: D962 (18V supply); D963 Resolder IC951, IC952, IC602, new CRT was the cure, though I (8V supply), D969 (5V supply); Q601, Q957, Q951 and R986 — was far from convinced that it and D972 (5V standby supply). dry-joints here are the most com- would work! Check the degaussing Comparator 2 is used as a mon causes of tripping. circuit: in the quest for low power a 'power-good' detector. Should a Now turn the chassis over and relay was used in early models, but brief mains supply interruption that inspect the area between the audio later ones use a conventional circuit, could lock-up the microcontroller heatsink and the front switches. so check for an intermittent posistor. chip occur, this comparator will There are several through-board If the set trips only in the cus- shut down then restart the power links here: resolder them. There are tomer's house, check for energy- supply to initialise the set. Bear this also three between the field output saving light bulbs that can cause in mind when investigating difficult IC and the LOPT, and two around random IR interference. Also make intermittent trip faults. the jungle IC. sure that the mains socket is good The HT is set by VR950, which A couple of other things should and secure: a drop-out will not nec- forms part of a potential divider be checked. If R950 (68W, near essarily affect the picture but will with R950 and R953. Error sensing the HT preset) is a carbon resistor, activate the power-good compara- is carried out by Q954, whose replace it with a metal-film type tor which will deliberately trip the emitter is held at 6.2V by ZD950. (part no. 0113795). If it's not pres- set. Block-type mains adaptors Don't be fooled by this. Despite its ent, fit modification kit J3333961. should not be used, and check any circuit reference number, ZD950 is Don't get too alarmed — it's a dubious multiplugs. a voltage-reference diode, not a spring! Fit the longer end to the zener diode, and measures open- core of the line output transformer, Set trips permanently circuit. It must be replaced by the then push the other end through In this case the set remains dead or correct type (BZV10). A 6.2V nearest hole in the line output tran- tries to start then immediately shuts zener diode will shut down the sistor's heatsink and secure it on down. This points to an over-volt- power supply, or make it behave the adjoining tag. Although this is age or, more usually, excess-current erratically. Q954 drives the LED in not specifically advised, I think it is condition. Check and resolder the IC901. good practice to thread the spring possible dry-joints listed above — In standby the LT supplies are through a piece of sleeving in case you will need to anyway! — and switched off by a high from pin 24 it becomes detached. The purpose check that R950 is up to standard of the microcontroller chip. of the spring is to prevent static (if in doubt, replace it). But the The LT voltage regulators are build-up that can cause spurious most common cause is a short in conventional: IC951 is the 5V regu- tripping. the line output stage, either the x lator, IC952 the 5V standby regulator Hopefully the set will, once line output transistor Q751 while Q957 regulates the 8V supply. reassembled, run. Adjust the HT (BU2508AF, Hitachi specification)

464 June 2004 TELEVISION 470p

T900 11974 FB 10 5W 26V D952 BYW29F-200 C955 BD438 18V regulator (IC953) WM 3300 Protection Circuit d fitted 35V (see Fig 3) R992 R993 18 680 4W

11982 ec546B 1k L950 vArkv

IC548B C967 8981 0950 BYR29F-700 T47n 217 7irziC977220 200V To 16 protection 0959 outpu prof cct. (see F(g.3) 470p R986 D963' •1N4531 > 560 2W 12 FB 5% o • 1---1 M11- 1 • 8V 0951 BYW29E-200 0957 11991 C957 R989 BD909 I 1000 4 7 35V "1g 1W ID957 R948 6.8V 1k On/standby D965* switching from IC001 0966' C979 11951 JC548B 12k 47n IW 0967 11950 R9504 BAT85 D974 68k 33k • 5V 1W MPG06G L7805CP 0970*

IC901 R9524 10k 5% 0972* BF422 VR950 11947 L905 IC952 5V 1k 82k 7805 standby 5% Izm C970 C964 r=1C974 11953 T1000 ZD950 2k7 4.7 470 10V BIV10 50VT 16V 5% Fig. 2: The power supply cir- T cuitry, secondary side. Circuit „t and component-value varia- tions will be found in different versions/models. or a disc-ceramic tuning capacitor If the set works when brought comes from! The 26V line carries (values vary, but the offender will into the workshop, suspect that quite a current, and if the relevant usually put its hands up!). When someone has put an audio phono trip is disconnected there can be a replacing the transistor, check very lead in the 18V supply for the IR minor explosion. The value of R766 carefully for dry-joints in the line speaker extender. This can result in (emitter of Q751) is critical (12, driver area and replace the line driv- R975 (22Q, 2W) overheating slight- 10W, 5%). er transistor if you are unsure about ly — the supply regulator IC953 usu- As previously described, the trip it. Very often the customer will com- ally survives. A knock-on effect is circuitry is based on IC950. To isolate plain about a shifted picture before that the audio item connected does- all the trips (beware!!!) desolder pin the failure. Check and resolder the n't take too kindly to 18V in a signal 12 (earth) of the IC. A better course is through-board links by the jungle path, the result being another repair! to remove each diode in turn — chip as well to avoid a recall: there The next suspect in line is the remembering that the last one to be is also a hidden one next to IC950. field output IC — very often repeat- disconnected will be the faulty one... If the line output stage is blame- edly switching the set on will reveal less, the next favourite is the audio field collapse or half a raster. Hum bar output stage, which is based on If the set is still tripping, it's time A hum bar on the screen can be IC4000. Not surprisingly, damage to check the protection circuitry. The caused by the degaussing circuit in here is usually caused by someone circuits themselves are quite reliable, later sets without the relay. A modi- adding extension speakers. Failure so they are generally responding to a fication sheet is available to rein- can take out part of the 26V rail, fault — don't be tempted disconnect state the relay if necessary — the Q951 often being damaged. them and look for where the smoke idea is to prevent any current what-

TELEVISION June 2004 465 5V

R957 0955 R078 11V o 1k2 1N4531 100 Powerguard ire -11111 —e — V\A' *›- to IC001 R956 5V pin 60 1k2 5°. R960 IC950-4 0957 R97 4k7 10k R955 1N4531 470k 1% 13 ii

EHT sensing D959 it from ZD717 From 1900 MPG066 15k 1% pin 12 R963 ele C961 220k C962 5V nel C976 IC954 1n5 0961 T1 TL431 50V BAT254 R019 °1 T 10k

R974 0958 R065 R013 1N4531 220 100 Protection LT from 0951 output to D952/C955 IC001 pin 22 R985 470 R967 R968 2W 5°. 11k5 1°. 10k 1°.

0960 R972 MPG06G 64k9 IC950-3 1°.

R969 P964 10k 4k7 1% 4k7 1% 1°. From 0972 etc R970 From emitter 11k 1°. Fig. 3: The protection circuitry of 0751 in the A7 chassis.

soever flowing via the coils once driver (Q601) is used — the design- The only fault I've had here was degaussing has been achieved. It ers felt that IC601 ran too hot when distortion with one AV input. It was also has the advantage that its internal EW amplifier is used. caused by the IC. degaussing is controlled by the 5V The smaller-screen models may not If fitted, the Dolby circuit uses a line, so a set left in standby will be have Q601 fitted, instead using Yamaha YSS241 chip in conjunc- degaussed at switch on. It's a fairly IC601's amplifier pins 11 and 12. tion with IC400. It's virtually trou- involved modification, so make Most faults here are confined to ble-free. Any odd buzzes are usual- sure that this is the cause of the the IC, dry-joints and dried-out ly caused by incorrect cable route- fault — by temporarily disconnect- capacitors. One 'fault' that can be ing. External amplifier-speakers are ing the coils first. misleading is when the lower half used, so the outputs are via four of the picture is blanked out phono plugs. Understandably, not Field and EW circuits because someone has switched on much happens when a customer In the large-screen models the the blanking in the vertical adjust- connects conventional speakers to field/EW chip IC601 is a conven- ment menu! This is always handy these outputs! tional TDA8350Q. It's fed by the as a test for some know-all who The original Dolby sets came 27V supply, which is derived from isn't familiar with the chassis . . . with IR wireless speakers. The pin 5 of the LOP'!', with flyback advantages were dubious — a boost derived from the 200V sup- Audio stages power lead to each speaker was ply. This IC is more reliable than in Basic versions of the chassis use still required. More seriously, there other chassis because, in most IC4000 (TDA7263M). As previ- were pops, crackles, drop-outs and models, a separate EW MOSFET ously mentioned, it can short inter- hisses, especially with non-Dolby nally. Remove it to check if it's the broadcasts. Conventional amplifi- Table 1: HT voltages for different models cause of tripping — often there's a er-speakers were supplied with hole in the side! An intermittent later sets. Model HT crackle can be caused by a through- board connection by the IC. Check The signals circuitry 2156/2186 110V the connections to R4005 — it can As with most modern sets, this area 2156/2186 (later version) 109V be missed, as it's hidden between is relatively trouble-free. On the 2556/2586/2856/2886 152V two capacitors — and R4009. odd occasion the tuner fails, with 24/28W 152V Switching and stereo processing predictable symptoms. The scan 24/28W (Panasonic CRT) 142V is carried out by IC400 sockets can be changed to AV, RGB 32W 150V* (TDA9875). Fortunately it doesn't or S-Video via the menus. Scart-1 2966/2986 150V seem to cause much trouble, as the doesn't always switch when pre- 2556 (Toshiba CRT) 115.5V switching circuits are a nightmare — sented with an AV signal, or choos- *originally 149V especially as shown in the manual! es ROB which is incompatible with

466 lune 2004 TELEVISION some Sky boxes. It is usually best noisy 5V rail, dry-joints, a faulty to use Scart-2 for satellite reception IR receiver or the front-panel and force AV mode through the switches (check by replacement in "More ..." menu. both cases). Make sure that the set The processor used varies. Early isn't tripping and resetting the models were fitted with a micro. Carry out a very careful TDA8375, which was subsequently inspection of the PCB around the changed to a TDA8843 then a customer controls — spillage here TDA8841. These ICs are not inter- can cause all sorts of trouble. changeable, and care must be taken Remember that the LED should that a replacement has the correct glow bright, then dim as the set C969 suffix — there are six possibilities. comes out of standby. To bring it 220 Unstable text and on-screen dis- out, press and hold the P+ button: 16V plays are usually caused by a dried- if the light doesn't dim, investiga- out capacitor in the deflection cir- tion in the microcontroller area will cuit — C601 (220/4F, 35V). have to be carried out. More often Poor picture is a complaint you it dims then reverts to bright: this is get occasionally, usually described a trip condition, and investigation Fig. 4: The degaussing relay drive circuit used in earlier production sets. as being over-bright or with loss of should take place elsewhere as pre- detail. The picture is usually fine at viously outlined. switch on, but the contrast gradual- For those not familiar with egory. The set will not know what ly increases until the controls won't Hitachi tuning systems, to tune the it is. If you are determined to do it, go low enough, with corresponding set press and hold the menu button. make a shadow copy of the data overshoot. Much time can be wast- An additional line (install) will first. It's usually best to obtain a ed looking for a heat-related fault. appear, enabling the tuning func- replacement EEPROM and tweak it The cause of the problem is our old tion. A quick method of temporari- as required. When adjustments friends the earthing points on the ly tuning a channel is to use the CH have been completed, remember to PCB. The problem areas are around button on the remote-control unit go to 'exit service menu' to memo- 1501 and between the LOPT and and type in its number. rise and return the set to standby. the field output IC. All the through- Odd complaints with early sets, holes here must be reworked care- The service menu such as inaccessible text pages, fully — on both sides of the PCB, as Access to the service menu is simi- inability to tune in higher channels a resistance of only a couple of lar to earlier models. Select menu or problems with Sky remote com- ohms can wreak havoc with the then press vol+ and vol— on the patibility, can be resolved by picture. Any apparent beam-limiter front panel simultaneously for changing the EEPROM to one with faults are also usually caused by about five seconds until another software version 3.0. Press menu problems in this area, though tap- three lines appear: install, service repeatedly in the service mode to ping the PCB will rarely cause the and exit service. This may take a see which version is running. symptom, suggesting that there's a few tries, as it can be a bit fiddly. I Problems are usually confined to component fault. am extremely reluctant to adjust versions lower than 2.0. anything in the service mode — The brain unless I know that someone else In conclusion The microcontroller chip IC001 is hasn't been so cautious! Once the dry-joints have been dealt an 80-pin surface-mounted device, Adjustment of the geometry and so with and modifications have been type SAA5296/7. The difference on is fairly straightforward, but do carried out this is a very reliable between them is the location of thé remember to check all resolution chassis. The A8 and A20 that fol- program code, which is internal modes after any changes. As lowed it are similar, but use switch- with the SAA5297 but external, in always, it makes sense to make a ing regulators in the LT circuits. EPROM IC002, with the note of the settings — some soft- This solves the dry-joint problem SAA5296, an interface chip ware uses bargraphs, some num- here, though the through-board (IC003) being required. Remember bers. Cathode level is best set at links are still a problem, especially that this is not the same as the set- 77V with a test pattern, though the on the digital processing panel. tings EEPROM which, in both manual originally suggested 84V or Following these chassis, Hitachi cases, is IC005 (type ST24W16). 91V — GoldStar CRTs can overrun pulled out of European CRT-based IC004 is an analogge switch that's and trip the set at this level. TV set production to concentrate used to route the IzC bus. The details of the set can be on plasma displays. Current large- As in most chassis the micro- found under options. The size of screen Hitachi sets use the ubiqui- controller chip is very reliable: the screen is important here, though tous Vestel 11AK19 and 11AK33 replacement is usually unnecessary usually the Model number is chassis, with minor modifications and can cause all sorts of other W2D/TN instead of -410 and -510. to the trip circuits and software. Ill problems. If there is a problem, Under options you will see two start with the EEPROM,and then extra lines that might be unfamiliar look for a load on the IzC bus — shipping mode and factory mode. caused by another part of the Shipping mode does what it says — My thanks to Dave Evans, circuitry. Check for oscillation at returns the settings to default. This Hitachi TLO supremo, pins 57 and 58 (12MHz crystal) is useful if the memory is hopeless- and Hitachi's computer of IC001. ly corrupted. Factory mode, like brain dump for assistance Random channel changes and/or formatting a hard disk, falls into with this article. volume changes can be caused by a the "don't even think about it" cat-

TELEVISION June 2004 A holiday at 1111lumen Ron Bourne recalls training back in the Fifties, when he attended a course at the Murphy Radio factory in Welwyn Garden City

uring the early Fifties I was ing much of the first morning on the around the god we were going to invited to go on a course on principles of the blocking oscillator, worship in our future years — a large Dtelevision at Murphy Radio which was widely used as a TV 12in. console TV. At that time pro- Ltd., Welwyn Garden City. This timebase generator. We were then grammes ran from 8 to 10 p.m., not was a major event in my life. introduced to the complex TV signal counting breakdowns during which Nowadays we travel all over the waveform, inter- an interlude was shown. We world without a thought. In those lacing, sync sepa- Model VI 14C which saw a plough going up and days London was a distant city. ration, the thyra- had a nine inch screen down a field. Don't forget There were not many cars on the tron and other and was manufactured that in those days all pro- in1949. roads — only bosses had them! So matters. grammes were live. Even the journey was to London on the After lunch in so, it all seemed to be a LMS then, via the underground, to the works can- miracle. We couldn't fore- Kings Cross to join the local LNER teen we were see what the future would service to Welwyn Garden City. shown the hold. During this latter part of the jour- workbenches Our training lasted for ney I had my first glimpse of the where we six more days. It included TV transmitting aerial at Alexandra would do our an introduction to the new Palace, the only one in the country practical work. idea of deriving the EHT at the time. They would be supply from the flyback condemned out- pulses in the line timebase. Our landlady right today. The We thought this wouldn't I can't remember the name of our benches were catch on, because of poor reg- landlady — there were about six of made of Dexion ulation. There was nothing like a us engineers. She was a formidable angle with a chipboard sur- sharp scanning line with good reg- lady whose husband had been face, and along the front there ulation, provided by a lethal mains- ordered to sleep in the garden shed were power sockets coupled by con- derived supply! to make room for us! Her view duit we were told we mustn't touch seemed to be that everyone who while looking at the test sets as they The sets hailed from north of Watford were earthed! Some of the sets had The construction of the sets in the lived in a cave. I was chassis that were at half mains early Fifties would not be believed bottom of the pile potential, so there would be today. Their heavy metal, sprayed when she discov- no way of escaping an chassis would nowadays satisfy a ered that I was electric shock. We were car body shop inspection. The cabi- from Stoke-on- told to keep our left nets were made of highly-polished Trent. So I hand in our pocket. No wood. De luxe sets had folding ended up in the isolating transformers in doors. Genuine, lovely pieces of attic bedroom those days! furniture — no plastic then! with an engineer The main Murphy Later, one de luxe Murphy set from Rugeley. TV product at the time had a 15in. CRT that was operated At breakfast was Model V114, a at 15kV derived from the mains. she told us the heavy beast with a huge The EHT generator circuit was at rules of the house. power transformer on the the base of the large cabinet. It In before 10.30 p.m. bottom chassis. It produced used two EHT valve rectifiers in a no keys. She then a killer mains-derived voltage-doubling arrangement. This enquired if anyone A 1953 Murphy twelve inch 6kV supply for the set's was a real killer — I've seen a one- model V210C. played whist? I2in. CRT. A UU* full.. and-a-half inch arc-over. You had Everyone decided that they were not wave rectifier valve was used to pro- to make sure that the large smooth- familiar with cards. Obviously she duce the HT supply. Even the vision ing capacitors were discharged with would have had to win! IF detector was a small, clip-in an earth lead. If you discharged thermionic valve — there were no them with a screwdriver its tip At the factory semiconductor devices in those would be blown off! The next day about twelve of us days! assembled in a small class room at After dinner at our lodging — Return the factory. We were, in this unfamil- there was still food rationing at the We returned to our workshops to iar environment, going to learn about time — some of us went to the facto- await our turn in the evolution of the mysteries of TV circuitry. There ry canteen where, in a darkened television — the opening of the were two tutors. I remember spend- corner, there were some chairs Sutton Coldfield transmitter.

468 June 2004 TELEVISION ata Id listributor of electronic components Television Repair / Mod Kits

On? M AI » Ut 011eedZli M W 7721 ecce Hrell CrI1V 6VDCI 011Gerl l u UTPIPC4 » Dg 10C MIL » C UI 010Dga. à MODE M BA (00D,Dan,M..eolauwee Ii20TeVDOW70..cecxocualoce ,Dzuvenee 14521 PSU ONWAKIT F16 PSU GOODKITi CT25A4STx TDA 8178S MITSKIT1 CI5944 FRAME SAMKIT2 1427T PSU ONWAKIT F18 VIDEO GOODKIT CT25A6STx TDA 8178S MITSKIT1 CI6844 FRAME SAMKIT2 1402 PSU ONWAKIT CT25AviB PSU MITSKIT3 VIK310 PSU SAMSUNGKIT 14557 PSU ONWAKIT 012DGID0(#3 CT25AV1BS PSU MITSKIT3 VIK320 PSU SAMSUNGKIT 14561 PSU ONWAKIT CUC 2050 PSU MODKIT48 CT25AV1BD PSU MITSKIT3 VIK350 PSU ... SAMSUNGKIT 1458T PSU ONWAKIT CUC 2051 PSU MODKIT48 CT25AV1BDS PSU MITSKIT3 VI375 PSU SAMSUNGKIT 1459T PSU ONWAKIT CUC 2058 PSU MODKIT48 CT28AV1B PSU MITSKIT3 V1395 PSU SAMSUNGKIT 1499Y STANDBY MODKIT37 CUC 2059 PSU MODKIT48 CT28AX1BD PSU MITSKIT3 WINNER 1 PSU SAMSUNGKIT 14SLTX STANDBY MODKIT37 CUC 2080 PSU MODKIT48 CT28AV1BDS PSU MITSKIT3 1799Y STANDBY MODKIT37 CUC 7350 GRUNDIGKIT1 CT29AS1 TDA 8178S MITSKIT2 ecedie 2002 PSU ONWAKIT CUC 7301/3 CT29A4 TDA 8178S MITSKIT2 51CSO3H PSU SHARPKIT1 2009B PSU ONWAKIT (BUZ90) PSU GRUNDIGKIT2 CT29A6 TDA 8178S MITSKIT2 51CSO5H PSU SHARPKITi 2052T PSU ONWAKIT CUC 7301/3 CT29B2 TDA 8178S MITSKIT2 56FW53H PSU & DOLBY MODKIT45 21521 PSU ONWAKIT (MJF 18004) PSU GRUNDIGKIT3 CT29B3 TDA 8178S MITSKIT2 59CSO3H PSU SHARPKIT2 2099TX STANDBY MODKIT37 CT29B6 TDA 8178S MITSKIT2 59CSO5H PSU SHARPKIT2 BTV17 STANDBY MODKIT37 CT33B3 TDA 8178S MITSKIT2 59CSD8H PSU SHARPKIT2 CTV501 PSU ONWAKIT M5 SERIES PSU MITSKIT3 HIT14RC PSU ONWAKIT 590S03H PSU SHARPKIT3 CTV701 PSU ONWAKIT 59FW53H PSU & EW MODKIT49 CTV840 PSU ONWAKIT JLL1IG KK Ii 86CS03H PSU SHARPKIT2 CTV841 PSU ONWAKIT J'Y@ CE25 CHASSIS PSU NIKKAIKIT1 88CSO5H PSU SHARPKIT2 CTV485 PSU ONWAKIT AV29SX1EK FIELD 0/P JVCKIT1 C289FTXN PSU NIKKAIKIT1 AV29SX1EN FIELD 0/P JVCKIT1 66CSD8H PSU SHARPKIT2 AV29SX1EN1 FIELD 0/P JVCKIT1 C28F41FXN PSU NIKKAIKIT1 66FW53H PSU & DOLBY ....MODKIT45 AV29SX1PF FIELD 0/P JVCKIT1 66FW53H PSU & EW MODKIT49 CT1417 PSU ONWAKIT AV29TSIE1 FIELD 0/P JVCKIT1 66FW54H PSU & DOLBY ....MODKIT45 CT2159U PSU ONWAKIT cucuechuge C14E1EK PSU ONWAKIT 10561 TDA 8175 PANKIT1 66FW54H PSU & EW MODKIT49 CT2162UNT PSU ONWAKIT C14T1EK PSU ONWAKIT TX25XD60 VERT OUTPUT PANKIT2 76FW53H PSU & DOLBY ....MODKIT45 CT2863UNT PSU ONWAKIT C21ET1EK PSU ONWAKIT TC28XD60 VERT OUTPUT PANKIT2 76FW53H PSU & EW MODKIT49 CS21M3EK PSU ONWAKIT TX28XD70 VERT OUTPUT PANKIT2 76FW54H. PSU & DOLBY MODKIT45 Dg@ CA T Jc TX29XD70 VERT OUTPUT PANKIT2 76FW54H PSU & EW MODKIT49 F SERIES PSU MODKIT30 Tx-w26D3 VERT OUTPUT PANKIT2 DA-100 CHASSIS....PSU & EW MODKIT49 TVC563 STANDBY MODKIT37 0M M» 1455 PSU ONWAKIT 1496R/T (H3N90) PSU MODKIT43 poulpe 01C)I17 eoweva2 1496RTT (BUZ90) PSU MODKIT44 310 10708 PHILKIT3 SLv715HB VCR -PSU MODKIT40 CF25A5OF FRAME MODKIT36 1498 PSU ONWAKIT 310.20491 PHILKIT2 SLv777UB VCR - PSU MODKIT40 CF25C22C FRAME MODKIT35 2086 PSU ONWAKIT 310 20496 PHILKIT10 CF28A50F FRAME MODKIT36 2096R/T (H3N90) PSU MODKIT43 310.31994 PHILKIT6 U110128CON CF28C22F FRAME MODKIT35 2096RfT (BUZ90) PSU MODKIT44 310 32252 PHILKIT5 35029400 THOMKIT2 CF28C28F FRAME MODKIT36 2098 PSU ONWAKIT 310.32253 PHILKIT4 3Fv507605920 THORNKITi CF29C42F FRAME MODKIT35 21V1N (BUZ90) PSU GRUNDIGKIT2 310 32254 PHILKIT9 PSU THORNKIT1 21V1T(MJF18004) PSU GRUNDIGKIT3 310 32255 PHILKIT7 ICC7 CHASSIS TDA8178FS THOMKIT 1 tOODtelin0 TVR 180R/208 STANDBY MODKIT37 310 32262 PHILKIT8 ICC7 CHASSIS FRAME THOMKIT3 147TT PSU ONWAKIT TVR1857 STANDBY MODKIT39 310 62264 PHILK1T1 ICC8 CHASSIS TDA 8178FS THOMKIT1 1491 PSU ONWAKIT ANuBIS A SOPS PHILKIT2 ICC8 CHASSIS FRAME THOMKIT3 1430RA PSU ONWAKIT £11?&5VD MIS CP110 CHASSIS SOPS PHILKIT6 ICC9 CHASSIS EAST/WEST THOMKIT4 G90A CHASSIS SOPS PHILKIT10 ICC17 CHASSIS 143ORS PSU ONWAKIT AV1 SERIES PSU MITSKIT3 PSU MODKIT41 G90B CHASSIS SOPS PHILKITio 1430RW PSU ONWAKIT CT1M5B PSU MITSKIT3 RI s3s0200° (TV -OVO) PSU MODKIT46 G110 CHASSIS SOPS PHILKIT3 PSU THOMKIT2 146oT PSU ONWAKIT CT21M5BT PSU MITSKIT3 GR2.1 CHASSIS SOPS PHILKITi R4000 PSU THOMKIT2 1455TS PSU ONWAKIT CT25M5BT PSU MITSKIT3 GR2.2 CHASSIS SOPS PHILKIT1 TX92F CHASSIS ....EAST/WEST THOMKIT4 2019R PSU ONWAKIT CT21A2STX TDA 8178S MITSKIT1 D-16 CHASSIS SOPS PHILKIT6 2029T PSU ONWAKIT CT21AX1B PSU MITSKIT3 HSM VIDEO SOPS PHILKIT5 2029TA PSU ONWAKIT CT21A3STX TDA 8178S MITSKIT1 JSM VIDEO SOPS PHILKIT4 COMPACT 11 PSU MODKIT47 CT21AV1BS PSU MITSKIT3 KSM VIDEO SOPS PHILKIT9 F16 CHASSIS FRAME GOODKIT1 CT25A2STX TDA 8178S MITSKIT1 LSm VIDEO SOPS PHILKIT7 F16 CHASSIS LINE GOODKIT1 CT25A3STx TDA 8178S MITSKIT1

@C OQ re. Pi?J 02 DC43 @OE A' P ZICCIN D 20 e2 6 0 0g/ 2 20(eg GO OD KIT1 £ 11.00 MODKIT35 £ 9.50 MODKIT46 £ 12.00 PHILKIT2 £ 2.50 SA MKIT2 £ 8.00 GRU NDIGKIT1 £ 10.50 MODK 1736 £ 5.00 MODKIT47 £ 15.50 PHILKIT3 £ 4.00 SAMSU NG KIT £ 16.00 GRU NDIG KIT2 £ 10.50 MODKIT37 £ 6.50 MODKIT48 £ 8.00 PHILKIT4 £ 4.25 SHARP KIT1 £ 11.00 GRU NDIGKIT3 £ 10.50 MODKIT39 £ 8.50 MODKIT49 £ 13.00 PHILKIT5 £ 5.75 SHARPKIT2 £ 11.00 JVC KIT1 £ 11.00 MODKIT40 £ 6.00 NIKKAIKIT1 £ 12.00 PHILKIT6 £ 5.50 SHARP KIT3 £ 9.00 MITSKIT1 £ 3.00 MODKIT41 £ 6.00 ON £ 12.00 PHILKIT7 £ 7.60 THO MKIT1 £ 7.00 MITSKIT2 £ 15.00 MODKIT43 £ 7.00 PAN KIT1 £ 15.00 PHILKIT8 £ 4.25 THO MKIT2 £ 12.00 MITSKIT3 £ 6.00 MODKIT44 £ 7.00 PAN KIT2 £ 9.00 PHILKIT9 £ 7.50 THO M KIT3 £ 9.00 M ODKIT30 £ 10.00 MODKIT45 £ 4.00 PHILKIT1 £ 10.00 PHILKIT10 £ 8.50 THO MKIT4 £ 4.00

0 ,9w ,i,Tylryfig Id eci41\y/iJ di Philips L01. 1E Chassis PSU Repair Kit Veste! 11A K31 Chassis PSU Repair Kit

Fits the following models : Fits the following brands : Bush , Goodman , Hitachi , Toshiba 28PT4457/05, 28PW5407/05 , 28PW6006/05 Models BD2851S , BD2951S , BD2581S, BD3251S

Order Code : MODKIT50 Order Code • MODKIT51 Price: £ 18.00 + vat Price : £ 10.00 + vat

X. P. H ou se Unit e Pup IN tUrnmeruflail (Là.r.rec9 e ").uus'hwz...1) ,iVsiibJj e bliddbe4:2 1-1J-V) Te0: ((Cil)) ,L3C10 Mâ trx Pi2u) 13.»â Lerf-1.à11 Gra -Aata distributor of electronic coemon Digital Satellite Accessories

eci Duacre 2GicuiDo® â else' DIwItleg LiWJ S ii72(iJef). iW 6,LaCr ey® 12(Dawcigi CGICDCXDO ,D,Lez Mau* à'y, CDuleowCIDD

Order Code : RCSKY Order Code : SKYPACK1 Order Code: SKYPACK2 Price £ 7.95 + vat Price : £ 16.00 + vat each Price £ 13.00 + vat each 5 or more £ 7.45 + vat each 5 + 5 + £ 11.50 + vat each £ 14.50 + vat each 10 + £ 6.95 + vat each Carriage Charged at £ 5.00 + vat Carriage Charged at £ 5.00 + vat Carriage Charged at £ 5.00 + vat .17MIM =rMW•1 elm i1r ays, Ay® âLez LàwpL y lPepese n Allows control of Sky " Digibox via the signal feed for For use with aerial amplifiers and Skyn" Digibox second TV Order Code: TVLINKEYE Order Code Price Allows for operation of Link Eye in 27833R conjunction with a distribution £ 10.00 + vat amplifier £ 5.80 + vat each 5 + Order Code 27829R 10 or more £ 7.99 + vat £ 4.80 + vat each each Price: £ 5.00 + vat Satellite Repair / Mod Kits

A in s &toe A ni same enowehj 1)22'9,00 D2a9D0 DIW1100 Digital Satellite Receiver eDmeD J eoe m Digital Satellite Receiver Tuner Repair Kit PSU Reliabilty Kit PSU Repair Kit Repair Kit Early psu Repair Kit LATER psu TYPE REV 03 Order Code Order Code Order Code MODEL DSO - 0385 REV C DSO - 0375 REV A DSO - 0385 REV 5 SATKIT36 SATKIT37 SATKIT35 Order Code Order Code Price Price Price SATKIT34A SATKIT34B £ 1.40 + vat £ 12.00 + vat £ 13.50 + vat Price: £ 10.00 + vat Price • £ 10.00 + vat

Dletteel e34)C9013C® P JJJ IJJJ 1)4J_ HILI cD11C0001G. Yeam Suitable for Amstrad DRX100 DRX200 Suitable for Panasonic TU-DSB20/30 , TU-DSB31/35 Grundig GDR200 , GDS200 Pace Digibox plus many more analogue makes and models Order Code: FANKIT1 Order Code: FANKIT2 Price: £ 10.00 + vat Price: £ 15.00 + vat

COeugoclID Ldj L1 aGsdldhdh® Li2G, GideGieei2olldeblditity Ld

These kits contain capactiors that are generally of higher specification than those fiited by the manufacturers. coomoo cocxmDD JCCDgiâCXJ coDe⣻ CDC),D4300 Early PSU Later PSU Later PSU DS00385 Rev C DS00375 Rev A Rev 03 Kit Contains 9 capactitors DS00385 Rev F Kit Contains 13 capactitors Kit Contains 11 capactitors Code :RELKIT34A Code :RELKIT348 Code :RELKIT34C Price: £ 4.00 + vat Price: £ 4.00 + vat Price: £ 4.00 + vat

tO M''.0D JttD5,130C) @ 3-UDID Samsung PSU Samsung PSU PSSH370601B PSSH370603B Kit Contains 12 capactitors Kit Contains 13 capactitors

Code :RELKIT34D Price: £ 4.00 + vat Code :RELKIT34E Price: £ 4.00 + vat crËrf-1]

(f ele ctro nic ' co m p o n e nts 105°c Electrolytic Capacitors

WM6111 leDC:Hil PRI M ri$ WiaaMlit (e()C13 P[20(eIll P.B.B ,P14.1 _;A, \17.,%113111 eiocei PlUnlegi P352 VALIDE4 @C OIM Pi;30(el Piet CZ Pate.iS Pail&tR PLI@C3

1441 W as W ate...o weinowied 410 Y eflo....apeaMoss07 900 VE900e... meellamed II« n else...ciniagOOKUOde 220uF ....CAP163 £0.70 10 1000uF ..CAP46 13.65 10 100uF CAP66 . .£0.85 10 2.2uF CAP94 . 10.50 5 33uF CAP206...£1.75 5 470uF ....CAP164 £0.80 10 1500uF ..CAP47 13.90 5 220uF ....CAP67 . £1.75 10 3.3uF CAP95 . 10.50 5 47uF CAP106. £4.35 10 2200uF ..CAP48 ...12.00 2 330uF ..CAPEi8 . 12.45 10 4.7uF CAP96 . 10.50 5 100uF CAP154. £4.50 5 90 We * 3300uF ..CAP49 ....£2.20 2 470uF . .CAP69 14.35 10 6.8uF CAP187....£0.80 10 220uF CAP155..£2.00 2 100uF ....CAP118....£0.45 10 4700uF ..CAP50 .£3.65 2 680uF ....CAP70 14.90 10uF CAP97 . .£0.95 10 330uF ..CAP206. £2.50 220uF ....CAP165 .£1.00 10 6800uF ..CAP51 13.90 2 1000uF ..CAP71 . 15.25 10 22uF CAP98 . .£1.05 10 470uF ....CAP29 £1.20 10 1500uF CAP143..£4.50 5 33uF CAP99 . 11.55 5 &in n eilip 680uF ....CAP166.£1.20 10 SO M OD 2200uF ..CAP72 ..£3.25 2 47uF CAP100..£1.75 10 1uF CAP156..£0.70 10 1000uF ..CAP119 .£1.50 10 luF CAP130....£0.40 10 3300uF CAP144..£3.25 2 68uF CAP188..£1.30 5 2.2uF CAP207..£1.20 10 2200uF ..CAP120 £2.10 10 3.3uF CAP131..£0.40 10 100uF CAP101..£2.10 10 3.3uF CAP157..£1.50 10 3300uF ..CAP187....£1.60 5 4.7uF CAP132. £0.45 10 Elle W as 220uF CAP102. £6.00 5 4.7uF CAP208..£1.10 5 10uF CAP52 . 10.50 10 0.22uF CAP145. £0.45 10 330uF CAP189. £3.00 2 10uF CAP158. 12.25 10 Vie Pgag 22uF CAP53 ...10.45 10 0.33uF CAP178. .£0.35 10 470uF CAP103..£6.00 5 22uF CAP159..£3.40 10 22uF CAP121.£0.35 10 33uF CAP54 ..£0.50 5 0.47uF . CAP73 . 10.35 10 680uF CAP190..£3.00 2 33uF CAP209..£2.60 5 33uF CAP122.£0.35 10 47uF CAP55 . 10.85 10 1uF CAP74 . .£0.35 10 1000uF ..CAP191..£3.00 1 47uF CAP210. £1.50 2 47uF CAP123.£0.35 10 68uF CAP133..£0.55 10 1.5uF CAP179. £0.35 10 100uF CAP211. £3.00 2 100uF .CAP124.£0.60 10 100uF ..CAP56 . 10.85 10 2.2uF CAP75 . 10.35 10 914) M ee 330uF .CAP212. £5.00 150uF ...CAN N .£0.65 5 150uF ..CAP57 . 10.95 5 3.3uF AP76 . 10.50 10 0.47uF .CAP192. .£0.45 10 220uF ....CAP125 £0.80 10 220uF .CAP58 . 11.45 5 4.7uF CAP77 . 10.35 10 F CAP193. 10.45 10 401> Mtle 330uF ....CAP30 £1.75 10 330uF CAP134..£1.60 10 6.8uF CAP180..£0.50 10 2.2uF CAP148..£0.45 10 0 47uF .CAP213. £0.60 10 470uF ....CAP31 £1.75 10 470uF CAP135..£1.75 10 10uF CAP78 . 10.50 10 3.3uF CAP194. 11.00 10 1uF CAP107. £2.15 680uF ....CAP32 .£2.10 5 680uF ..CAP59 ..£6.50 . 10 15uF CAP79 . 10.95 5 4.7uF CAP195..£1.00 10 2 2uF .CAP108. £2.25 1000uF ..CAP33 .£2.10 10 1000uF ..CAP60 . 14.35 10 22uF CAPI30 10.75 10 10uF CAP147. £1.40 10 3 3uF CAP214....£2.25 1200uF .CAP169.£1.50 5 1500uF CAP173..£4.00 5 33uF CAP81 . 10.85 10 22uF CAP148. £1.80 10 4 7uF cAP109....£3.15 1500uF.CAP170 11.50 5 2200uF ..CAP61. .£2.45 2 47uF CAP82 ..£0.95 10 33uF CAP149. £2.30 10 10uF CAP110. £4.00 2200uF ..CAP34 .£5.25 10 3300uF ..CAP62 £10.00 5 56uF CAP181. £1.10 10 47uF CAP196. £2.20 5 22uF CAP111. £2.50 3300uF .CAP35 15.00 5 4700uF CAP136..£3.50 2 68uF CAP83 . .£1.30 5 100uF .CAP150. £3.25 5 33uF CAP215. £2.50 4700uF CAP36 .£6.10 10 100uF CAP84 . 11.20 10 220uF .CAP197. £3.00 2 47uF CAP112. £3.50 6800uF CAP171..E4.50 5 4S W M 150uF CAP85 . .£2.80 5 470uF .CAP198. £3.25 68uF CAP216. £3.50 2200uF ..CAP174..£1.80 2 220uF CAP86 ..£2.80 10 100uF .CAP160. £4.00 Silf W e ft 2200uF ..CAP175..£2.00 330uF CAPB7 . .£4 00 10 SPP W OO 150uF .CAP217. £3.20 10uF CAP37 . £0.45 10 470uF CAP88 . £5 25 10 22uF CAP199. £1.60 5 220uF .CAP161. £7.00 15uF CAP172. £0.45 10 Weas 680uF CAP89 . £5 00 10 100uF .CAP151. £3.25 5 560uF .CAP162. £4.00 22uF CAP38 . 10.45 10 O 47uF CAP176. .£0.35 10 1000uF CAP90 . £5.40 5 220uF .CAP200. £2.50 33uF CAP126 10.40 10 iuF CAP137..£0.35 10 2200uF ..CAP182. £2.20 1 330uF . .CAP201. £2.50 400 WItngt 47uF CAP39 10.48 5 2.2uF CAP138. £0.35 10 4700uF ..CAP183. £4.00 1uF CAP113. £2.80 68uF CAP127. £0.55 10 3 3uF CAP139. £0.35 10 See Mono 2 2uF .CAP114. £3.20 100uF ....CAP40 . .£0.70 10 4 7uF CAP140. £0.35 10 991) tVone 0.47uF..CAP202. £0.60 10 3 3uF CAP218. £3.20 120uF ....CAP128..£0.85 10 6 8uF CAP177....£0.45 10 0.1uF CAP184. £0.80 10 1uF CAP152. £0.60 10 4 7uF CAP115. £4.95 150uF ....CAP41. .f0.95 5 10uF CAP63 . .£0.50 10 0.22uF .CAP185. £0.80 10 2.2uF CAP203. £1.30 10 10uF CAP116. £5.50 220uF ....CAP42....£1.20 10 22uF CAP64 . .£0.70 10 o 33uF....CAP186. £0.80 10 3.3uF CAP104. £1.75 10 22uF CAP117 £4.15 330uF ....CAP43 . .£1.40 5 33uF CAP141. £0.85 10 O 47uF CAP91 ...10.50 5 4.7uF CAP204 £2.00 10 33uF CAP219 £3.00 2 470uF ....CAP44..£1.90 10 47uF CAP65 .£0.85 10 1uF CAP92 . £0.85 10 10uF CAP105....£2.60 10 47uF CAP220 £2.00 1 680uF .CAP45 ..£3.15 5 68uF CAP142..£0.90 10 1 5uF CAP93 . £0.70 5 22uF CAP153 £2.30 10 100uF CAP221 £3.00

Aerial & Satellite Installation Accessories

:C=12:1 ,nuelOYI®ws tlez 2dffleeiacatiic3 C-à 0107 Now with built in Digital ByPass Operates with SkyTM DigiEye UHF TV antenna pre amplifier designed for the professional aerial installer

15dB gain masthead amplifier ideal for Class leading noise figure of 4dB or less majority of domestic installations

26dB gain masthead amplifier for longer 6dB signal amplification on all models cable runs (loss of more than 3dB) or if connected to passive splitters

Description Order Code Price Requires 12V DC power supply via downlead either via dedicated power supply unit or from a distribution ampli- 2 Way - No Bypass SLX2 £ 8.00 + vat fier with line powering 2 Way- With Bypass SLX2B £ 9.25 + vat 15dB Amp Order Code : 27830R 4 Way- No Bypass SLX4 £ 13.00 + vat Price: £ 4.30 -é vat 4 Way- With Bypass SLX4B £ 14.00 + vat 26dB Amp Order Code : 27831R 6 Way- No Bypass SLX6 £ 18.00 + vat Price: £ 4.50 + vat

6 Way- With Bypass SLX6B £ 19.00 + vat SLx Masthead Amp PSU 8 Way- No Bypass SLX8 £ 18.50 + vat Order Code : 27832R Price: £ 5.00 + vat 8 Way - With Bypass SLX8B £ 20.00 + vat Postage for 2+ £ 5.00 + vat

towa U)1.14) e@e®e?,/ Ïyp Ylicoec47 M uoulcolom Ccala 12dll Allows the user to find the best azimuth / elevation settings for a satellite dish , resulting in the best signal reception / picture and sound quality ett, Compact design Order Cock :PLG51 Order Code- PLG62 Order Code : PL6101 Backlit meter scale Audible signal strength reading Bag of 10 Bag of 10 Bag of 10 Adjustable level control Price: £ 1.25 + vat Price : £1.60 + vat Price : £ 1.00 + vat Adjustable sensitivity adjustment Frequency Range : 950 - 2250Mhz Bag of 100 Bag of 100 Bag of 100 Price : £9.00 + vat Price: £12.50 + vat Price: £ 6.00 + vat Order Code • 27860R Price 10.00 + vat Fanden, dtr[ ufcr of' e--1-cictronec conl pone:rite Koníg Replacement Remote

Part No Part No. Code Part No. Code Part No. Code Part No. Code Part No. Code Part No. Code

TOSHIBA ..continued AKA! F ERGLISON „M elted HITACHI continued MO M PHILIPS ..continued SHARP ..continued ..12582E R9639 \NS511T 89983 3121, R9157 RC9020 89434 RRMCG0662PESA 89487 1480REM 89953 C T2585 R9259 2514.. 89476 3126F R9157 RC9030 89434 RRMCG0739BM5A 189711 148018 89953 C72885 - 89259 1546 89677 C 1 89161 RC9050 89556 RRMCG0777PESA IR9487 1480TBT 89953 1480TBW 89953 CT2885E R97LIC R9259 2541318 89677 C2 R9161 RC9057 89710 RRMCG0833PESA IR9487 1816 89700 • R9639 ,547TN R9677 C3 89161 RC9060 R9556 RRMCG0898CESA 1R9487 1480TBY. R9953 1480TBZ 89953 RC556 89397 89639 2556TN 89993 C4 89161 RC9070 89434 RRMCG1014BM5A 1129711 RC85 89700 R9639 _5667N 89677 CM 1 89569 RC9133 R9710 RRMCG1023BM5A 1119711 151ORBT 89962 R9639 2567TN 89983 D 89151 RRMCG1031BM5A 1R9788 151ORDT 89962 RRMCG1036BM5A 1129711 151081 89962 AMSTRAD R9639 025671.82 89983 D2 R9161 5AMSUNG SRD550 IR'. R9639 C258878 89983 E 1 R9161 CX5312W 1129432 RRMCG1046BM5A 189788 15589B 89962 SRX510 1129 x R9639 C2659H 89142 E2 89161 CX5325W IR9432 RRMCG1048BM5A IR9788 155129E1T. 89962 AE6001 R9639 C2660. 89142 EM2 R9700 CX532WT 189432 RRMCG1050BM5A 189788 155R9BW R9962 •,x R9639 C2661.. R9142 ES5 89701 CX534WT 1129432 RRMCG2799CESA 1129487 155R9BZ 89962 R9639 C2846TN R9677 FSIO R9573 RM104 1R9432 SV2044G I129487 15689 89962 Beclink 100 189843 R9639 C2847TN R9877 FS11 89506 RM109 1129546 SV20446 1129487 156898 89962 R9639 C21356TN .. R9983 FUJI R9573 SV2145G IR9487 1561298G 89962 SV2145S 029487 156R9BW 89962 BEISQ 89639 C2866TN R9677 FS492 R9573 letast RC51321 189398 D78N 89639 C2888TN 89983 FS5 R9506 4AA4U1T0092 IR9459 SV2577S I129487 172ORB 89962 RC51331 189398 E51N R9639 C28W410TN 89983 FS5/1 89573 JXBA IR9457 SV277751 1129487 1722 18 89852 RC81331 IR9398 55988 89639 C28W510TN 89983 FS9 R9506 JXCL 1R9530 SV2877S IF19487 173210 89852 RCU1734 89584 CBP 14768 89142 FS9 89573 JXCR IR9530 SV2877S1 IR9487 210ORB 89962 OLAUPUNICT RCU1742 89584 C131, 1646R 89142 Rd1 89157 JXFF IR9457 21008803 89962 210ORBT R9962 8689493 R9188 RCU1785 89594 CBP2067 89142 RC2 89157 JXGA IR9139 SONY 1532 89503 RCU1789 89594 CBP2216 R9142 RM 1 89535 JXGE IR9139 RM604 89974 2101RBZ R9962 1570-46 89516 RH880 89594 CBP222 89142 RS1 89535 JXGT IR9460 RM607 89974 2102RBZ 89962 8627 105 463 R9188 RH885 R9325 CBP226 89142 852 89535 JXGW 029460 RM609 89974 212180 89962 8668813000 89516 RHT01 R9259 CBP260 89142 RS3 89535 JXGY IR9460 RM615 89511 2132DB 89852 555-46 89516 RHT10 R9639 CL2156TAN 89983 RCN610 89752 JXLB 189460 RM620 89511 214ORB ...... 89852 583-48 89516 RHT30 89259 CL24W1TAN 89983 RCN620 89751 JXLG IR9460 RM625 89511 21401B 89852 B1111 R9504 749F 89639 CL2556TAN 89983 RCN624 R9757 RC238 IR9974 RM630 89511 21411E1 89852 C18 R9504 749N 89639 CL2586TAN 89983 SMI 89491 RC254 IR9974 RM631 89511 2145DB 89852 D32 89503 151F 89639 CL2856TAN 89983 SM2 89491 RC258 1R9530 RM632 89511 214500 R9852 L32 R9503 151N 89639 CL2886TAN 89983 RC305 029974 RM633 89511 215010 89953 M32 89503 759F 89639 CL28WI TAN 89993 PANASONIC RC307 189457 RM634 89511 2152DB 89953 M55-16 89516 1598 R9639 CL28WD2TAN 89983 02280227 R9835 RC308 189457 RM635 89511 2152DD 89953 M63-16 89516 1688 . 89639 CL32WD2TAN 89983 91005926 R9835 RC317 .. 1129457 RM640 89321 21550B 89953 M70-16 89516 1742 89584 CLE87IA 89602 EUR50100 89826 RC318 1129457 RM641 89321 2163013 89953 P32. R9503 1752 89584 CLE871B 89602 EUR51920 R9835 RC321 1129457 RM641A 89321 21630B 89953 016 R95134 1758 89584 CLE874A 89602 EUR51921 89835 RC812 189457 RM650 89336 216898 R9962 832 R9504 1789 89594 CLE874B 89602 1R3592 R9826 RCI325 189457 RM651 89336 216R9B2 R9962 TC106 129406 178DPL 89639 CLE876 89476 TC1485DR 89826 RC1328 IR9457 RM652 89336 2173DB 89953 TC110 PIP 89248 CLE876C R9477 TC14SIR 89834 RC642 189530 RM654 89336 218010 89953 89448 2181113 89852 TC143 R9406 C821£MIAM CLE876D 89477 TC150E R9562 RC1345. 1129974 RM656 TC144 R9406 105-068 89403 CLE876G 89477 TC1856PER 89826 RC885 189457 RM657 89338 2181113 89953 TCI90 129529 10520913 R9862 CLE902A 89677 TC1785DRS 89826 RC700 189139 RM658 89321 219R 89962 TC192 89529 105210A R9862 CLE9028 89677 TC1785IR R9826 RC702. IR9139 Rm661A 89321 219898 89962 TC194 89529 105-219J 89854 CLE903A R9677 TC1785UR 89826 RC710 . 189139 RM670 89123 219R9B2 89962 105-224V 89854 CLE92IA R9983 TC2185DRS 89926 RC711 1129460 RM671 89123 2522DB 89953 252200 89953 M O WN 105-229H 89854 CLE92113 89983 TC2185IR 89826 RC901 1129139 RM672 89123 RC51331 189398 105230A 89862 CLE922A 89992 TC21R1C 89826 SO2 189460 RM673 89123 252708 89953 RC61331 IR9398 105-230C R9854 CLE922B 89992 TC21R1U 89826 SO3 189460 RM677 89448 2535013 89652 21907 1R9397 3811 89854 CLR876E 89477 TC21S1R R9834 RM681 R9442 253500 89852 CB20E4OX 89854 CP2146TA 89677 TCC23PER 89826 SHARP RM682 89442 2537DD 89952 2545DB 89852 12ALICKISJ CBT2190E 89403 CP2546 89677 TN01410 89826 37AM12S R9788 RM683 89442 DM01414 929397 CBT4902 R9403 CP2546TA 89677 TNO8E0421 89926 51AM12S 89788 RM684 89442 2545DD 89852 DM014A 1 1129840 CBT4902E 89403 CP2556TAN 89983 TNO8E0422 89826 51AT15S 89798 RM685 89442 255018 89953 DM020A 1 89840 C819905 89403 CP2841TA 89677 1808E0428 . R9826 548M125 R9788 RM686 89442 2552DB 89953 DM02195 1R9840 VS068K 89862 CP2856TA 89983 TNO8E0430. 89926 54A7155 R9788 RM6878 89448 255200 R9953 0M02595 189840 CP2856TAN 89983 TNCI8E0432 89826 54CSO5SN 89711 RM687C 89448 2555 R9953 DM02895 1R9840 SRUND1G CP2886TAN 89983 1808E0435 R9836 5V2044 89487 RM689 89441 2555DB 89953 CUC503 89614 CP28WD2TAN 89983 TNO8E0436 . 89836 5V2145 89487 RM694 89452 255500 89953 2557DB 89953 EERG OD61 CUC5200 89614 CP32WD2TAN 89983 TNO8E0441 89826 70CSO3S IR9711 RM698 89442 20H3 89594 CUC5301 89529 CPT1556 R9576 11408E0461 89834 72CSO3S 189711 RM717 89448 2563013 89953 2285 R9584 CUC5302 89529 CPT1557 89576 TX14S1T 89834 72CSO5SN 1R9711 RM719 89448 256300 89953 22H3 ...... 89594 CUC5310 89614 CPT1560 89576 TX21S1RC 89834 C1421 IR9487 12M816 89441 25730B 89953 2415 89584 RC212 89614 CPT1561 89576 TX2161T 89834 C2021 IR9487 8M817 89441 2577DB 89953 2422 89584 PC 900 89614 CPT2I55 89575 TX2161TC 89834 CV2I21 R9487 RM820 89452 257908 89953 2423 R9584 89500 CPT2164 89575 TX2171C 89826 CV3707 IR9487 RM826 89441 26368 89953 2433 R9584 " Vt 89509 CPT2558 89575 TX25A2C 89836 CV3709 189487 RM828 89452 2835DB 89852 2445 RF' VT R9509 C P12564 R9575 TX25A2CI R9836 CV3710 IR9487 RM830 R9443 283700 89852 2452 R9509 CP12566 89575 TX25W2 89836 CV3720 IR9487 RM831 R9443 285208 89953 2453 R9299 CPT2669 89575 TX25W2C 89836 DV1416SN IR9487 RM832 89443 285300 89953 2463 R9509 CPT2785 89575 TX25W2C1 89836 DV1506SN IR9487 RM833 89451 2855013 89953 2475 R9509 CPT2870 89575 TX28A1D 89826 DV1706SN 189487 RM834 89452 2857 08 89953 26H3 R9562 CST1430 R9576 TX28A2C 89836 DV210816 1129711 RM836 89871 285700 89953 29132 r TOP 89615 CST1435 89576 TX28A2CI 89836 DV2130EX 1129487 RM837 R9451 286300 . R9953 38K2 89614 CST1560 89576 TX28W2 89836 DV250716 IR9711 RM839 R9871 2866DD 89953 41H3 89529 CT2116 89476 TX28W2C 89836 DV25073S IR9711 RM841 89452 2873138 89953 4233 TP711 R9529 CTRM200M 89542 TX28XDP I C 89835 DV25081S 1R9711 RM842 89443 2877DB 89953 4414 TP712 89614 TX29ADID 89835 DV25083S IR9711 RM883 R9871 2879DB.. 89953 4415 TP715 89749 JYS TX29W2C1 89836 DV28037S 1129711 RM886 89871 332708 R9953 4423 TP720 89614 AV21TSIEN 189698 TX33A2C 89836 DV280715 1129711 33390B 89953 4433 TP760HIFI 89614 AV25TS1EN 929698 TX33A2CI 89836 DV28081S 1129711 THOMSON 3357DB 89953 51A0 TP770 89749 AV25VM1EN 1129698 PH11.1EIS DV28083S 1129711 140210570 89639 3377DB 89953 51A2 F TP771 89749 AV28VM1EN 1R9698 RC5002 R9510 DV37505 89788 140M53 89639 3387DB 89953 51A3 TP800 89749 AV29SXIEN 1129698 RC5140 89510 DV37605 89788 140M56 89639 3787DB 89953 51A4 R95,4 TP900 R9749 AV29TSIEN 1129698 RC5154 89510 DV51605 89788 14M570 89639 40PW8DB 89953 51A5 89584 TRC1 89715 AV32WZ2EN 189698 RC5240 89510 DV54035 R9711 21M576 89639 48J6DB R9953 5102 R9594 TRC2 R9715 RC8072 IR9698 RC5250 89510 DV5432S 89711 21141051 R9639 48PJ6DG 89953 5103 89594 RC8074 1129698 RC5260 89510 DV5465S 89711 925TX1 049 89508 55PJ6D8 89953 51H3 89594 1:111ára RMC530 IR9698 RC5300 89510 0V54705 89711 RCT2000 R9259 56PW8DB 89953 51H4 89594 2970491 89479 RMC682 1129698 RC5350 R9510 DV5935H 89711 RCT3000 89831 703700 89852 5127 89594 A518780. 89142 RMC76I IR9698 RC5410 89553 DV63016 89711 RCT5000 89259 7053DD 89953 51K3 129594 C1405 R9476 RMC76I1E 1129698 RC5420 R9553 DV6303S R9711 RCT5020 89502 C16869 89953 5980 Rq ro.4 ,, 414 89476 RMC770 1129698 RC5540 89510 DV6311S 89711 RCT5141S 89470 C19369 89962 5982 ,57H 89142 RMC771 1129698 RC5701 89434 DV63135 89711 CT9383. 89962 5983 ,67 R9142 RMC7711E IR9698 RC5801 89553 DV6332S 89711 TOSHIBA C19387.. R9962 5984 89142 RMC793 189698 RC5801 89556 0V63365 89711 1400 R9962 C19396 89962 59135 14 89476 RMC7931E 1129698 RC590 1 89556 DV7001S 89711 14008 89962 CT9399 89962 5902 . 46114 89677 RC5903 89556 DV70025 89711 140088 89962 CT9414... . R9962 5903 89 ,94 ,...2147114 89677 LO ME RC6008 89434 DV7003S 89711 1400813G 89962 CT9432 89962 5902 89594 C2156TN 89983 F B300 IR9616 RC6404 89465 DV70115 89711 140ORBN 89962 C19455 R9962 5903 R9594 C2188TN 89677 FB50 IR9514 RC6416 89465 0V70245 89711 1400REIT 89962 CT9475 89962 59H4 89594 C2170TN R9983 FB52 IR9514 RC6512 89464 DV7032S 89711 1400813W 89962 C79478 89962 59H5 89594 C2186TN R9983 FB70 1129514 RC6804 R9434 DV70365 89711 140ORDT 89962 C19480. 89962 59J7 R9594 C2257H . R9142 F872 189514 RC7118 89464 RRMCG03510ESA 89487 144088 89852 C19552 89962 59LS2 R9639 C2259H 89142 FB90 1129514 RC7141 89485 RRMCG03510ESB 89487 144ORBT 89952 C79626 89953 6223 89584 C2261 R9142 FB91 189514 RC7500 89484 RRMCG03510ESD 89487 144080 89852 CT9784 89953 6245 89584 C2267H R9142 PC 7507 89710 RRMCG0370CESA R9487 1440TB R9852 CT9785 89953 6682 89584 C2268H 89142 MATSUI RC7512 89864 RRMCG0483PESA 89487 1440TBT R9852 C79859 89953 6683 R9584 C2273 89142 0760047240 189490 RC7535 R9864 RRMCG0489CESB. 89487 145ORB 89852 C79867 89953 R9594 C2273H 89142 076L067240 829490 RC820I R9434 RRMCG0568PESA 89487 145080 89852 C19868 89953 R9594 C24WI TN 89983 20768 189490 RC8205 89710 RRMCG0617PESA 89487 1480129 R9953 CT9900 89953 R9594 C24W511TN 89983 2092T 1129490 RC9010 89434 RRMCG0618PESA. 89487 1480RBT R9953 C19949 89953

_Pced@ 3 C110 s;1 Zt)C

E L E C -rriO N IC jdo&,C ®1 E L E C -rnc3NIC r,cowdw)/, neJc u7,9 ,eccxecg, datelittd '111Strlibutor of electronic components Transistors / Linear IC's

Pert No. Price I Pert No. Price Pert No. Price 'Part No. Price I Price P.nl N. Price iPart No. Part No Price Part No. Price Part No. Price BU208A £0.75 RF5450 £100 MJE350 £0 80 $TK4191 £9.00 STK5464 £300 SIR 171 £4.00 TDA2450-3 £10 00 TDA4665 E2 50 TDA8138 £2 00 BU2506DF £0.90 RF5740 £3.00 AUF ST64191 X 114.00 $TK5466 £5.00 S19380 £3.50 TDA2480-2 LO 70 BU2506DX £1.00 10A4 670 f4 75 TDA8138A £1.30 RF5840 £3.03 MJF16206 £4.50 STK419-130 .£15.00 STK5467 STR381 £4.00 £3.90 1062501 £3 00 TDA4671 £5 00 TDA8138B £2.00 BU2508A £1.00 RF810 moo MJF18004 £1.75 STK419-140 £18.00 $TK5488 £ £3.00 STR383 10625061 f 8 00 TDA4680 £3.50 BU2508AF £1.10 RF611 £1.20 TDA8139 £2.00 MJF18006 £2.00 $TK4192 £7.00 STK5471 9.00 STR384 1062507 £4 50 TDA4681 £4.50 1068140 £2.00 BU2508AX £1.30 F620 £1.00 MJF18008 £1.75 STK4197 II £9,50 433 :.551000 $16 5472 £175 STR40090 ;££ 1042510 £4.50 BU25080 £1.30 0064555 £2.75 TDA8143 £1.80 F830 £0.75 MJF18204 £2.50 STK4199 II £10.50 STK5473 £4.80 STR40115 £8.00 TDA2514A £100 TDA4686 £100 BU2508DF £1.20 F634 £1.25 TDA8145 £1.20 STK0025 £4.20 STK4199Il £10.50 STK5474 £5.00 STR40904 £6.50 1062515 £450 TDA4687 £100 TDA8146 £2.00 BU2508DX £1.50 F640 £1.50 STK0039 £6.00 STK420 £4.00 S1K5476 £3.50 S1941090 £3.30 TDA2520-1 moo 10647006 £7.50 1068153 £10.00 BU2520AF £1.70 F640F £2.00 STI(088 £10.00 STK4204 II £10.50 $TK5477 £4.50 STR4142 £4 50 TDA2521 £8.00 TDA4710H BU2520AX £1.40 £7.00 TDA8170 £1.70 F630S £100 S1KI039 £4.60 $TK4204II £10.50 STK5478 £2.50 STR4211 £ TDA2522 .£12.00 TDA4714C £3.50 BU2520DF £2.25 F642 £2.00 1068171 .£2.30 STK1040 £6.40 STK421111 £10.00 STK5479 £3.00 STR43111 £93 5 510 1062523 £8.50 TDA4716C £4.50 1068172 £2.00 BU2520DX ezoo F644 £2.00 STK1049 £7.00 STK4211 V £8.00 STK5481 £4/0 019440 £8.00 1062525 £4.50 TDA4720 £6.60 1068173 £1.75 BU2522AX £1.50 F650 £2.00 STK1050 £6.50 STK4221 Il .£1200 $TK5482 £2.85 STR441 £9.50 1062530 £100 1064725 BU2525A £125 £7 50 TDA8174 £2.00 F710 £1.50 ST61060 £7.00 STK4231 II £10.50 STK5483 £440 S1944115 1062548 £200 10A4780 £6 00 TDA8175 £7.00 BU2525AF £2.20 F720 £0.85 $TK2025 £6.20 STK4231 V . neoo STK5486 £4.50 STR442 ;164 10075 1062549 £3.00 1064800 £3 00 BU2525AX £1.90 TDA8177 £3.00 F730 £1.25 STK2028 £5.00 $TK4241 £10.50 STK5487 £125 STR450A £7.00 1042558 £4.00 1064810 £5 00 TDA8177F £3.50 BU2525D £2.40 F740 £0.90 STK2029 £6.00 STK4241 V £12.50 STK5488 £4.80 019451 £8.00 10625600 £7.00 1064850 £4 75 TDA81790 £7.50 BU2525DF £1.75 F740F £300 STK2030 £10.00 STK4272 £5.00 $TK5490 £4.50 01945111 £5.50 TDA2560-3 .£14.00 TDA4851 £3 25 TDA8180 £12.50 BU2527AF £4.00 F820 £0.90 STK2038 £7.00 STK4273 £5.50 STK561 £4.00 STR4512 TDA2574V £3.50 BU2527AX £2.50 TDA4852 £3 25 1068205 .£12.50 F830 £oes STK2048 £9.50 STK4274 £5.00 STK563 £4.15 S1R452 £475 10625766 £9.00 TIDA4854 .£100 TDA8212 £3.50 BU2527DF £2.00 F830F £1.60 STK2058 IV £16.00 STK4274 £100 STK5632 £3.00 STR453 . £5.00 1042577A 1064850 BU2527DX £2.00 £6.00 10682146 £10.50 F840 £0.85 STK2101 £10.50 STK430 £5.00 $TK5720 £4.00 019454 £1100 10A25784 £7.00 1064856 £5.00 TDA8215H £3.00 BU2532AL £3.25 F840F £1.75 STK2110 £5.50 STK4301 £5.00 $TK5725 £3.50 $19455 £5.50 10425796 £2.10 1064858 BU2708AF £2.00 £3.50 TDA8217 52.25 F9140 £10.00 STK2139 £6.75 STK4311 £6.50 STK5730 £3.00 STR456 70 10625795 £3.25 1064860 BU2708Ax £2.00 F9230 £400 TDA8303 £2.50 STK2155 £9.00 STK433 £4.00 $TX583 019457 . ££ £4.00 64 i00 1062652 .£4800 TDA4861 £3.50 TDA8304 £4.00 BU2708DF £2.00 F9510 £1.50 STK2230 £4.70 STK4332 £3.65 STK6316 £3.00 019470 £3.00 1042653A £4.50 TDA4866 £2.75 TDA8305 £5.00 BU2708DX £200 RF9511 £1.50 STK3102 II £510 STK435 £3.75 STK632413 £100 STR50020 £3.50 1042710-1 E4.00 BU2720AX £2.00 TDA4880 . £4.50 TDA8305A RF9520 £1.50 STK3106 £25.00 STK4352 £5.00 $TK6327 £12.00 STR50092 £5.50 10628201.1 £1.00 TDA4918A £17.00 1048310 £8.00 BU2720DF £2.00 RF9530 £1.25 STK3122 III £7.25 STK436 £430 STK63284 £4.130 $TR50103A £2.60 TDA2822M £060 1064930 .£5.00 BU2720DX £2.03 10683500 £2.75 RF9531 £2.00 STK3152 II £9.00 STK4362 £4.50 STK6431 £8.00 STR50112A £6.50 TDA3190 £2.00 104,4935 £3.00 TDA8351 52.00 BU2722AF £3.30 RF9540 £1.75 STK3156 £5.00 STK437 £6.00 STK6607 £4.00 STR50113 £5.00 10633010 £16.00 1064940 £2.00 10483540 £2.75 BU2725AF £2.00 RF9541 £2.00 STK350-030 £7.00 S1K4372 £4.90 STK6712BIV £510 STR50115 £5 00 1063303 £7.00 1064941 BU2725DF £2.00 £2.80 TDA8356 £2.00 RF9610 £0.95 STK392-040 £1100 STK439 £5.00 $TK6722 £6.50 01950213 £4 00 1063501 £100 1064942 £2.00 106836093 £8.00 BU2725DF £2.00 RF9620 £0.85 STK401-050 £8.00 STK4392 £5.00 STK6732 £10.00 STR50330 £4 75 1063502 £160 1064950 BU2727AF .£2.00 £1.00 TDA8361AN3 £8.00 RF9622 £2.00 STK401-080 £9.00 STK441 £6.80 STK6822 £7.50 01951041 £5.00 1063504 £3.00 TDA4951 £4.50 TDA8361N3 £9.00 BU2727A £2.00 RF9630 £1.30 STK401-120 £10.00 STK4412 £4.50 $TK6875 £8.50 STR51213 £5.00 1063507 £410 TDA5010 BU2727AF £2.00 £100£ TDA8362AN £12.00 RF9640 £2.30 $TK401-140 £12.00 $TK443 £7.00 $166922 £10.00 01951424 £7.00 TDA3521 £7.50 TDA5400 6.00 TDA8362AN3 £7.50 BU506DF .£1.00 RFBC20 £1.10 STK4017 . £4.00 STK4432 £6.00 STK6932 £4.50 $1953041 £4.00 TDA3560 BU508AF £0.60 £600 TDA5500 £900 TDA8362BN3 £8.50 RFBC30 £1.20 STK4019 £4.80 STK457 £4 70 $TK6962 £2.75 01954041 £3.20 1063581 £100 1065600 £4.50 TDA8362N3 £1200 BU508APH £0.60 RFBC40 £2.10 STK402-040 £700 STK459 £5.60 $TK6972 £3.00 STR5412 £2.80 TDA35614 £3.00 BU508AX1 .£0.90 TDA5610-2 £7.50 TDA8362N4 £9.00 RFBE30 £2.25 STK402-070 . £7.00 STK460 £6.60 STK6981B £5.00 STR55041 £4.50 TDA3582A £2.60 1065620 ££143..0050 TDA8382N5 £12.00 BU508D £0.75 RFD120 £100 STK402-070 £7,00 STK461 £6.00 $TK6982 £6.00 STR56041 .£5.50 TDA3563 £3.50 1065702 BU508DF £0 85 1E/A8366142 £1100 RFD9120 £1.20 $TK402-071 f 7 00 STK463 £050 S166982H £6.00 $1958041 £210 TDA3563A £4.00 TDA5830-2 £11.00 1068366N3 £11.50 BU508DR £1 30 RFD9220 £100 STK402-090 £8.00 STK465 £9.00 $TK7216 £4,20 STR59C;41 £3.00 TDA3564 £3.25 10681000 1068370 £11.50 BUH1015 £4 25 RFF120 £3.00 ST64021 £3.80 $TK4773 .£8.20 STK7217 £2.50 $1960001 £5 25 1063585 £2.20 10661010 BUH1215 £4.50 ££ 1.255 0 TDA8372A £18.50 RFIBC40 £1.00 S1K402-100 . £900 STK4793 £8.00 STK7225 £500 STR6008X f 5 75 10A3566 £180 TDA61030 TDA8374 BUH515 £2.00 FIBC4OG £2.00 £10.00 STK402-100 £900 $TK4803 £10.00 $TK7226 £17.00 STR6020 2 0 TDA3566A £3.00 TDA61060 £122 :2 5 TDA8375A £12.50 BUH515D £2.50 FP054 £4.00 STK402-120 £000 STK4813 M X) $TK7233 £7.00 $TR61001 ££ 4.775 TDA3567 £3.50 10661070 BUH517 £2.75 £3.00 TDA8376 £15.00 FP064 £5.00 STK4024 II . £5.50 S1K4833 £8.50 $TK7251 £5.00 STR7001 £6.00 1063569 £100 DA6108JF £3.00 TDA8380 £2.00 BUH517D £175 FP140 £2.50 STK4025 £5.30 STK4843 £7.20 $TK7253 £8.50 STR80145 .£4.75 1063570 £3.75 DA61110 BUH715 £4.25 £2.25 1068424 £4.00 FP150 £2.40 S1K4026 £480 STK4853 £17 00 STK730-060 £8.50 01981145 £3.75 TDA357613 £7.00 10661200 £5.50 TDA8425 BUL310 £1.25 FP240 £100 STK402611 .£4.80 eeoo STK4863 £7.00 $TK730-080 £6.00 01981159£400 1063650 £675 066160-2S BUL381 £1.50 £4/5 TDA8432 £5.50 FP250 £2.80 SlX4026V .£5.00 STK4873 £11.00 $TK7308 £7.00 0198124 £10.00 1063651 £2.00 DA6160-2X £2.50 1068433 BUL381D £1.25 FP340 £2.50 £8.00 STK4028 £5.50 STK488-010 £8.00 STK7309 £eoo STR83145 £5.00 TDA36514 £150 TDA7052 £1.20 1068440 £3.00 BUT I IA £0.35 FP350 £3.25 STK4032 II £5.10 STK488-050 £8.00 STK7310 £3.20 01983159 £700 TDA3652 £5.00 TDA7056 BUTI1AF £0.35 £2.00 1068443 £3.50 FP380 £8.00 S11(4034 X. £9.25 STK4893 £10.00 TDA1420 . $TK73405 II £5.50 £8.00 TDA3652TX10 £8.00 TDA7262 BUT11AX £0.50 £3.25 1068451 £3.25 FP450 £2.70 STK4036 £4.70 $TK4913 £9.00 $TK73410 £3.50 TDA1470 £1100 TDA36530 £0.80 TDA7263 £3.50 106 5453 £3.50 BUT12 £0.80 FP480 £4.00 STK4036V £8.00 STK501 £5.50 STK73410 II £5.00 TDA15144 £3.25 TDA3653C £0.85 TDA7263K4 BUT12A £0.80 FP9140 £14.50 £4.00 1068461 £9.50 STK4038 .£6.80 STK50322 .£3.50 STK7348 £4.00 TDA1540 £4.20 11363654 £0.80 TDA7264 £5.00 1068501 £3.75 BUT12AF £0.90 FP9240 £100 STK4040 II £6.50 STK5314 .£4.75 STK7356 £4.25 TDA1541 £5.00 10636540 £0.85 BUT18 £0.80 1047265 £5.00 1068505 £11.00 FPC40 £3.00 STK4042 0 £8.00 STK5315 £500 $TK7358 £440 TDA1541A £4.00 1063724 £3.00 1067266 £5.00 TDA8560G £4.25 BUT18A £0.80 FPC50 £4.50 STK4046 .£9.50 S165323 £6.03 $TK7359 £4.25 TDA15461 £10.50 1063725 £3.00 1067269 BUT18AF £0.65 £5.00 10485610 ££5.25 FPC60 £6.00 STK4050 II m oo $TK5324 .£100 STK73605 £3.75 TD61547 £10.00 1043730 £4.00 1067269A £2.75 10485820 5.00 BUT56A FPE40 £5.50 STK405-030 £7.00 STK5325 £3.70 $TK73907 £7.00 TDA15520 £3.50 1063740 £4.00 TDA7293V 10685830 BUT58AF £2.00 £4.75 FPE50 £4.50 STK405-0504 £12.00 ST65326 £7.50 STK73908 £5.50 1£ TOA 155340 £125 1063750 £4.00 TDA7294V 45.5. 0050 10685650 £11.00 BUZ71 £0.75 FPF40 £5.50 STK405-0704 £8.00 $TK5330 £8.50 STK73908 £5.50 TDA1553C0 £3.00 TDA3770 £7.75 1067295 TDA85660 BUZ714F £1.00 FPF50 £4.50 £5.50 STK4050V £15130 STK5331 . $TK7402 10615540 £300 TIDA3771 £4.60 11367296 £5.00 TDA85870 £7.00 BUZ72A £1.00 FS740 £1.75 STK405- 120 £1100 STK5332 £1 80 STK7404 £6.00 1D6 15550 £3.75 TDA3803A £5.00 1067297 £3.50 10685880 BUZ72AF £1.00 £6.00 FS840 £1.25 STK4060 £5.10 STK5333 £6 50 $TK7406 £610 10615560 £3.25 TDA4400 £1.75 1067300 £5.50 TDA8569Q £8.00 BUZ73A £1.50 FZ20 £0.65 STK4065 £8.50 S165335 £3 50 STK7408H £7.50 TDA 15570 £3.00 TDA4420 £1.20 10A7 302 £4 50 TDA8571J £9.00 BUZ73AF £0.60 F242 £2.75 ST6407-040 £7 CO $165336 £3.50 STK7408 £6.75 10615580 £3.00 TDA4421 £3.00 1067310 BUZ76A £1.10 £8.00 TDA8703 £5.00 RFZ44 £1 60 STK407-070 £8.50 $TK5337 £5 00 $TK7410 £15.00 10615610 £500 TDA4422 £2.00 1067312 £4.50 1068708 £6 00 BUZ77A £2.00 RFZ46N ei.50 STK407-090 £8.50 STK5338 £2.95 STK7458 £12.50 TDA15620 £5.50 1064427 £100 1067313 £6.50 TDA8709 £7 P, BUZ77B £2.50 RFZ48 £175 STK4101 . £100 S165339 £4.00 STK746 £9.00 1061580 £4.25 TDA44297 £20.00 1067318 £5.50 1068741 BUZ80 £115 M110016 ..... £700 STK4111 £400 S1K5340 £3.50 $TK752 £3.00 1061599 10,64431 £1.50 TDA7330A £7.00 1068745 BUZEIOAF . £2.00 MJ11015 £2.50 STK4112... £100 $165342 £245 STK7554 £4.80 T0416024 £4.00 1044474 £4.00 TDA7340 £8.00 1068840 BUZ83 £2.00 MJ11016. £3.00 STK411-230 £12.00 $TK5343 £180 STK7561 £6.50 TDA 16846 £2.00 TDA4480 £6.00 1067350 300 1068841 BUZ900 E10.00 MJ11032.. £8.00 STK411-240E £14.00 $TK5352 £5.00 STK7561A £7.00 10616706 £2.00 1064481 £2.15 167359 £3.00 TDA8842 BUZ901 £1 100 MJ11033 £8.00 STK4121 . £4.80 STK5352 £5.00 STK7562 £10.00 1061675 £2.50 T064482 £11.00 -167360 £700 TDA884:. BUZ905 £10.00 8,1415003 £2.50 ST6412-150 £18.50 $165353 . £400 STK7583 £8.00 10616756 £2.00 1064500 £3.00 67362 £4.50 TDA8844 El1.11906 £16.00 1.1.115004 £3 00 STK4122 £5.60 $TK5361 £3 75 STK7563F £6.50 10616833 £2.00 TDA4501 £2.80 ' ,A7385 £5.50 TDA9102C £2 BUZ90 £1 50 MJ15015 £2 50 STK4130 II £7.00 $TK5362 . £4 00 STK7573 £3.00 ODA 16846 £200 1044502 £400 )47370V £3.25 1069103 £4.75 BUZ90A £1.80 M-115016 £3.50 STK413011 . £7.00 $TK5364 .. £2.50 $TX7578 £15.00 T061701 .£147 0050 TDA4503 £3.25 )673724 £4.50 1069105 BUZ90AF £200 14415022 £4.00 STK4131 . £4.80 S1K5364 £2.50 STX780 £100 TDA1770 £ 10645046 £8.00 07374V £3.50 10691011 BUZ91A £2 60 14415023 £4.00 STK4132 11 £6.00 STK5371 £3.50 S1K781 £3.00 TDA1771 £2 00 TDA45054 £3.00 07375V £5.25 TIDA9141 BUZ93 £1.50 AU 15024 £300 STK4133 II £7 50 STK5371 £3 50 STK770 £4,00 11618704 £2.00 1064505E £6,50 A73788 £10.00 TDA914' RF120 £2.25 MJ15025 £3.00 STK4140 II £8.00 $TK5372 £2.130 STK7707 £900 TDA 18724 £2.75 10A4510 £2.00 67377 £450 1069144 RF130 £4 75 MJE 13004 £1.00 STK4141 11 £4.20 STK5373 £3 75 $TK780 £4.80 TDA19084 £2.50 1044558 £3.70 4;7381 £11.00 1069151 RF140 £5.50 MJE 13005 £0.80 STK4141 V £6 00 $TX5383 £3.00 $TK78603 £7.50 TDA1940 £6.00 TDA4557 £4.00 )073844 RF230 £5.50 TDA9160 , MJE 13007 £1.00 SlX4142 . £5.30 $TK5391 £3.75 $TK78617 £24.00 TDA1941 £3.03 1064560 £2.70 ,A7385 £5101.0055 • 1069162 RF240 £4/5 MJE 13009 E100 STK4151 £6.80 $TK5392 £5.00 STK795 £3.25 11362003 £ 0O5 TD04565 £1.50 IA 7386 £11.00 TDA9170 RF250 £375 144615028 £2.00 STK4152 . £6 50 $TK5421 £4 50 $TK8050 £16 00 TOA2004 LI.50 ,,44566 £2.50 )67393 £10.00 1069176 RF251 £6.50 AIJE 15029 £2.00 STK4154V £14 00 S1K5422 £3 75 STK8250 £500 TDA2005 £1.50 04568 £2.25 ' 07394 £6.00 1069177 RF330 £6.00 MJE 15030 £2.50 STK4181 £6 50 $TK5431 £5 50 S1K8260 £12 00 TDA2006 £0.70 " 44580 £10.00 [1.47398 £4.50 1 TDA9210 £4,5, RF340 £3.25 MJE 15031 £4.00 en(elo w £8.50 STK5434 f 5 70 $TK8280 £18 50 TDA2009 Eteo 44600 £2.00 A7431 £7.00 TDA9302H £2.25 RF350 £7.50 MJE 16002 £100 STK4162 £5.50 $TK5436 £5 00 STR 10006 £4 50 TDA2020 11 20 0460011 £1.60 ,A7439 TDA9500 £7.50 F440 £5.50 144E18004 £1.25 STK4164 11 £11.75 $TK5441 . £3 50 01911006 £3 25 TDA2030 04601 11.20 ;4749S ££46:25°5 TDA9503 £9.00 F450 £6.50 144518006 £1.20 STK4171 £9 00 $TK5443 .15 75 $19 17006 £5 00 TDA2030H .646010 .£0.65 ;;75fit 018.00 TDA9610H £9.50 F510 £0/0 144E18008 £1.50 STK417-130 £15 00 $TK5446 .. £3.50 $1920005 £4 50 1062048 04605 £1.90 £4.25 TDA9614H £8.00 F520 £075 144E243 £0.60 STK4172 II £6 80 $TK5451 £3 90 $1930115 £2 75 TDA2050v ' 04610 £3.70 £150 F530 £015 MJE253 £0.85 STK4181 £6 80 STK5481 £5 00 STR3315 £2 75 1062051V .44650 £3.00 £4.00 F540 £100 MJE340 £0.25 STK4182 II £9 00 STK5462 f 3 50 STR370 1.3 00 TDA2052V • ;k41351 £8.00 TDA8137 £2.00

Please note that this a very small selection of the transistors and IC's that we stock. We stock a full range of Japanese Transistors 2SA,2SB, 2SC,2SD,2SJ,2SK series , Diodes , CMOS , TTL Logic ICs Computer ICs , Zenor Diodes. etc

KR House 1.1n1110, Pop ill , u th ytEly , Y./9111b19y h]idd19.:•;uz 1-1J-19 W-11-3 nghinJ MC)) tOCX) eta 1(02.(J) ;39(Yi ;_512M 1711.1)1:.111 G ra ta distributor of electronic coy-pollen& Line Output Transformers

Pul W V Salo PO » Pere G3o C uhe Prrtoge Lose/ Ggeu Ged » emat? Dea/s Poles Ife Ou0s

04100.0041-euektouud M OSBOCeg...ceaultheaose0 CU M NO M MO aneflOconsE0 PdIS MON06..esselocose AT 2079 / 21 LOT395 £12.00 10588080.P2 1011505 £19.00 3714002 10102 £12.00 2433453 LOT82 £12.50 TLF 14568 F LOT40 £15.00 AT 2079 / 24 101392 £15.00 151128140 LOT1505 £19.00 043714002J 10102 £12.00 2433751 LOTO1 £13.00 TLF 14584 F 10141 £17.00 AT 2079 / 40 10173 £11.50 151281.4 1011505 £19.00 43700000 10102 £12.00 2433752 10101 £13.00 TLF 14586 F LOT42 £17.00 15128140 LOT1505 £19.00 2433891 10123 £12.50 AT 2079 / 99 101276 £14.00 AT 2079/30 01 101106 £12.50 153144.6 1011505 £19.00 t ffler Mée 2433892 10184 £14.50 ûr41010Pe AT 2079/30102 101106 £12.50 15314460 L011505 £19.00 1810951 10155 £14.00 2433893 LOT23 £12.50 3119 108 31260 .LOT90 £12.50 1531447 A 1011505 £19.00 3714002 10102 £12.00 2433952 LOT33 £10.00 3119 108 31290 _10173 £11.50 1532873 A LOT1505 £19.00 043714002J 10102 £12.00 2434002 LOT226 £14.50 3119 108 31440 101433 £16.00 & MOW@ 3714002 10102 £12.00 3233500 101244 £14.50 43700000 10102 £12.00 2434141 10133 £10.00 3119 108 31441 ..101433 £16.00 043714002J LOTO2 £12.00 3233900 101244 £14.50 AM 152591 10155 £14.00 2434274 10144 £10.50 3119 108 31442 . LOT433 £16.00 2434393 101405 £22.50 3119 198 62930 10157 £11.00 43700000 10102 £12.00 40011200 LOT244 £14.50 7140021 10102 £12.00 40148300 101244 £14.50 PQ MOVOSW 2434593 L0144 £10.50 3122 108 10246 . 101111 £15.00 £15.50 2435006 101401 £17.00 3122 138 36070 . .LOT111 £15.00 00 D-3-508-002 101381 venture 06 D-3-083-001 10182 £12.50 2435131 LOT251 £14.50 3122 138 36072 . .LOT111 £15.00 WI MP RTRNF 1220 CEZZLOT39 £18.50 1810951 10155 £14.00 06 D-3-083-002 10182 £12.50 2436201 10190 £12.50 3122 138 36920 .10157 £11.00 RTRNF 2001 CEZZLOT338 £17.50 2433751 10101 £13.00 06 D-3-084-001 10123 £12.50 23236465 LOT392 £15.00 3122 138 36922 10157 £11.00 RTRNF 2006 CEZZLOT308 £13.50 23236098 101288 £14.00 06 D-3-087-001 LOT23 £12.50 2433891H LOT23 £12.50 3122 138 38923 .10157 £11.00 RTRNF 2023 CEZZLOT310 £15.00 23236198 101288 £14.00 06 D-3-088-001 10184 £14.50 45150504 LOT362 £16.00 3122 138 37050. LOT132 £15.00 23236201 101395 £12.00 06 D-3-093-001 ....101204 £16.00 3122 138 37620 10190 £12.50 23236245 101395 £12.00 06 D-3-508-003 ....101276 £14.00 011n4F3510 3122 138 37771. 101129 £14.00 O W7 1-439-286-00 10148 £13.00 23236255 101289 £15.00 06 D-3-512-001 _101204 £16.00 20070 LOT438 £16.00 3122 138 37992 LOT1116.. £19.00 1-439-286-11 10146 £13.00 23236425 LOT288 £14.00 29201-022-01 10163 £17.00 20071 101438 £16.00 3122 138 38040 LOT73 £11.50 1-439-286-12 10146 £13.00 23236427 101395 £12.00 473197 101304 £15.50 20072 LOT438 £16.00 3122 138 38123. .101395 £12.00 1-439-286-13 10146 £13.00 23236428 101289 £15.00 059 / 37 101200 £14.00 20073 LOT438 £16.00 3128 138 20200. 101433 £16.00 20074 LOT438 £16.00 3128 138 20201. 101433 £16.00 1-439-286-21 10146 £13.00 23236424 101129 £14.00 1-439-332-41 1011 00 £15.00 TFB 4090 AD LOT395 £12.00 » MU M 20075 101438 £16.00 3128 138 20202. .101433 £16.00 1-439-332-42 LOT101 £14.50 TFB 4124 AE 101392 £15.00 1142.5057 LOT1164 £15.00 3714002 LOTO2 £12.00 3138 108 30100. .LOT106 £12.50 1-439-332-52 101100 £15.00 TFB 4124 AP LOT392 £15.00 1142.5077 LOT1164 £15.00 3221008 101438 £16.00 3138 108 30101. .101106 £12.50 1-439-363-11 L01268 £14.00 1142.5079 1011164 £15.00 043714002J LOTO2 £12.00 3138 108 30103 L01108 £12.50 1-439-363-21 LOT268 £14.00 1142.5081 1011164 £15.00 043221088P LOT438 £16.00 3139 128 30400 10190 £12.50 We are stockist of both 1-439-387-11 LOT311 £14.50 1152-5016 1011934 £19.00 43700000 LOTO2 £12.00 40348-08 1011577 £18.00 1-439-387-21 101311 £14.50 1179.0387 1011147 £16.00 7140021 LOTO2 £12.00 40348A-08 1011577 £18.00 1-439-416-11 LOT255 £16.00 1192.0527 1011147 £16.00 40348A-09 1011577 £18.00 Konig 1352.5008 1011167 £15.00 ZU MUCietle0 4812 140 10246 .101111 £15.00 1-439-416-12 LOT255 £16.00 1-439-416-21 LOT255 £16.00 and 1352.5008E 1011167 £16.00 731003 LOT51 £15.50 4812 140 10349 . 101106 £12.50 1352.5016 LOR1934 .£19.00 334 P 18506 10151 £15.50 4812 140 10369 10190 £12.50 1-439-416-23 LOT255 £16.00 1-439-416-41 LOT255 £16.00 1352.5027 1011270 £16.00 4812 140 10421 L0190 £12.50 1-439-416-51 101255 £16.00 HR Diemen 1352.5033 1011270 £16.00 CX310,41 4822 140 10246. 101111 £15.00 40153201 LOT349 £17.50 4822 140 10274 ..101123 £14.50 LOPT's /M U M 4822 140 10306 ....10157 £11.00 W a ng «, 105009.8 1011505 £19.00 3714002 LOTO2 £12.00 CXBIKX9 4822 140 10349 101106 £12.50 This is just a selection 10500980 1011505 £19.00 043714002J 10102 £12.00 3714002 LOTO2 £12 00 4822 140 10381 101128 £13.00 10500980.P1 LOT1505 £19.00 43700000 10102 £12.00 043714002J 10102 £12.00 4822 140 10384 .LOT127 £15.50 of the LOPT s that we 10531460 1011505 £19.00 CF 124 B 10167 £14.50 43700000 LOTO2 £12 00 4822 140 10406 LOT73 £11.50 105660.6 1011505 £19.00 CF 124 E 10167 £14.50 4822 140 10544 .101433 £16.00 stock.. Please call on f flaie0006 4822 140 10566 ..101433 £16.00 105660060 1011505 £19.00 TLF 14512 F 10139 £18.50 AT 2076 / 10 10157 £11.00 10566060 LOT1 505 £19.00 020 8900 2329 for copy 2424593 10144 £10.50 TIF 14520 F LOT40 £15.00 AT 2077 / 81 101121 £15.00 10566060.P2 1011505 £19.00 2432461 101169 £15.00 TLF 14521 F LOT39 £18.50 AT 2078 / 21 101395 £12.00 105880.8 L011505 £19.00 of our LOPT catalogue 10588080 LOT1505 £19 00 2432761 101169 £15.00 TLF 14567 F LOT39 £18.50 AT 2079 / 15 LOT129 £14.00

CD Pick Ups and Mechanisms

Part No Price Part No Price Part No Price CDM12.1 Mechanism . .£14.00 KSS 213 B £8.75 OPTIMA 6 S £11.50 KHM220AAA KSS 213 C £9.50 OPTIMA 5 £11.50 DVD Laser £ 40.00 KSS 213 D £16.00 RCTRTH8151 £20.00 KSS 210A Original . . . .£11.00 KSS 213 F £12.00 RCTRTH8112 £14.00 KSS 210A Replacement .£9.50 KSS 240 A £30.00 RCTRH8147 Mech ....£ 10.00 KSS 210 B £15.00 NKS 240 A Replacment for KSS240A . .£20.00

Check out our Online Catalogue at www.grandata.co.uk This advertisement is just a selection of our stock. Please contact us if you cannot find the part you are looking for.

* Please add £1 p+p and VAT to all orders (Unless Otherwise stated) *All components are brand new * We accept payment by Access , Switch , Visa , Cheque and Postal Order *All prices quoted are subject to availabilty and may be changed without prior notice E & OE • ,Uu ed0 Pc» tourriânIll tânIn epülkome killddheel CMI3 Entitled

L J âf.e) Airdt)n 8 tUs.©guitt.lutadtAti.(cct,culll

Is2;!,- QCË3C,I) 1‘,3b(Jt Wif1)3 n 8 wurnm eitudtAtiuccc),m01 Engineers are occasionally tempted to tackle a repair that's obviously going to be uneconomic, maybe out of interest or for their own/family use. Adrian Gardiner describes such a job, with a Panasonic home cinema system

Engineering madness once a new microcontroller chip had revealed a short-circuit transistor. A I know few people in this trade who, at been obtained and fitted, and the standby replacement sorted out the mechanical some point, haven't suffered from a LED on the front panel lit up. Pressing problem, but not the missing audio one. moment of madness. You know the sort the power switch had no effect however. of thing — that totally scrap unit sitting on Checks around IC601 revealed that its Loss of audio your bench, fit only for the skip, but reset pin 18 was being held low perma- The audio output from the DVD module somehow you feel tempted to repair it. nently. Reset is provided by the digital is fed to the digital signal-processor One such item adorned my bench recent- transistor Q601, which was short-circuit (DSP) board. Here the analogue audio ly, a Panasonic SAH'T70 DVD home cin- collector-to-emitter. After fitting a switch chip IC802 selects an input from ema system with a five-DVD auto- replacement I found that the power either the DVD mechanism or the tuner changer mechanism. The unit had been switch, when pressed, now operated the pack. Checks showed that there was no struck by lightning, and the customer's relay to activate the main power supply. output from this IC. Once a replacement insurance company had paid for a I was greeted with the Panasonic wel- had been fitted there was normal audio replacement. I had acquired the scrap come message in the display. This was at the auxiliary output sockets, but else- unit and decided, during a brief lapse followed by immediate shutdown of the where there was still no audio. from normal business sense, that it would system, which reverted to standby. The unit uses a number of M5228 look rather nice in my living room. So I Clearly some kind of protection mode surface-mounted operational-amplifier set about removing the lid in order to was in operation, but testing was going ICs. These are common in Panasonic investigate further. to be difficult as there was an on period and Technics equipment and are prone to of only two seconds. failure. I found that one such device, The power supply A multi-regulator chip, IC502 (type IC803 on the DSP board, was faulty. The unit was completely dead, and a STK470-050A), provides the main sup- After its replacement there was normal quick inspection of the power PCB plies in this model. Cold checks around audio from the front left-hand channel revealed a scorch mark and several it revealed a faulty PCB-mounted fuse, but from nowhere else. Turning my vaporised printed tracks. As with other FP549. Hoping that I would be lucky, I attention to the main panel I found models in this series, power is derived replaced this fuse and reapplied power. another defective M5228 chip, IC402. from a large transformer. It has multiple Naturally the fuse immediately failed. Replacement of this restored normal wires and is brought into circuit by a So an order for a new STK470-050A audio to the front speakers, but the sur- relay that's operated by the microcon- regulator went off to Panasonic. round-sound, sub-woofer and centre troller chip. A separate transformer, The regulator is mounted on the main channels remained dead. 1502, provides a standby supply via a PCB and, to gain access, a complete Extensive checks in the audio circuit- 5V regulator circuit that's based around strip-down is required. The replacement ry failed to reveal anything amiss. The Q592. It was in this area of the circuitry duly arrived and was fitted. At last the only other clue was that the volume con- that the vaporisation had occurred: Q592 power supply ran normally and the unit trol behaved erratically. So I came to the itself had gone short-circuit. remained on. It accepted and read a DVD conclusion that the digital signal proces- I replaced Q592 and remade the miss- disc, but several faults remained. There sor chip IC801 on the DSP board was ing tracks. But when I tested the unit it was no audio from any of the outputs, defective. A replacement was ordered was still dead. A quick check at the out- including the auxiliary sockets; the and subsequently fitted, after which I put of the regulator produced a voltage remote-control system didn't function; was delighted to find that the sub-woofer reading of only 1-5V. So it was obviously and the five-disc auto-changer didn't and centre channels were now OK and severely overloaded and, as it supplies work correctly. Returning to the front that there was normal volume-control power directly to the microcontroller panel, I found that the remote-control operation. But there was still a problem chip IC601 and its associated circuitry, I problem was easy to solve — by replacing with the surround-sound rear channels. came to the conclusion that this IC had the IR sensor Z601. There's a small input board, which suffered during the lightning strike and contains the scan socket etc., on the rear was in need of replacement. It's a 100- The mechanical problem panel. Checks here showed where the pin flat-pack device which is mounted on I decided to tackle the mechanical surround sound was being lost. It passes the front PCB. To gain access to this problem next. The unit would load a through another M5228 op-amp, IC103. when the unit is dead you first have to disc correctly. But when it was asked So a replacement was fitted. open the tray. A special hex tool is to change to another disc it 'parked' the required for this purpose. You insert the first disc successfully then jammed. Success at last! tool underneath the unit and turn it clock- The cause of this was the disc-change The DVD home cinema system was at wise to open the drawer. solenoid, which failed to operate. last fully operational. My sanity was also The 5V standby supply was normal Checks in the solenoid's drive circuit restored — until the next time! •

TELEVISION June 2004 475 trial delivery at UHF works well, The government has set up a Digital Action Plan exemplified by the success of with the aim of moving TV broadcasting to an Freeview with the public. This is all-digital basis by the year 2010. Various issues offset to some extent by the still still have to be resolved however before homes limited coverage provided by DTI', amounting to 75 per cent of the can be converted to the all-digital dream. These population, though the use of involve aerial standards, signal distribution 16QAM (16 quadrature amplitude within the home, video recording and set-top modulation) instead of 64QAM with four of the available multiplex- boxes. J. LeJeune reports on the current situation es has greatly extended coverage. There is also the problem of he government has shown of suitable aerials, signal distribu- reception with portable TV sets, for some determination to move tion within homes, video record- which analogue remains more TTV broadcasting to an all-dig- ing, and the design, development usable than digital reception. At ital basis by the year 2010 and is and supply of set-top boxes. To present over 70 per cent of multi- fairly confident that this target can achieve the goal of an all-digital channel reception is via sets situat- be met. A number of technical future post-2010, the government ed in the living room. The exten- issues remain to be resolved how- has set up a Digital Action Plan. sion of this facility to other, smaller ever before homes can be convert- Figure 1 shows its structure. sets around the home is considered ed to the all-digital dream. These The Action Plan lays down the by many to be rather too expensive relate to the design and installation need for trials to ensure that an undertaking and possibly unnec- householders will be able to essary. An increase in the field replace all existing analogue TV strength of the digital signals, as a Sleeting Board. DTVDOAS Ministedal equipment in their homes with result of a corresponding increase corresponding digital devices. In in the power output from transmit- fact the Go Digital project has ters, would help equate digital already taken place, and highlight- reception using portable sets with ed the need to convert the whole current analogue reception. Government Project Teem Stickel°Idols Programme Group house, not just the TV set in the There are numerous alternatives Group Ilenopernere living room, and a number of other to a power increase. The most issues. viable are the provision of numer- ous repeaters, diversity reception, Signal delivery the use of active deflectors, wire- While some people think that the less distribution in the home at Pilo( 1 Tec hn dopy Smarten 1 Mantel : Promote Group Planning Pro motion current use of UHF for terrestrial 5-8GHz, cable or Wi-Fi digital LI:to n e& Group Group signal delivery is outdated and home networks and wired RF dis- advocate satellite delivery instead, it tribution systems. Each has its mer- Figure 1: Structure of the government's Digital Action Plan. has been shown that digital terres- its. These could be adopted individ-

47 6 June 2004 TELEVISION ually or in combination to provide the best answer to particular prob- Ceggelen OM M eet, lems. Reflected signals that result in multi-path reception are a problem with analogue reception, and because of this aerial positioning is sometimes tricky. Dr!' can cope with multi-path signals but, eventu- ally, this distortion of the received signal adds so much unwanted rub- bish that decoding ceases and reception abruptly ends. Diversity Subscriber reception has much in its favour Ofterear. Midis« 10 bile left Connection. but is costly. Even without it, digi- tal reception is more costly than analogue. There is also the problem limilu mé Aimee% S b bb that impulsive noise can mar the quality of reception in marginal- signal areas. We have already learnt a lot about this. Quality counts For successful digital reception quality counts: from the aerial to the outlet socket, quality of con- struction coupled with good per- formance are of huge importance. The addition of DU signals was a disaster initially with a twenty certain types of impulse spike and delivery of analogue TV and radio Figure 2: year old analogue distribution sys- the problem remains largely signals. Many of these simple dis- A typical digital tem that had previously provided unsolved. tribution systems could be up-grad- cable network acceptable performance. Only ed to carry digital signals. In many arrangement. when the cabling had been Home-entertainment centres cases additions to the wiring will checked and some sections and signal distribution have to be more visible than that replaced, screened splitters and The living room has already installed when the dwelling was multi-taps had been fitted, and all become the centre of a cluster of built. External cabling is never outlet plates had been changed to home-entertainment items, a trend pretty: foresight by home designers take a combination of F connec- that's expected to continue. An and builders may be the answer to tors, could the digital performance audio system, audio recorder, DVD this problem, with cable for current be regarded as satisfactory. player or recorder, VCR, satellite and possible future use installed at The outlet plates were removed and/or DTI' set-top box, maybe a the time of construction. CAT5E and blank plates drilled with a hole dish positioner, a computer or and coaxial cables plus several to take an F barrel connector were games machine, a broadband inter- copper pairs wired from a central installed. The incoming cables were net modem and a cable set-top box point to all rooms would be a boon terminated with a right-angled F could be present in any combina- to future installers, provided a plug because many of the patress tion. It's likely that there will be a standard that permits easy location boxes were only the depth of the requirement for material from dif- and identification is adopted and plaster. Flyleads to receivers or set- ferent sources to be played or dis- adhered to. top boxes were replaced with ones played in different rooms in a An alternative is the use of of quality similar to distribution house. The advent of HDTV will domestic mains wiring to send sig- cabling, and appropriate plugs were probably make analogue PAL UHF nals from one room to another. fitted properly. Crimped F connec- distribution unsuitable. The This method of distribution is tors were found to perform less requirement for RGB distribution under development and several well than the threaded type or the is a strong possibility. The feasibil- large schemes are being evaluated later 'snap 'n' seal' connectors, ity of multi-channel home distribu- in the UK, Germany and possibly because of cable deforma- tion at 5.8GHz is being studied, Switzerland. Germany has a strict tion at the crimp. This does not this frequency providing an alter- standard for such equipment. solve the problems of reception native to the 2-zIGHz slot that's with portable sets however: at the rapidly becoming unusable because Recording video present time this remains a trial- of signal congestion. The Wi-Fi The advent of the personal video and-error business. 802.11 standard could be pressed recorder (PVR) has made TV pro- DIT reception seems to be par- into service for video-signal distri- grammes much more readily acces- ticularly vulnerable to the presence bution though it remains relatively sible to the viewer. In addition to of impulsive noise, with momen- untested for this purpose. the time-shift facility, a programme tary freezing of images and Wired distribution systems are can be recorded from the point unpleasantly loud plops on sound. found in many homes. They pro- where viewing is interrupted for Several chipset manufactures are vide the nearest thing to the con- some reason, enabling viewing to working on spike-cancellation tech- cept of the all-digital home but are be resumed subsequently while, niques, but these are specific to mainly used for the multi-point simultaneously, the remainder of

TELEVISION June 2004 477 active only when the viewer choos- es to vote on a topic. Interactive TV requires a return path to the broadcaster of course. In the Sky case satellite viewers communicate back to Sky via a telephone link. Other means are provided by the mobile phone SMS service, while cable network subscribers are pro- vided with a return path via the operator's network to the data highway.

Cable TV For cable TV subscribers additional services such as Video on Demand (VoD), a pay-TV service that deliv- ers a film or feature to one cus- tomer only; information services Upstream Channel Downstream Channel such as time, weather, stock- exchange prices and football Speech results; and a fast broadband con- Baseband nection to the internet make full Figure 3: The ADSL signal spectrum, with equally-spaced OFDM (orthogonal frequency- use of the network's return path. division multiplex) carriers. With most modern networks the the programme is being recorded. manufacturers would use the digital upstream paths use a band of fre- The development of several clever equivalent of PDC (programme quencies from 5-65MHz. Speed of means of accessing recorded mate- delivery control) to enable record- data communication is ensured by rial directly via a graphical display ing to be timed by the metadata the bandwidth of the coaxial and of the contents of the disk drive included in the SI (service informa- fibre-optic cabling used. Figure 2 will make the use of PVRs increas- tion) layer of the data stream. shows a typical digital cable net- ingly appealing. Inevitably these would be 'half- work arrangement. The fact that over thirty million way' products, preceding the analogue VCRs are installed in the advent of more sophisticated Data via telephone lines UK alone makes changeover to a devices that meet the ETSI stan- Telephone companies all over the digital-only system a major prob- dards. Solution of the EPG problem world use ADSL and its derivative lem, given the amount of prere- has become an urgent matter, as the VDSL. The technology makes use corded analogue material and EIT (event information tables) are of the existing copper-wire pairs archive tapes that viewers will con- inefficient. At some stage receivers that carry the telephone service, tinue to want to use. Thus although and recorders will both be capable adding RF carriers in the range digital technology may supplant of assembling a full programme 200kHz to 2-2MHz modulated with analogue for all main home-enter- database of schedules to ease timer digital data. Although the technolo- tainment and information purposes, programming. gy works well, the reach of the RF there will still have to be a place signals is restricted by line condi- for analogue in future digital Set-top boxes tions. The length of the local loop homes. The set-top box market for DTT is cannot, at present, extend much Some manufacturers may make at present an open one, and con- more than 3km with new lines. provision for analogue devices in sumers are confused about the dif- VDSL (very high-speed digital their set-top boxes and PVRs. For ferent 'features' offered by the subscriber line) technology is more a period there will be a niche mar- manufacturers. Work is continuing difficult to implement, though ket of this type, with recording on on a basic standard that provides many telephone companies are pro- to hard disks, or DVD-R/RW customers with a range of facilities posing such services. Despite their drives. The transition to all digital regarded as appropriate for a versa- limitations, the xDSL services have will be blurred by continuing use tile yet reasonably-priced product. the advantage that nearly everyone of 'legacy' analogue equipment, Naturally some manufacturers will has a telephone connection. both VCRs and receivers. All-digi- want to introduce models that fall Figure 3 shows the ADSL signal tal receivers are more expensive, below such a standard while others spectrum. and many users of analogue will want to offer more. To avoid receivers still in good condition confusion, a 'star' rating system is In conclusion will prefer to go digital by using a under consideration. The all-digital home will provide set-top box. unparalleled versatility for obtain- In late 2002 the TVAnytime Interactive and enhanced TV ing entertainment, information and Industry group agreed a standard for Interactive and enhanced TV cause assistance. Electronic retailers a hard-disk recorder with advanced a degree of confusion for digital should start to educate their cus- features. It includes simple functions customers. Enhanced TV is in tomers about the offerings that will like programmed recording as well common use, providing supple- be available in the near future. But as advanced features and a degree of mentary data streams that can be forget the silly applications — the future-proofing. selected via the remote-control intelligent dustbin, refrigerator and In the period before the full keypad. The Sky News facility is a possibly vacuum cleaner. These ETSI standards are met, many good example: this becomes inter- will surely be gimmicks.

478 June 2004 TELEVISION NEWS AND TECHNOLOGY • INSTALLATION -SERVICING -DEVELOPMENTS

S ON AND CONSU MER ELECTRONICS

wan ad reeds a peak rankly ahe ad, ad dech ak «apnea r4n, gates ad marts la people rairl” Wale » ad eau* apilima 01 10.1.000 S•INSIALLATIONS•SERY1 1 0.0(YELOPMEN NTS

TELEVISION L E V I S I O N AND HO ME ELECTRONICS REPAIR TELEVISION TE AND HO ME ELECTRO NICS REPAIR FEIRU4RY 1004 £3,20 AND CO NSU MER ELECTR O NICS MARCH 2004 £3.20 JUNE 2004 £3.20 Workshop equipment guide Test report: Horizon digital signal-se fflgth motors

The Sale TEST REPORT of Goods Act The D-GEN Servicing the •xplomed pattern generator Philips LOI chassis Sky digibox RF2 checker Simple volume Servicing the CCTV recording system compressor circuit Hitachi A7 chassis Satellite, Audio, Monitor, TV, VCR and DVD faults Satellite, Audio, Monitor, Tv, VCR and DVD faults FAULT FINDING FOR TV AUDIO M OTIF VIDEO IT

Television and Consumer Electronics magazine is the only magazine for technicians who deal with consumer electronic products, in particular TV, video, satellite and audio equipment.

• Launched in 1935 this respected • Keep up to date with the latest journal is the longest established information and changes affecting consumer electronics magazine the industry • Tips and guides on repairing television • Essential reference and in-depth and electronic equipment including features covered monthly satellite receivers„ PCs, monitors, VCRs, • Essential reference and in-depth DVD, audio equipment and much more features covered monthly Make sure of your copy now... Subscription rates for 1 year: Contact UK £33.80 • Europe £49.00 or €92 Highbury Fulfilment Services, USA S104 • Rest of the World £63.50 Link House, 8 Bartholomew's Walk, Ely, Cambridge CB7 4ZD.

Telephone 01353 654 431 Subscription rates for 2 years Fax 01353 654 400 UK £53 • Europe £78.40 or €146 HIG HBURY USA S166.65 • Rest of the World £101 BUSINESS Email [email protected] . 410.01. 91,1,00•ALY 011 .1.M ..

TELEVISION June 2004 479 Send letters to "Television", Highbury Business, Media House, Azalea Drive, Swanley, Kent, BR8 8HU or e-mail [email protected] m

using subject heading 'Television Letters'.

Please send plain text messages. Do NOT send attachments. Be sure to type your full name, address, postcode, telephone and e-mail address (if any). Your address and telephone number will not be published but your e-mail address will unless you state otherwise.

flu drill. Very modern and labour saving, but the problem was plugging it in — Keith Cummins' account of his grandfa- because of all the different sockets then ther charging a car battery from a DC in use. Some houses didn't have sockets mains supply, using an electric fire in at all, so you had to remove the living series, reminded me of a design for a room light bulb and make your connec- DIY light dimmer I once saw in an elec- tion to the holder! Incidentally in those tronics book that dated from the Fifties. Days of DC days a common DIY method of making The dimmer, intended for theatrical use, I showed Keith Cummins' article Days of the hole through the window frame was consisted of a vertically mounted section DC (May) to my dad. The subsequent to repeatedly heat a poker and burn your of drainpipe that was sealed at the bot- reminiscences occupied the rest of the way through! tom with bitumen and filled with a salt- evening! There was the occasion when I solved my connection problems by water solution. Connections were made the local electricity supply, which came making up five short extension leads. to an electrode at the bottom of the pipe from the colliery power station, had a Each had a different plug at one end and and to another one mounted on a plunger fault that caused smoke to come from a 13A socket at the other. Because I am that could be moved up and down inside, just about every TV set and radio in the constitutionally unable to throw anything thus providing a variable resistance to pit village. Then there was the customer away, I still have this kit. A section of it dim the mains-powered lighting. who used TV coax for his electric fire is shown in the accompanying photo- Health and safety at work? No chance! and wondered why the lead got hotter graph (Photo 1). The strange object at the Martin McCluskey, than the fire! bottom, in the middle, is a Wylex plug, Bishop Auckland, Co. Durham. Mention of the old Wylex plugs took and there's a rear view of one just below us back. When some new houses were top right. Digital picture quality built in the village in the early Sixties the I still have to wire up fiddly little 2A I have to disagree with Gerald Gutteridge local electrician got the job of wiring plugs from time to time because, in the who maintains (letters, May) that digital them and fitted Wylex sockets through- Sixties, they were often fitted to power a transmissions provide a better picture out. People who subsequently moved in TV distribution amplifier from the light- than analogue ones. The point is, you found that his was the only shop for ing circuit. can't get more out than you put in. miles around that sold the plugs, which Bill Wright, Where there's no significant scene were twice the price of ordinary ones! Micklebring, Rotherham. change from frame to frame the digital Weren't there two types, 13A and 5A? I picture is indeed very good — because the seem to remember that you could plug in I enjoyed Keith Cummins' article on DC system is not being stretched. When a 13A plug then push in a 5A plug at the mains supplies, and knew that car batter- there's a bit of lateral movement howev- back, piggyback style. No, that's too ies could be charged from such a supply er, or a few quick scene changes, the pic- bizarre — I must have dreamt it! via a series load: I thought one used a ture looks a lot less good: there are lots When I tired of using a brace and bit light bulb of suitable power, but it was a of motion artefacts (pixellation), depend- to drill holes for aerial leads in cus- long time ago! ing on the bandwidth (bit rate) allocated tomers' window frames I bought an elec- Mains regulation remained a problem to the particular channel. An example is much later, with the power cuts about the heavenly halos that surround football forty years ago. A local dealer I knew and rugby players with digital TV. received hundreds of service calls for Analogue viewers shouldn't feel left out adjustments and explanations about what here, as most OBs are digital from end to was happening. While lack of width was end — so you can preview digital artefacts easy to explain to customers, I recollect on your analogue set now. The last few that Bush TV sets could respond to a low rugby matches from Twickenham mains supply by producing a picture with demonstrate this perfectly. I've seen the no sound! Most calls required just 'twid- future and it stinks — pixellates if you dling' and explanation during the day like! when the voltage was nearer normal. The minimum bit rate for decent digi- In those days people dreaded tube tal TV is apparently about 4Mbits/sec. failure, hence the popularity of TV This is for an average programme. What rental. But I have several colour sets in are the broadcasters using? I know for a use that still produce fine pictures despite fact that for some rugby games OBs have being over twenty years old! used as low a rate as 2Mbits/sec. The Photo 1: Part of Bill Wright's collection of Philip H. Bearman, result is horrendous — sub-VHS quality. extension leads, including front and rear New Barnet, Herts. A complete multiplex has (used to have?) views of a Wylex plug.

480 June 2004 TELEVISION 26Mbits/sec. But there may be eight or produce these probes. A limited number more channels. It seems that the system is of sets are available however, priced at built to a cost, not a specification! £12 per set plus £1.50 post and packing. Geoff Thomas, Please send cheques to LMB Electronics. Merthyr Tudfid. 301 Mawney Road, Romford, Essex, RM7 8DR. Our phone number is 01708 Naiko spares 748 836. In the May editorial you asked about Michael Bennett, spares for Naiko equipment. These are LMB Electronics. available from Naiko UK Ltd., Naiko House, Spear Fir, Bardsey, Leeds, LS17 An unusual aerial rotator 9EA. The phone number is 0193 757 I recently came across the accompanying 9888. picture (see Photo 2) which I took when Photo 2: Bicycle-wheel aerial rotator, Dave Packham, in the Czech Republic two or three years spotted in the Czech Republic a couple Leeds. ago. A unique aerial rotator, don't you of years ago. think? height and width. Easy I thought, low HT. Sharp probes Fernley J. Heath, C.E., I found a few dry-joints and thought that In his recent workshop equipment feature Newton Abbot, Devon. was it, but not so. Then I asked whether (March/April) Eugene Trundle mentioned the remote-control unit was available. that he didn't know of any very sharp Clever baby "Oh" came the reply, "the baby plays with probes. We used to manufacture a set of About a year ago a neighbour asked me to it all the time." The penny then dropped. I 'ultra-sharp' meter probes that can easily look at his set, a Proline Model 2811. The entered the code and reset everything. penetrate solder resist, flux and even PVC line output transformer had to be replaced The question is, how can a year-old cable. They received a favourable review because it was arcing. Recently the set baby find the code, let alone upset all the in the January 1991 issue of Television. was passed on to me as my neighbour had settings?! Unfortunately, because of the high cost of decided to update. Jim Lesurf, manufacture, we are no longer able to The only fault I could see was lack of Dagenham, Essex.

with the Thorn 8800 chassis. R. Bailey, 22 also modules and boards for these models, Grebe Close, Waterlooville, Hants, PO8 preferably non-workers. Phone Mike on 9UT. Phone 023 9278 3811. 01758 613 790. Wanted: Old half-inch diameter ferrite rods. Wanted: I would like to be able to vary the Must be six inches or more long. Will pay very playing speed with a radio-CD player — good money for them. Peter Tankard, 16A quite a few very low-priced and attractive Birkendale Road, Sheffield, S6 3NL. Phone units are available at present. The problem is 07931 463 823 (mobile) 9 am. to 10.p.m. that dance music is not always recorded on Wanted: Does anyone know of a source of CDs at the correct speed, while it is desir- H ELF spares for a Minato portable TV set? There able to be able to vary the speed for teach- are power supply problems. D.W. Davies, ing or practice purposes. Presumably the fre- Emlyn Electronics, 119 Ernlyn Avenue, quency of the drive to the motor would have WANTED Ebbw Vale, Gwent, NP23 5TZ. Phone to be made adjustable. Equipment with a 01495 307 256. variable-speed feature is available commer- Wanted: Reel-to-reel stereo tape recorder to Wanted: Early (pre-1975) black-and-white cially, but the price is prohibitive and fea- borrow, buy or rent, possibly even a salvage and colour sets, equipment, picture moni- tures that are not strictly necessary are unit. Equipment is required to transfer old tors, spare parts, home-built equipment, included. I would appreciate guidance from family recordings. Phone Armando Guselli manuals, catalogues etc. Please phone Keith anyone who might know how to carry out on 01923 896 941. Parker on 020 8422 5049 (Harrow, London). this modification. D.N. Wellings, Wanted: I have several Philips/Marantz For sale: Marconi TF868B LCR bridge in Nordheide, Shurton, Stogursey, Bridgwater, DCC recorders, Models 900/DD82, that date GWO with manual, £25. Manor Supplies TA5 1QE. Phone 01278 732 099. from the 1990s. They work fine but produce Mk IV colour-bar etc. generator in GWO Wanted: Chopper transformer for the no audio output. If anyone has any ideas or with manual £15. Samsung 13in. Panasonic TX-25W3 etc. (Euro 1 chassis). can help, I would be grateful. I suspect the Syncrnaster 3 colour monitor Model Part no: 5451708900, cct ref: 1639. DA or AD or the digital boards, the two CVM4967T, works but colour drifts, £5. plug-in boards in the middle of the main Rod Tyler, Tyler TV. Phone: 01798 342210 Box of assorted items with the following PCB. Philip Rosbottom. Please email e-mail [email protected] and more, £10: Thorn Model VR172L VCR [email protected] Wanted: Circuit diagram for the removable (has tracking fault) with manual and remote- Wanted: Back-tension gauge for modern control unit; AEI transistor test set R2446; front panel in a Sony Car Radio Model XR- VCRs, e.g. Matsui. Tape-splicing kit for Panasonic KX-T2406DBE UK answer- U301RDS — alternatively an old/replacement VHS tapes. Loading gear for the Philips phone; Eclipse 36 chisel/plane honing guide front panel would be much appreciated. Turbo deck as used in Models with instructions; ultrasonic distance-meas- Phone Graham on 01905 371504 (evenings) VR242NR7229/VR7239 etc., part no. uring tool with user guide. All proceeds go or e-mail [email protected] 4822 310 10657. TMP47C433AN38-42 to charity. Buyer collects (Bishop's Wanted: One supply brake assembly item processor chip and socket. Mains lead, tele- Stortford, Herts). Phone David Martin on 148 part no. 6410529010 for the Mitsubishi scopic FM aerial and battery cover for the 01279 506 212 or email VCR Model HS-B20/30, or just the rubber Vega Selena transistor radio dating from [email protected] tube. Phone Graham Bond on 0117 965 1980/1, or a set for spares. Have for dis- Wanted: For spares, Quad 33, 34 or 44 pre- 6667 or email: posal a large-screen colour TV set fitted amplifiers and 303 or 405 power amplifiers, [email protected]

TELEVISION June 2004 481 inter conditions continued during March and there was \ ery little terrestrial DXTV reception to report. A minor W Sporadic E opening occurred on the 6th, with reception of RAI (Italy) ch. IA from 9.20 p.m. onwards. On the 21st Peter Schubert (Rainham) received unidentified SpE programming in ch. E3. Cyril Willis (King's Lynn) has nothing to report other than meteor-shower pings. Conditions are better down under, where Robert Copeman (Melbourne) reports that the SpE season was good. Nothing exot- ic, but the usual stations were received. Autumn is approaching there, and the signals are fading away. Unlike the situation here in Europe, there has been no closedown of Low Band (Band I) transmitters — VHF is still a main spectrum for TV transmission, and DTT is a long way off! Satellite transmissions are on the increase, especially for far-flung island groups where a single downlink can give coverage over a wide area. Fiji Television for example has invested heavily to bring Fiji 1 and six pay-TV channels to the island group. The main problem there could be the reliability of electricity supplies in remote areas. It seems that in New Zealand people who sign up for Sky Network NZ often find that the dish installer hasn't reconnected the terrestrial TV aerial. Thus viewers are deprived of their local UHF transmissions. This appears to be a specific installation instruction

Satellite sightings DX and March was marked by much violence. There were the train bombings in Madrid on the 1 1 th, with over 190 rush-hour com- muters being killed. The sombre mood was captured by the Newslink feeder via Eutelsat W2 (16°E) that afternoon, uplinking from outside the Puerto de Atocha railway station. Several live reports were transmitted, including English, but the haunting SateHit background image was that of a long row of parked black hearses waiting as the rails were cleared. Newslink ran news reports for several hours, at 12.562GHz H (SR 2,816, FEC 3/4). Many other satellite trucks were uplinking news about the Madrid terrorist tragedy, for example via Eutelsat WI (10°E) at 10•967GHz (4,167, 5/6) and 11-099GHz (5,632, 3/4). The following day Round° brought more news uplinks and it became known that the bomb- ings had been carried out by al-Qaeda rather than the ETA. Anti- Terrestrial DX and satellite TV recep- war crowds demonstrated on the streets, and Eutelsat W2 became a major carrier of the news, with the following active: El6 at tion reports. Broadcast and satellite TV 12.548GHz H; Enex-B at 12.563GHz H; Atlas-Enex GlobeStar news. VHF TV aerial construction and Espana at 12-510GHz H; RTL Xng D22 at 12-518GHz H; Sky News at 12.533GHz H with a church service; and Esretet 3 at mysteries. Injuries, part 2. 10•998GHz H — this is an EBU frequency. Two days later there was a general election in Spain and a Roger Bunney reports new government was elected. Once more there were news feeds everywhere. But it was also election time in Russia where, not unexpectedly, President Putin was overwhelmingly re-elected. With the events in Spain, there was very little coverage from Moscow. I checked at 10°E and found that UKI 298 Moscow was using the APTN slot at 10•967GHz (4,167, 5/6), with a stu- dio shot of a reporter and an inlay of the Kremlin Square as a backdrop. He appeared to be totally unaware of the mass of smoke and flames in the background, because a massive building called the Manezh was alight from end to end. When I moved to 16°E I found that dramatic live pictures were being provided by a Russian satellite truck as the huge building burnt, with the Moscow fire brigade helpless. This was an NTV RUS-6 news feed at 12.563GHz H (5,632, 3/4). This major incident seemed to produce little coverage in the UK press. Iraq was rarely out of the headlines. A major attack on the US Military HQ in central Baghdad produced reports from APTN Baghdad and CBS Baghdad via Eutelsat W 1 at 10•972GHz V and 12.533GHz H respectively (5,632, 3/4). There was graphic footage of the damage to the buildings. Subsequently Dan Rather, the veteran CBS TV news reporter, arrived in Baghdad to Terrorists strike in Madrid. Scene outside the Puerta de Atocha give nightly on-the-spot reports. He is exemplary in his polite- station. Seen via Eutelsat W2 (16°E). ness and friendliness to the crews who work with him, as can be

482 June 2004 TELEVISION seen from non-edited VTR footage. On the 9th he interviewed the American ambassador in one of Saddam's palaces. Dan had pre- viously interviewed Saddam himself prior to the start of the war. We saw Dan and the ambassador walking along the marble corri- dors of the massive palace. The local newsroom for CBS is at the Baghdad Mansour Hotel. When it's in operation, you find reports via Eutelsat W2 (16°E) at between 12-533GHz and 12•560GHz H. March 9 saw the return of UK prisoners captured in Afghanistan from the prison camp in Cuba. On the 10th Sky News UKI-15 was camped outside Paddington Green Police Station, where the prisoners were taken, uplinking via W2 at 12.525GHz H (5,632, 3/4). Was something happening in Afghanistan on the 23rd? At 1900 hours a Kabul News (screen ident, on colour bars) transmission from APTN Afghanistan (ser- vice ident) appeared via W2 at 10•967GHz V (4,167, 5/6). A reporter stood for ten minutes, obviously cold, but there's no report — only colour bars, then the transmission was terminated! Eutelsat 2F3 wanders around at 21-5°E, shuffling within a 3-5° inclined orbit. I gather that it's on boresight for standard-tracking Election night in Moscow, when the Manezh art museum behind dishes, i.e. non-inclined-orbit tracking, during the late afternoon. Kremlin Square caught fire. Reception via the APTN feed from So at 1600 hours I carried out a scan across the upper part of the Eutelsat W1 (10°E). Ku band, including the Telecom section, and found a number of signals, with no side-lobe problems from the Astra 1 powerhouse services will close. Digital TV fill-in relays will be progressively at 19.2°E. Sislink 20 UK was present at 11•659GHz (Tramore opened in the above and the Hesse regions next year. horse racing), Basic 8MHz SI at 11-664GHz (Ascot horse rac- ing), Sis 18 Path 2 at 11•675GHz and UKI 784 Cl 4.2 at Sweden: Channels TV3 and ZTV are now available again terres- 11•696GHz, the latter two with anti-war meetings in London. trially, via the Teracom DTT multiplex. Channel TV8 should also These transmissions were all with horizontal polarisation, running be available terrestrially by the time this is read. at 5,632, 3/4. Another four transmissions were present in the Telecom band: BBC UKI-777P at 12•507GHz H, Baghdad 216 at US: The FCC is considering ways to encourage viewers to move 12-538GHz H (both running at 4,226, 7/8), Solo at 12.544GHz H to UM' as the deadline for 85 per cent population coverage by and UKI-534 DSNG at 12.574GHz H (both running at 12,593, 2006 nears, though there's no hope of that being achieved. Dual 3/4). On the 23rd APTN Jerusalem was present at 12-538GHz H analogue/digital transmissions have failed to produce the DTI' (4,226, 5/6) with the service ident Digit Video. So, despite the take-up expected, possibly because of equipment costs. widely-inclined orbit, it's possible to find many live OB and news downlinks from the unstable 2F3! Taiwan: CNS-TV, which opened a DTI' service last June, has to Alan Richards has now moved from the Nottingham area to date attracted only some 10,000 subscribers. Horricastle in Lincolnshire. Sadly he had to leave behind his ex- SIS bookies 1-5m prime-focus dish, and is for the present using Russia: Despite the fact that there is no official analogue-to-digi- an 80cm Sky (analogue) dish. With slight modifications to the tal switchover date, the head of Russian State TV is planning for dish mounting he can cover from Express at 53°E to his old a large subscriber take-up of a basic digital TV service across the favourite PAS-9 at 58°W. Express produced SGU-1 and -2 (pre- Moscow region over the next year. The company promoting the viously on Sesat, 36°E) at 10•974GHz H (8,888, 3/4). SGU-1 had service, Skylar, will provide a free set-top box for the $5 a month a "pan pipe and piano accompaniment" against pictures of snowy service provided the receiver is 'digital capable'. suburbs and city footage, while SGU-2 carried a blue screen with the ident cry 1B2. Colour bars with the ident Satvision UK were Ireland: The government, in conjunction with RTE, is about to present at 11.645GHz V (2,170, 3/4) via Europe*Star (45°E). announce a digital TV project covering the Dublin area. Up to a Alan says that the Sirius slot (5°E) can be an active spot. He million potential viewers would need to buy a set-top box. The reports Latvia-TV5 testing at 11•840GHz H (27,500, 3/4) with ETA multiplex will be transmitted from the Three Rocks site and lots of adverts, a fashion programme and a nice multi-coloured will include RTE-1, Network 2, TV3, TG4 and up to six UK petal logo in the top right-hand corner. Oltenia TV has recently channels. appeared nearby at 12.625GHz V (3,400, 3/4) with material of the classic B movie type, football from Craiova etc. and a nice selec- Switzerland: The German-language Ul channel that uses the for- tion of national music rendered on harpsichord and zither, all mer TV3 facility, offering sport, general entertainment and docu- FTA! mentary material, has been offered a ten-year franchise. The Finally Edmund Spicer (Littlehampton) reports a few changes potential number of viewers should reach 1.8m by January 2005. at Turksat IC (42°E). TRT1 and 2 and the TRT3 and TRT4 + 8 radio stations are now carried ETA in a multiplex at 11.096GHz Hungary: The new chairman of MTV has suggested that it V (27,500, 3/4). When there are major football games, e.g. should open additional TV channels, including ones for sport, Turkey v. UK, TRT1 usually carries the event with very few news, culture and 'nostalgia'. adverts — combine the picture with commentary on BBC Radio 5 Live and you'd think you were in the Ankara stadium! Luxembourg: RTL has further increased its empire with the acquisition of full voting rights in the French channel M6. Gosta Broadcast news van der Linden reports that the 100kW ch. E7 RTL Dudelange Germany: The closure of analogue TV services and the move to transmitter closed down at the end of March, perhaps as part of DTT across Germany continues. The Rhineland Palatinate and the move to MT. Baden-Wurttemberg regions are to have eight state and commer- cial DVB-T TV channels that will open on October 4 and a fur- San Marino: The RTV studio base at the small republic, near ther sixteen that will open on December 6, when the analogue Rimini, has been completely re-equipped. Sony Italia provided a

TELEVISION June 2004 483 Once fitted to its host vehicle the equipment can be used by a sin- gle operator, via a laptop computer, and provides automatic align- ment with both synchronous and inclined-orbit satellites. It can be `broken' down into small, user-friendly packages for flyaway operation. Turkmenistan is to have a fourth TV channel, following an agreement with InSpace Communication which will install and operate the new equipment. Transmissions should start this sum- mer. The Corse Mediterranee channel is to open shortly, transmit- ting French-language programming from Corsica across much of North and Western Europe and North Africa. It will be operated by the France 3 mainland network. Jordan has announced the go-ahead for the Al Khalijiya (Gulf One) satellite TV channel, which will provide Arabic program- ming for the Gulf and Middle East. A new Tunisian commercial channel, NASR TV, is to down- load from the Hot Bird slot at 13°E. The French pay-TV channel TPS has signed an agreement to screen UK Premiere league football matches for three seasons from August 1st. Matches, live or recorded, will be broadcast across France, Monaco, the Comoro Is, Guadeloupe, Mauritius and Mayotte. A NASA TV publicity transmission - the start of a Mars explo- The Thai army has for years transmitted radio and TV pro- ration update. Via Atlantic Bird 1 (12.5°W). gramming. The army's satellite division has opened a new TV channel, One Tambon, to advertise Thai products, downlinking to Japan. It will also be distributed via Tokyo cable systems. consultancy service for RTV, which now has six ENG units and a And finally the new Danish-based channel TV2 Charlie is six-camera OB van. The whole system is being upgraded for digi- intended for the over fifty year olds. This subscription channel tal operation. will be broadcast via cable and satellite capacity at 1°W, and will make some fifty per cent of its programming. RSL-TV: Southampton Television, which transmits on chs. 29 and 55, went into administration in early March but continues to VHF TV aerials be on air. Latest news, in mid-March, is that the RSL-TV Oxford Steve Bell's mention of an `aerial mystery' on the letters page in Channel has taken over the ailing Southampton station. the April issue produced an interesting response last month. This cleared up the basic mystery. It reminded me of the time when I Satellite news used to build a range of Band I aerials that were sold by South The new Eutelsat satellite W3A was launched on March 15, to West Aerials, which subsequently became Aerial Techniques. slot in at 7°E. It has 58 transponders in all, mostly Ku-band but Aerial hum or element self-resonance was a common problem with some Ka-band capacity. Coverage, widebeam or spot-beam, with certain types of Band I aerials, and could be overcome quite reaches across Europe, the Middle East and North Africa, extend- cheaply. It was common to see a large Band I aerial with element ing south to Somalia and Ethiopia. Operations include VSAT, sections missing, or indeed a whole element. Curious perhaps that DTH, broadband, one/two-way video linking and news feed ser- the end 12in. or so would fall off a vertically-polarised aerial — vices. this couldn't be blamed on roosting pigeons! At the April NAB show in Las Vegas SISlink launched its new During one very warm summer evening in the Seventies I self-contained automatic satellite uplink equipment, pPOD. The heard, when in back garden, an odd buzzing noise. Looking up at compact package can be carried in most vehicles and will provide the DX-TV mast, I saw that the four-element, horizontally-mount- performance similar to that obtained with a standard SNG truck. ed wideband Band I array appeared to be in distress, with the reflector part clearly `vibrating' — despite the fact that there was no wind. I climbed the mast and found that two distinct parts of each reflector rod were vibrating, sufficiently to look `fuzzy'. These were a section perhaps a foot from the main boom fixing clips and another about a foot from the end. Both the elements that comprised the reflector were suffering similarly. In effect it seemed to be a sort of mechanical standing wave! To touch the vibrating part of the element was painful, but to grasp the element elsewhere instantly stopped the buzzing. I was at 52ft. above ground, hanging on to the lattice mast. This was not the best place for extensive testing! The Band I aerials I made all used hard-drawn half-inch seam- less alloy rather than the seamed alloy tubing most aerial manu- facturers used. I recalled an old Telerection aerial whose Band I elements were full of sawdust, obviously to damp out physical oscillation. Experimentation with lengths of sash cord inserted in the reflector stopped the buzzing. Thereafter my Band I aerials all included an 18in. length of waxed washing line in each reflector element and the problem never recurred. Seamed alloy didn't suf- TV2 Norway test pattern, received via Eutelsat W2 (16°E). The fer from the problem to the same extent. vertical white bar in the black rectangle at the bottom cycles right The resonance always occurred on a warm, still day. Why, I to left continuously. have no idea. But clearly if the situation had been allowed to con-

June 2004 TELEVISION tinue there would eventually be metal fatigue and the element would fracture at one of the nodal points. Band 1 dipole I am intrigued by an elderly Band I/III aerial that is still in position in Totton centre. It's a memorial to TV of old, and the days of the Chillerton Down ch. 11 and Rowridge ch. 3 transmit- ters. The aerial, see Fig. 1, is a simple type that would be used in areas close to local transmitters. It has three Band III elements at the front and a single Band I dipole at the back: between them there's a further element, which is presumably a full-wave Band III dipole. This latter element, which is mounted with its own dipole insulator, has phasing elements that are connected to the larger Band I dipole. These are screw-fitted on to the dipole insu- lators. So far so good, but the curiosity is that the phasing ele- Front ments have a connecting section that loops round at the rear of the Band I dipole and appears to short it out. Obviously it doesn't, but can any reader comment on this rear loop and how Band I perfor- mance was maintained?

Injuries, part 2 Downlead In the April column I mentioned my fall from a 4ft high domestic connector stepladder over Christmas and the injuries I sustained. Pains in my arm continued into March, and I eventually consulted a local osteopath. He discovered tom muscles that "were repairable with- out hospital treatment", and I subsequently endured several ses- sions of paid torture. He seems to know his stuff, and there has been a 75 per cent improvement. I am promised a full recovery over the next few weeks. Fortunately I am not a self-employed aerial rigger, nor do I Fig. 1: Combined Band I/III local-reception aerial dating from the have to carry large TV sets. Had that been my work, funds could 1970-80 period. The Band I dipole seems to be shorted out! Any have been at a very low level by now. The moral is, take care and ideas about this? assess risks before you start on a task.

nin NI NIKKO U œ ELE CT R O NICS LEC,Z-.5 tje EL ECTRONIC COMPONENTS DISTRIBUTORS

STK-401-020 STK-407-070 STK-490-310 DVD/CD LASER PICKUPS STK-401-030 STK-407-090 STK-495-020 LOPT'S + MECHANISM STK-401-040 STK-407-100 STK-496-030 STK-402-030 STK-407-120 STR-F6523 REPLACEMENT STK-402-040 STK-407-710 STR-F6524 • LOPT'S FOR MONITORS KSS-210A ....£7.95 KSS-213D £8.50 STK-402-070 STK-411-220 STR-F6535 OVER 500 DIFFERENT KSS-213B ....£7.95 KSS-213E £8.75 STK-402-071 STK-411-240 STR-F6552 KSS-213C £7.50 KSS-220F ...£13.00 STK-402-090 STK-411-290 STR-F6653 TYPES IN STOCK STK-402-100 STK-412-010 STR-F6654 KSS-240A . . £17.50 KSS-710A £15.50 STK-402-120 STK-412-020 STR-F6655 KSS-210B ....£8.50 STK-402-240 STK-419-120 STR-F6656 • LOPT'S FOR TV'S STK-405-030 STK-419-130 STR-F6668 ORIGINAL ALSO AVAILABLE FOR STK-405-050 STK-419-150 STR-F6676 FROM £6.00 STK-405-070 STK-442-130 STR-F6707 KEN WOOD, PIONEER, SONY STK-405-090 STK-443-050 PAL-006A • ORIGINAL ELDOR KHM 220 AAA orig £57.00 STK-405-120 STK-489-010 PAL-007A CDM 12.1 £13.00 STK-407-040 STK-490-040 LOPT'S 12.3 £14.75 STK-407-050 STK-490-110 12.4 £23.00 • HR DIEMEN AND AND A LOT MORE, PLEASE ENQUIRE! • Sony tactile switch 4 pin MOO 10pcs £0.28 • Sony tactile switch 2pin MOO 10pcs £0.25 AN-5277 £2 35 TA-8273 £1150 • Wire ended lamps for car stereo 6,9,12V • LOW COST NIKKO AN-7125 £2 49 TA-8276 BA-4900 £5 50 TA-8277 £11.95 MOO 50pcs £0.15 each LOPT'S BA-4901A £8.50 TA-8427K £0 89 BA-4905 £5.99 TDA-7384 £4.90 • SPECIAL MOO 10PCS and more Pis enqi BA-4908 £6.50 TDA-7385 £5 75 S-2000N/CH £0.65 BUT-11A ... .£0.35 BA-4911 £8 50 TDA-7386 £6 99 S-2055N £0.65 SAP15P £3.25 • REMOTE CONTROL HA-13158 £5 50 TDA-7490 BU-2508AF/CH £0.65 SAP15N £3 25 HA-13159 £13.50 TDA-7560 £13.00 BU-508AF/CH £0.49 UC-3842A £0.45 TA-8260 £8.50 TDA-85680 £5.75 ... STR-50103A £1.75 FOR TV/VIDEO TA-8262 £10.75 TDA-8588BJ TDA-8361/N3 £2.75 TA-8263 £9.25 TDA-16833 £1.35 STR-54041 £1.49 FROM £5.00 TA-8268 £15.00 TDA-16846 £1.48 • PRICES QUOTED EXCLUDING VAT AND TA-8272 STK-5332 £1 30 SUBJECT TO CHANGE W 0 PRIOR NOTICE. NIKKO ELECTR O NICS PHONE CLICK/ORDER a 358 Kingston Road, Ewell, Epso m Surrey KT19 ODT IT'S EASY 020 8393 7774 ONLINE Tel: 020 8393 7774 E mail: [email protected] TO ORDER OR FAX VIEW OUR CAT ON Website: ww w.dalbani.co.uk 020 8.393 7395 www.dalbani.co.uk

TELEVISION June 2004 Phoenix Gold ZX450 bering to bridge the 'remote' terminal to This large car power amplifier was basical- +12V, and check that drive pulses are pre- ly dead, which is often the case when one sent. of them is brought in for repair. I've found The fuse in this particular Phoenix ampli- that there is a general lack of understanding fier was intact. The switch-mode control amongst engineers of the principles circuit was on a separate board, and a scope involved with these units: this tends to put check showed that it wasn't producing them off wanting to take a look. At a first drive pulses though the 12V input was pre- glance they do tend to look very complex sent. Further checks on this board revealed inside. They are rather less daunting when a distinct lack of volts anywhere, other than you realise that two thirds of the transistors at the input pin. While following the print or FETs bolted to the heatsink are part of round I came to a ZTX490 transistor that's the switch-mode power supply. controlled from the 'remote' input terminal. The reason why a switch-mode power This transistor was short-circuit base-to- supply is required is that the output powers collector. A replacement restored normal quoted by the manufacturer, and desired by operation. owners, from the huge speaker system sim- It transpired that the owner had been ply cannot be achieved with a nominal 12V attempting to fit a fancier fan, with rotating supply. Assume that 4çà speakers are used. blue LEDs on it. Such things are available With a 12V supply the maximum current as accessories. He had been trying to con- that could be driven through the speaker nect it to the remote-control circuitry when coils would be 12/4 = 3A. This would the failure had occurred .. . G.D. equate with a maximum theoretical power AUDIO of 36W, which is nothing like the hundreds Technics SU -X990D of watts often claimed. The switch-mode The owner's complaint with this heavy hi-fi power supply boosts the I2V input to typi- amplifier was "powers up but no output; cally ±20V. The theoretical power then crackling before, but was working". A fair FAULTS becomes 400W (current through the speak- amount of dismantling is required to get the er coils 10A). Allowing for system ineffi- main PCB out to examine its underside. Reports from ciencies, 100W RMS can easily be attained. Once I had reached this point and turned You don't get "owt for nowt" of course in the PCB over I came across one of the Geoff Darby this world. For the switch-mode section to worst cases of heat-stressed joints I've ever Eugene Trundle deliver the sort of power required by the seen. Just about every semiconductor amplifier proper, the DC input power device on the board, both power and small- James Grant requirement is huge. This is the reason why signal devices though, curiously, not the these amplifiers have input fuses that the output hybrid, had cracked or crystallised J.S. Ogilvie Electricity Board would be proud of, and joints on all legs. The worst were at the power terminals to which you could con- devices mounted on heatsinks. There was Martyn S. Davis nect welding cable (the owners often do.. also similar trouble at the legs of more than Chris Bowers and .). It's also the reason why you may find up a few passive components. to ten switching transistors connected in A lengthy blanket resoldering operation, Philip Rosbottom parallel, and why the majority of faults followed by a close inspection using a occur in this area rather than the output strong magnifying glass, restored the ampli- stages, which are quite reliable. fier to its former glory. G.D. You will often find that there's a blown fuse and one or more of the switching tran- Grundig M5C sistors is short-circuit. These are usually What's that then? It's a smart-looking FETs, and are readily available from your music centre and it worked well, except CD normal general component supplier. When music playout stopped after one-two hours. We welcome fault reports from readers checking them, don't get carried away The fault was in the laser unit, type KSS- — payment for each fault is made after looking for the same readings across them 213C. We replaced it with a bargain from publication. all. If you look a little closer you may well CPC: order code AS00201 brings you the find that some of the TO220 packages are complete CD deck, with two motors and Reports can be sent by post to: actually double diodes — the secondary side the laser assembly, for £13.50 (at the time rectifiers. If you find short-circuit FETs, of writing) net. E.T. Television Magazine Fault Reports, check for burnt-out print tracks and open- Highbury Business, circuit current-sharing resistors. Sony HCDH I 600 The cause of the vast majority of faults is This CD player attempted to spin up and Media House, easily found by checking as above. On read a disc but didn't, eventually saying Azalea Drive, Swanley, occasion however you may find that the "no disc". When I tried to open the drawer Kent BR8 8HU chopper control chip has failed. This can to get the disc out and see if the lens was lead to the demise of the switching devices dirty it wouldn't open, and a hum came so, once you've replaced any faulty ones, from the speakers. There was also a smell, or e-mailed to: you should attempt to trace the drive to like electrolyte, from somewhere around [email protected] them and disconnect it. Repower, remem- the regulator circuits.

June 2004 TELEVISION A close visual inspection failed to to get at. It lives on a little sub-board that Sony PMC-303L reveal anything amiss, and scope checks can be removed without disturbing any- This personal component system made a on the supply lines for any excessive rip- thing else. The part no. is T99-0559-05. skipping sound and wouldn't play CDs. ple also drew a blank. Time to dig deep- M.S.D. The cause was the KSS-213B optical pick- er. There's a row of electrolytics beneath up unit, part no. 8-848-379-31. A replace- the regulator heatsink. C280 and C282 Sony STR-DB930 ment restored normal operation. C.B. (both 100µF, 35V) were leaking elec- This unit failed to power up. Checks trolyte and had damaged the print run- inside with a voltmeter showed that the Sony HCD-CP333 ning through beneath their legs. cause was the display controller IC102, There were missing segments in the char- Everything worked again once I had part no. 8-759-641-15. There was normal acters displayed by the LCD panel. Checks repaired the missing print and replaced operation once a replacement had been on the main board, using a voltmeter, the two electrolytics. J.G. fitted. C.B. revealed that the cause was the system control chip IC601, not the display control Sony IS-D50 Sony HCD-CP300 chip IC602. A replacement, part no. 6-80°- This is a portable radio-cassette-CD play- Cassette playback was slower with deck 361-01, restored correct operation. C.B. er unit. The problem was that the tape A than deck B. The cause was the cas- jammed in the loaded position. This hap- sette mechanism itself, part no. 1-796- Technics SL-QX200 pens when the capstan belt, part no. 3- 078-11. A replacement restored normal This direct-drive turntable's arm lift didn't °29-598-01, slips off. As a precaution, fit playback. C.B. work. The actuator had come out of the a complete set of belts. J.S.O. lever/slot under the arm mounting. P.R. Sony STR-DE475 Kenwood SE-A551S There was no sound from this stereo Technics RS-M253X This three-year old AV control centre FM/AM receiver's left and right surround- The mechanism didn't do anything, came in because its volume control was sound speakers. Checks on the main because the large square belt that drives dicky. It's the first time I've had one of board, on the B side, revealed dry-joints at the gear assembly for the functions was these in for repair, and I was very glad RY550 and RY601. All was well once stretched. A replacement from CPC, 2mm that the volume potentiometer was easy these two relays had been resoldered. C.B. by 51mm, restored normal operation. P.R.

What a Lovely Pair!

HORIZON DIGITAL TERRESTRIAL METER HORIZON DIGITAL SATELLITE METER

HDSMV2 *g nal Strength and BER displayed together r • Signal Strength and BER displayed together Pre and post BER displayed on sub menu • 32 Transponders or 16 satellites, horizontal & vertical • 10 pre programmed transmitters (via website) M • Audible tune-in, with back light or all channel step through • DVB, C&Ku band, Mpeg, V Sat compatible • Audible tune-in, with back light • Input dynamic range -65dBm--25dBm • 7 or 8 MHz channels • Input connector F-female. Input imp 75 ohms po• 2K and 8K mode e • Symbol Frequency rate from 1 Msps-45Msps • Automatic Transmission and constlation • Universal charger 80 V — 250 V Ac. Intelligent Charger • VHF (band3) and UHF bands (CE approved) with delta V delta T detection Fast charge, • RF input range 167-862 MHz then Trickle • Input dynamic range —72dBm--20dBm • Run time with full charge (single LNB): Minimum 3 • Input connector BNC. Input imp75 ohms. Loop through hours from 2.4Ah battery • External power for mast amplifiers, etc. • Figure of 8 mains input connector. 2.1 mm Female • Built in universal charger 80-250 V Ac. Intelligent charger (CE PSU plug for external charge via car charger approved) with delta V delta T detection. Fast charge, then Trickle • LNB short circuit protection 500 rnA automatic limiter • Run time with full charge: Minimum 5 hours from 2.5 Ah battery • RF input range 950- 2150 MHz • Figure of 8 mains input connector. 2.1 mm Female NU plug for • Computer interface: Serial Port (COM 1,2,3 or 4) for external charge via supplied car charger upgradeable software on satellite settings. • Computer interface: Serial port (Corn 1-4) for upgradeable software on transmitters. , ' le Speed up your installations call NO i I t 8281 3777 : :2 [ i )_1 -1r-Ji '' or email lie for a reliable soluti0 - - -onI -) ., . For a roltable colutil

TELEVISION June 2004 tilt-adjustment screws. I changed all these items over and refit- ted the deck. Then I tried it, only to have exactly the same problem. This is not uncommon, the usual cause being that the surface-mounted driver chip IC2501 (BA5823FM) on the board under the deck has been damaged by the faulty motor. Be careful when you order the replacement, as the other chip on the board is designat- ed IC5201. If you want to be reasonably certain that the IC is faulty before you order a replacement you can check with a scope, set to DC, connected to TP5210. This is pin 17 of the flexiprint connector on the PCB. The signal here is called `Spdin', and is the control signal to IC2501 to start the spindle motor. Once focus has been achieved, this line will shift level. If it does, and the spindle motor doesn't start, there's a good chance that the IC is faulty. Once I'd fitted the replacement the unit read and played all discs correctly. One Aiwa HT-DV9OK final task remained - to set the optical A lot of engineers I know don't seem to block tilt. This adjustment must be carried like Aiwa equipment. But in general I've out whenever major mechanical work has D\ta had no problems with overall build quali- been done on the deck, such as in this Fault reports from ty, performance or design. It's rare to get case where the slide rods had been a fault that can't be fixed, or to find that a swapped over and sat on arbitrarily adjust- Geoff Darby problem is difficult to work on because of ed screws. Fortunately it's easy to do. poor mechanical design. This item was Insert a DVD disc and allow it to be and particularly noteworthy. The problem was read. Then stop the unit and press the Chris Bowers simple enough, a defective laser, but it's front-panel 'stop' and remote-control but- got to be the easiest one in the world to ton '5' simultaneously. This will bring up change, bar none! the jitter display. Press 'play' and confirm Once the unit's case has been removed normal playback. The first three figures in the top of the deck is completely exposed. the display represent the jitter percentage, To remove the laser you take out a single for example 092 indicates 9-2 per cent. screw at the end of the slide rod and dis- Once the disc is playing, move a few connect the ribbon cable. The replacement chapters in and confirm that a reasonably is just as easy to fit, after swapping the steady jitter figure is displayed. Next gen- plastic rack from the old one. Remember tly insert a 2mm hex wrench (Allen key) to unsolder the two very easy to get at into one of the three holes in the chassis shorting points at either side of its PCB pan, immediately under the deck. The after plugging the ribbon cable back in. machine can be stood on four upturned Aiwa parts are now supplied via Sony. coffee mugs to facilitate this. I usually The laser was very reasonably priced, start with the hole at the front. 'Feel' the We welcome fault reports from making the repair economic - something wrench around gently until it engages readers - payment for each fault is that's becoming increasingly rare with with the head of the adjustment screw. made after publication. DVD players. G.D. Try to avoid pushing on or disturbing the deck. Wait until any disturbance has Reports can be sent by post to: Technics SL-HDV600 evened out to a steady display again, then This four-piece DVD/hi-fi system refused adjust the screw gently one turn clock- to read any discs, DVD or CD, and dis- wise. Wait again for the display to settle. Television Magazine Fault Reports, played error code H02. This indicates Note the figure, then turn the screw two Highbury Business, spindle motor trouble. The motor did in turns anti-clockwise. Choose which direc- Media House, fact feel rough and stiff and in need of tion produced the biggest reduction in the Azalea Drive, Swanley, replacement. It's not supplied as a sepa- jitter figure, then continue adjusting in Kent BR8 8HU rate unit, coming pre-fitted to the plastic that direction until there is no further deck chassis (item 307 in the exploded improvement. Repeat this procedure for view) with the turntable already fitted. A the other two adjustment screws, which or e-mailed to: number of items have to be swapped from are accessible through the other two holes [email protected] the old chassis to the new one. These in the chassis pan. Finally go round all include the optical block, its slide rods, three again and tweak for the lowest jitter clips, bias springs and screws, two gears figure. and the suspension rubbers. Several other With this unit I was able to get a very gears are pre-fitted, also the optical block respectable 6-5 per cent (065 indicated).

June 2004 TELEVISION Treat anything below 8 or 9 as acceptable. below the white (base) wire. which they started to jump and freeze. A This adjustment should also be carried out When you replace the board in the unit, look inside revealed that the optical pick- when the laser is replaced. screw the `Q002' house assembly to the up assembly was working correctly. Then, One final note. If, after working on the amp board, using the screw next to the checking with a heat-gun and a can of deck, one of these units seems to struggle flexible connectors. Don't touch any part freezer, I found that the cause of the fault to read a disc, either DVD or CD, and you of the DVD or power board when doing was C702 on the DVD board. A small get very high jitter figure readings, check this. Normal DVD operation should be modification involving a couple of compo- the lens carefully for smudges or finger- restored once these two components have nents was required to restore normal DVD prints. These units are extremely intolerant been replaced. C.B. playback. C.B. of this — I've been caught out on more than one occasion. G.D. Sony HCD-5300 Sony SLV-D950GI There was no power supply operation. The This DVD player/VCR wouldn't play Sony HCD-S500 cause was found to be optocoupler PC901 DVD discs. I tried a quick play with a There was no eject or operation in the on the power board. Normal operation was normal CD disc, which played back all DVD mode. Multimeter checks on the restored once a replacement had been fit- right. So it seemed that the cause of the DVD board revealed that Q002, on side B ted. The part no. is 8-749-019-04. C.B. trouble was the optical pickup H211, part of the board, was faulty. A modification is no. 9-885-037-37. A replacement restored required when you get this fault. Remove Sony DVP-NS405 full normal operation. C.B. Q002 and replace it with 'house assembly' There was no display and the disc spun at part no. X-4954-896-1. The three wires high speed. A check on board IF89, side Sony DVP-F21 must be connected as follows: with the B B, using a magnifying glass revealed the The problem was that the disc dropped at side of the board face up and Q001 upside cause of the fault, a dry-joint at Q404. eject. A call to Sony technical provided down in front of you, connect the blue wire Once this had been resoldered there was a the solution. The push switch, part no. 1- to the collector (top), the white wire to the normal display and the disc rotated at the 762-594-64, on board MD91 needs to be base (bottom left), and the red wire to the correct speed. C.B. attached at the centre of the fixing. Fit a emitter (bottom right-hand side) next to the replacement, then check while holding the Q002 print. Also replace chip resistor R011 Sony HCD-C770 unit vertically so that the disc slot is face (11(Q) with a 470Q chip resistor, part no. 1- The pictures produced by this DVD player down: insert and eject a disc three times to 218-949-1. This is the chip resistor just were all right for about an hour, after ensure that it doesn't drop. C.B.

Test Case 498

One of the nastiest things that can occur when servicing supply components that Ray checked showed any signs of consumer electronics products is the 'instant blow-up' This being faulty, so he ordered a replacement MOSFET and also, sort of thing usually arises with the power supply in an audio to be on the safe side, a new MC44603P control chip output amplifier or a TV set. You look for and replace (IC7520). It could have been the initial cause of the fault, or it damaged components, then find that the replacements are may have received a dose of 300V at pin 3 when Tr7540 destroyed as soon as power is applied. The puff of smoke or failed. Reasonably confident that he had solved the problem, the blue flash from the fuse is very demoralising, especially Ray returned to his Hoover washing machine. It needed motor when it happens for the second or third time! The advent of brushes and a drum-drive belt. Variety is the spice of life! single-chip circuits has eased the situation in TV field output The spare parts for the Philips TV set were not long in stages and most audio amplifiers. But TV switch-mode power coming, and Ray quickly fitted them — he was under pressure supplies seem to be ever more diverse, and some of them are from the customer, as is usual these days. When he connected prone to repeated self-destruction on the repair bench. the set to the bench mains socket and switched it on there was The problem we had on this occasion was with a Philips a momentary buzz followed by a bright flash from the mains Model 21PT5322 (MD1.2E chassis). The set looked innocent fuse. Back to square one! enough when it came into the workshop, the fault report Ray studied the circuit diagram in the service manual. consisting of just one word, 'dead'. As Television Ted was There were so many possibilities! Maybe something funny away on holiday, it would have to be tackled by Cathode Ray with the optocoupler, or shorted turns in the chopper — between his washing-machine repair jobs and satellite call- transformer. Perhaps some heavy loading on the secondary outs, such is life in the workshop at present. Ray took the back side of the circuit, not detectable by cold resistance checks. off and the main PCB out, and soon found that the 2•5AT Possibly something on the primary side of the circuit breaking internal mains fuse F1501 was open-circuit, having blown down under load or applied voltage... violently (its glass was black inside). This could be an easy Ray found a helpful section in the service manual, headed one, Ray thought. He checked the mains bridge rectifier 'fault finding in the power supply'. It called for the use of a diodes, which were all OK. The associated filter capacitors, on DC power supply, so Ray approached Sage for the loan of his the AC and DC side of the bridge, were also OK. But the one. This worthy, acquainted with the situation, took one look chopper transistor Tr7540 was short-circuit between all three at the set and made a suggestion that resulted in a complete pins. It was a MOSFET device, of a type that Ray had never cure. What was it? Should Ray have known more? come across before — an STP4NA60F. Needless to say there was no such thing in the stores. None of the other power- The answers will be found on page 507.

TELEVISION June 2004 489 Panasonic NV -SD2208 A cassette was trapped inside this machine, revealed that C604 was the cause of the while the front panel displayed the caption fault. This double-layer 0.2214F memory H02. It didn't take long to discover that the capacitor had started to leak on to the capstan wasn't turning. It took rather longer board. A quick board clean up and a to establish that the BA6187S capstan-drive replacement capacitor restored normal oper- chip IC2501 was the cause. E.T. ation. C.B.

Philips VR437 Aiwa VX-G 1 43K This VCR produced no signs of life, but the This VCR was dead. I found that the mains fuse was intact and there was 320V STRF6707 chip IC501 in the power suppl \ at the chopper transformer's primary wind- was faulty. Nothing else had failed. B.L. ing. My trusty ESR meter showed — after discharging the mains bridge rectifier's Akai VS105 reservoir capacitor! — that C2114 and Failure of the brakes to release in fast for- C2201 had both dried out. C2114 (47µF, ward/rewind was cured by cleaning the 25V) is on the primary side of the power mode switch. The fault with another of supply, while C2201 (4714F, 50V) is on the these machines was no RF or video output secondary side. E.T. and no supply to the tuner. FR3 (0.352) in the 18V supply was high in value. L.G. Daewoo V235 VCR CLINIC This VCR was dead. After a lot of search- Amstrad UF30 ing in the power supply I found that R52 This VCR wouldn't store channels. The Reports from (390kQ) was open-circuit. I also replaced cause was the X24CO2P EEPROM IC6004. R51, which has the same value, though this L.G. Eugene Trundle one produced the correct resistance reading. Peter Tennant In addition it's best to check the electrolyt- Alba VCR7300 ics in the power supply. A couple of them According to its frustrated owner this bud- Chris Bowers were low in value. P.T. get VCR did all sorts of strange things. As usual, removal of the mode switch and a Bob Longhurst Sanyo VHR899 check inside showed what was wrong. Once L. Gare This VCR was dead with the fuse in the it had been cleaned and retensioned, then plug open-circuit. I thought it was going to refitted, the machine behaved normally. Dave Gough be an easy job, but not so. When I tested D.G. the machine I found that it was very slow at and loading tapes. It turned out that the loading GoldStar 12631 This VCR was dead with no display. I Martin McCluskey motor had to be replaced. All was well after a general clean and test. P.T. removed the power supply can and checked niu the ESR of the electrolytics. True to form, JVC HRD455 they were all faulty. Once all eight had If one of these good old machines won't been replaced the machine sprang to life. accept tapes, replace both cassette switches To avoid comebacks, it's good workshop to cure the problem. P.T. policy to replace every electrolytic capaci- tor in this power supply. D.G. Aiwa HV-GX35 A very dim display is a common fault with Panasonic NVSD40 this model. The cause is usually CP25 The complaint with this VCR was that it (1,000µF, 10V) in the power supply but, if produced bad pictures. This was confirmed you are unlucky, it can be fluorescent dis- when I connected it to my monitor on the We welcome fault reports from readers play itself. P.T. bench. Head cleaning proved fruitless, but I — payment for each fault is made after had in stock a replacement drum unit. Once publication. Sony SLV750HF this had been fitted the machine produced This VCR produced snowy playback pic- stunning pictures. D.G. Reports can be sent by post to: tures, though the sound was OK. As a first step I checked the drum for possible dirty or Sanyo VHRH790E bad heads, but everything was OK in this This VCR remained dead after a power cut Television Magazine Fault Reports, respect. I then checked the head amplifier and no amount of blasting with a hairdryer Highbury Business, assembly and found that IC801 was the produced any signs of life. When I removed Media House, cause. A new IC restored clean pictures. the deck and PCB I found that one of the Azalea Drive, Swanley, Kent BR8 8HU C.B. start-up resistors in the power supply, R60001 (2701d2), was open-circuit. A Sony SLV825 replacement brought the machine back to or e-mailed to: The display disappeared when the life. Beware of a fully-charged mains-recti- [email protected] PAL/NTSC switch was in the PAL position fier reservoir capacitor. The other series- but was OK in the NTSC position. connected start-up resistor, R60007 (68k52). Capacitance meter checks on board MFI67 is less likely to cause problems. M.McC.

June 2004 TELEVISION e ,44* ft

ELECTRICS LIMITED i e jeee e-% 171 HAREHILLS LANE, LEEDS LS8 30E Tel: 0113 240 1114. Tel/Fax: 0113 240 7275. S.` .-ere _ç . cell e ç". Mobile: 07976 403134 P-eCI

O l e (ele % ee "S' Email: [email protected] 9.e.‘ GC' t- __fe el- rko PHILIPS .„l'k e*t

14" PORTABLE FROM £39.00

14" COMBI TV/VCR £69.00

24" W/S TV FROM £149.00 28" W/S TV FROM £169.00 WWWhy go any- 32" W/S TV FROM £269.00 where else for DVD PLAYERS FROM £34.00

VCRS FROM £34.00 Panasonic

AUDIO FROM £34.00 spares? 4ttf PLEASE CALL FOR A STOCK LIST MANUFACTURERS GRADED PRODUCTS From phones to cameras, home cinema systems to DVD players. Panasonic brings ideas to life. If you service or repair any of our products. we can make your life easier too. thanks to the new Panasonic Spares Direct website.

I I jJjj rjjj9 ireless Handsfree Solution Specially developed for smaller companies who only need parts or advice occasionally but still want w,Jrjto iii )jj ouf genuine discounts on guaranteed spare parts. it's W.Drif,3 W nh phriliu now open for business r..:14yorytt.9 llejlAyt hu9d9d Register on the site now and you'll find the most competitive prices, ont ne technical information and ii hiJiaflWi repair manuals. special offers and immediate part number identification. Clip th u wirufer.,-; epuvirY.f.ph y9 ur Wj'iiocjï It's fast, it's easy. it's trouble-free and it's the only th9 5yIrlycc trillicinin9r th y9ur pi19.11 place you need to visit when you need to service or "Th 9.1•1 y9ur r.vJj th Jri with ihy e 4iiu repair any Panasonic product.

So why call us for spares when you can now visit us 24 hours a day?

Visit www.panasonic-spares-direct.co.uk for more information.

Order Code FONEFREE Price £ 16.00 + vat Panasonic

eios cxue (pe4j ititYlkn the 11.)4Le 1).1).9.511d Panasonic CS UK i-P_Ate9 , Urin'15 , ?'•.-);) In r_;91ninsedbli 9Jtf s, Willoughby Road. Brackrell. Berkshire. RG12 8FP Wuinbluy '1.0.Funr..1 ()29) :31./l/l) 27:32 D F L (92 U) 5-12.5 www.panasonic-spares-direct.co.uk 2:m.1.111

TELEVISION June 2004 491 that the fault was in the power supply. I noticed a couple of high-value resistors around the chopper IC, and when these were checked I found that RPO6 (3.9MS2. 0.5W) was open-circuit. A replacement brought the set back to life. It seems to be a popular model. P.S.

Philips 28PW9536/05R (SMG7.1E chassis) The complaint with this set was distorted sound from the right-hand channel. Interchanging the speakers made no differ- ence. On the assumption that it was not an output stage fault, and having found that there was activity around the MSP3410D multiple sound processor chip IC7751, I decided to order a replacement. This 68- pin surface-mounted IC is a horror to change. Thankfully the replacement put matters right. P.S.

Mitsubishi CT25AV1B (EE3 chassis) The customer complained that the picture was too wide. On inspection I saw that there was an EW problem. Checks TV FAULT FINDING revealed a short-circuit reading across one of the EW modulator diodes, D506, but the diode itself was OK. Time to discon- Reports from nect pins 4 and 5 of the TEA2031 A EW Matsui 2107T correction chip IC551, where a short-cir- Michael Dranfield This set's power supply was tripping audi- cuit was found to be present. A replace- bly. A check on the 2SC5250 line output ment IC restored the scanning to its cor- Philip Salkeld transistor showed that it was slightly rect width. P.S. leaky. The cause wasn't obvious until I Mike Leach brought my x10 eyeglass into play: I Toshiba 3339DB could then see a ring around one leg of the The standby light was on but there were Eugene Trundle line driver transformer. Resoldering plus a no other signs of life. A check at the HT replacement transistor restored normal fuse produced a reading of 60V, which Uel Harte operation. M.D. indicates that the set is stuck in standby. This is a known fault, the cause being M. Richardson LG KE14P2GX shorted turns in the line output trans- This is a 14in. TV/VCR combi unit. If the former. In the past the cost of this item Jerry Fedorak fuse in the plug or the internal mains fuse has been prohibitive, but I've noticed that blows every couple of weeks, replace the Toshiba now stocks an equivalent, part no. Bill Bolem and degaussing posistor TH801. It has a ten- 23236641, at a very reasonable price. It dency to intermittent internal flashover. makes repair of this oldish set a sensible Gary Laidler I've had this fault a few times now. M.D. proposition. P.S.

We welcome fault reports from readers Ferguson M51131 (TX807C Philips 28PW6615/05 (MG1.1E — payment for each fault is made after chassis) chassis) publication. This set seemed to be dead, but voltage The customer said that the picture would checks showed that there was 35V at the flash red then went completely red. No collector of the line output transistor. Cold surprise to find that the W66ESF002X14 Reports can be sent by post to: checks revealed a dead-short rectifier, tube was faulty. Fortunately it was DP092 (MUR120), on the secondary side insured. After fitting a replacement I was Television Magazine Fault Reports, of the power supply. A replacement rewarded with sound and a raster. A check Highbury Business, brought this eighteen-month old set back on the CRT base board showed that the Media House, to life. M.D. TDA6108JF RGB output chip was run- Azalea Drive, Swanley, ning cold. Further checks revealed that the Kent BR8 8HU Bush WS6674 (11AK37 chassis) BAV21 diodes D6305, D6306 and D6307 This set was dead with no LED display. (part no. 4822 1303080842) were all The mains bridge rectifier's reservoir leaky, also the BAS216 diode D6310 (part or e-mailed to: capacitor held its 330V charge when the no. 4822 13083757). To be on the safe set was switched off, a clear indication side I also replaced the TDA6108JF chip, [email protected]

June 2004 TELEVISION part no. 9352 56140112. CRT flashovers from the right-hand channel. Two zener of us to carry it into the workshop! The can cause quite a lot of destruction. P.S. diodes in the audio output circuit were complaint was a rattling/whistling sound found to be faulty, ZD4002 (36V) and that came from within and whose loud- Bush WS6674 (PT92 chassis) ZD4000 (12V). A couple of new diodes ness increased with the picture-tube's Apparently the picture had become nar- and another output chip restored the beam current. The line output transformer row then the set had shut down in stand- sound. M.L. was the cause, the set running silently by. I found that the BY228 EW modula- once a replacement had been fitted. E.T. tor diode DD07 and the BD680A driver Philips 14PT3685/05 (L9.3 transistor DVOI were short-circuit, while chassis) Hitachi CPT2578 (G8Q chassis) RV38 (MU) was burnt out. When I It's great when you can relate what you How old does a TV set have to be before replaced these items and switched the set learnt at technical college all those years it gets kicked out of this column? This on it was back in the narrow-picture con- ago to a fault with a modern-day receiv- one clocks in at some fourteen years. The dition. After a few seconds RV38 started er! The symptom with this set was a bent complaint was about an intermittent to overheat. When you get this situation, and rather curvy field collapse. I remem- burping from the loudspeaker in the check CD08 and CD21 (both 680nF, ber being told that the cause would usual- standby mode, with the two green LED 250V) with a capacitance meter. ly turn out to be open-circuit field scan bars flashing. The cure was to replace Replacement of one of these capacitors coils. Well, not quite. In this case it was- C908 (470pF, 25V) in the power supply. normally clears the fault. On this occa- n't the coils themselves but an open-cir- E.T. sion however there was glue at the two cuit connection in the scan-coil plug, legs of CD21. It effectively made CD21 which plugs into the main PCB. The Tatung T2OTD51(D series open-circuit. All was well once this clear crimping was poor and was easy to put chassis) glue had been removed and the capacitor right, providing a cheap cure. M.L. We rent out a lot of Tatung TV sets that had been resoldered. P.S. use this chassis and have got to know Sharp 37AM23H (5BSA them very well. But it was the first time Panasonic TX28PL4 chassis) we'd had this fault. The 115V rectifier There was sound but no picture from the Only snow was present on the screen, and D809 was dry-jointed at both legs, the AV3 output. Otherwise the set worked I soon found that there was no voltage at result being spasmodic shutdown. I also perfectly. My first step was to carry out a the tuner's supply pin. A circuit diagram found that the soldering of crystal XL301 self-check on the set, in case the micro- was required to follow the path of the was suspect. This is a common complaint controller chip had been corrupted. The supply to the tuner. In the process I found with the chassis. E.T. situation remained the same after doing a leaky 3.3V zener diode, D211. A this however. A look at the block diagram replacement restored life to the tuner and Philips 14PV320 showed that the AV3 socket is fed from all was then well. M.L. This TV/VCR combi unit produced the the video processor chip IC601. A no-go symptom, though a subdued pump- replacement, part no. VDP3120BPPC2, Daewoo DTL25G7GB ing noise came from the chopper trans- put matters right. This IC has been a This set had poor and intermittent former as a result of the operation of its problem with many Panasonic models. remote-control functions. It would some- excess-current trip. Checks showed that P.S. times be OK, and on others wouldn't D6391 (BY W98-200) was short-circuit, appear to come out of standby. The LED though its series-wired fuse F1391 Philips 25PT4103/05 (L6.2 would turn green however, but no line remained intact. E.T. chassis) drive would be produced. When the set This set was very slow to start up. It decided to work correctly a very loud Tatung T21TD50 (D series would come on only when it had been buzzing and vibration came from the area chassis) switched on for about five minutes. While of the chopper transformer. Prodding and The picture had disappeared, though the it was thinking about rousing itself a loud poking in this area with an insulated, sound remained. I found that resistor hum came from the speaker, and I found blunt instrument made no difference to R427 (22Q) was burnt and open-circuit, that most of the voltages on the sec- the tone of the buzz. Bells started to ring because the line driver transistor TR402 ondary side of the power supply were in my empty, Monday-morning head, so I was leaky. It's advisable to fit a low. A drop of freezer and my trusty measured the voltage across the mains 2SD677C type in this position, in place of hairdryer helped with the diagnosis. The bridge rectifier's reservoir capacitor. The the original BC337, even though the lead- cause of the trouble turned out to be tran- meter produced a reading of only 221V! out configuration is different. E.T. sistor Tr7501 (BF487) in the power sup- A replacement 180pF, 400V electrolytic ply. Mi. cured the evils mentioned above, and Grundig P37-070 (CUC7301 Monday suddenly didn't seem so bad chassis) Hitachi C32WD2TN2 (A7 chassis) after all! M.L. This set seemed to be dead, but the power This large-screen set's power supply was supply was tripping slowly. Checks on constantly pumping. As there were no Daewoo 1514 (CP365 chassis) the primary side revealed that R667 (10) obvious shorts in the line output stage I If the complaint is intermittent picture had risen in value to 3.1Q. As a precau- disconnected D952 to remove the 26V fading or no picture from a cold switch tion I also replaced R666, which is in par- supply to the audio output stage. The on, check for bad solder joints in the allel with R667. Note that the values can pumping then stopped, and inspection of tube's heater circuit — at pin 10 of the line vary with different chassis. U.H. the TDA7263 audio output chip IC4000 output transformer and the motherboard revealed a crack at the centre of the chip. plug pin it feeds. E.T. Bush DVD142TV (11AK46 I fitted a replacement, which went bang chassis) shortly after switch on. This time the set Sony KV36FS76U This TV/DVD combi set had been pur- continued to run but there was no sound This is certainly a heavy set — it took four chased from a local supermarket less than

TELEVISION June 2004 493 three months ago. But the owner had lost plug's socket, as this chassis suffers Sharp 51DT25H his receipt, and therefore wanted us to from problems here. After resoldering Strange noises came from the line output repair it. The red light would come on the socket I switched the set on and stage in this set. A quick check showed then, when the unit was switched on obtained a perfect picture. J.F. that L604 had been overheating. The from standby, the green light appeared. cause of the trouble was D604, which But shortly afterwards the set reverted to Philips 28PW6615/05 was short-circuit. U.H. standby. A check on the BU808DFI line When I tried this 28in. widescreen set output transistor Q602 revealed that it the standby LED was flashing. Cold Daewoo GB20C5NTS (CP185 was leaky. So a replacement was fitted checks in the power supply revealed that chassis) and all the associated circuitry was the relay, circuit reference 1002, was This set became a bit of a nightmare to checked. The unit was then left to run intermittent. It's available from CPC as repair. The fault was stuck in standby. for the rest of the day, with no problems. part no. PS280-10375. J.F. with the standby LED flicking slowly The next day the original fault symp- between green and amber. My initial toms returned, but this time the line out- Fidelity CTV3128NF suspicion was a fault in the line output put transistor was OK. The cause of the All this large set produced was a ticking stage, but there was nothing obviously problem was the MC44608P40 chip noise. Tests showed that the BU2525AF wrong here and a new output trans- IC800 in the power supply — found by line output transistor Q602 was leaky. former, also a new field output IC, made heating and freezing it. There were also dry-joints at the tuning no difference. To go into the service menu, first capacitors. Everything was OK once Attention was then turned to the press menu on the remote-control unit these problems had been attended to. microcontroller chip. Clock and data then scroll down to install. Don't enter J.F. pulses were present, and the supply volt- it: instead, press 4, 7, 2 and 5 on the age was correct. A scope check at reset remote-control unit. M.R. Goodmans Compact 110 pin 60 showed that it didn't toggle at There was no picture or sound, only the switch on. When I disconnected pin 60 LG R128CZ1ORX front red LED was on. When I checked the set came back to life. A replacement The first anode voltage was fluctuating, the 12V supply to the line output stage I microcontroller chip cleared the fault. producing a very bright raster with fly- found that coil LHO1 was open-circuit. Note that the new version 2 should be back lines. Checks on the tube base It's located near the TDA3653A field fitted, and that the EPROM should be panel showed that R709 (220Q) was output IC. A blob of glue on the track replaced at the same time. Remember to open-circuit and C703 (1014F, 250V) side of the PCB had hidden an open-cir- adjust the tuner option codes after fitting leaky. M.R. cuit solder joint at the coil. Once it had the replacements. U.H. been cleaned and resoldered the set Samsung WS28V53N worked normally. B.B. Technosonic 07 text This set was brought in because of lack The fault report with this Amstrad-based of green in the picture. Both IC501 and Philips 14PT1532/05 (L6.1 portable said "small picture". A check on IC502 (the red and green drive chips) on AA chassis) the HT voltage at the cathode of D511 the CRT base panel had short-circuit There was lack of height and foldover, produced a reading of only 85V instead pins, but the fault was still present when and R3405 was burning. The cause of of 110V. The usual culprits in this situa- replacements had been fitted. Further the fault was the surface-mounted capac- tion are C508 and C509 on the primary checks showed that R508 (82kQ, 0-25W) itor C2404 which was leaky. Once I'd side of the power supply. This time they was open-circuit. M.R. replaced these two components the set were OK, but I fitted replacements to be worked correctly. B.B. on the safe side. The actual cause of the Sony KV16 WT1U fault was the 330;4F, 160V HT smooth- The symptom with this new set was field Black Diamond BD14T ing capacitor C517. A replacement collapse. In the past I've found dry-joint (11AK2OS chassis) cleared the fault. U.H. problems in the field output stage in This set was dead with the mains fuse Sony sets. Not this time however. So out blown. On initial investigation I couldn't Schneider STV2802T with my trusty Ayo to check the voltages see anything else wrong — the MOSFET I am used to line output transformer fail- at the line output transformer, where the chopper transistor and its control chip ure with these sets. The problem with this 24V supply was missing. The dry-joint were both OK. By chance I then noticed one however was bad EW distortion. was at wire link L807, which was almost that the blue disc-type capacitor C808 Once the back had been removed the dropping out. Resoldering cured the was split open. A replacement plus a cause was obvious from the state of C313 fault. new fuse restored normal operation. (12µF, 100V — strange value). A replace- I also found poor soldering at the rear U.H. ment restored correct scanning. G.L. scart socket. After dealing with this I gave the set a soak test to ensure that Philips 14PT2002/05 (L01 .2E Goodmans 286NS (Philips everything was OK. J.F. chassis) L6.2 chassis) There was no sound. I initially thought The only sign of life with this set was a Sharp DV5940H (4BS-C that the set might be in the wrong sound faint whistle from the line output stage. chassis) standard, but checks on the menu and An ohmmeter check across the output This set was tripping, so checks were option codes proved fruitless. Close transistor produced a dead short reading, carried out in the line output stage where inspection of the surface-mounted jungle which is what you usually find with these the 2SD1546 output transistor was found chip IC7200 showed that several of its sets. But the transistor itself was OK, the to be leaky. After fitting a replacement I pins were poorly soldered. A complete cause of the fault being C2912 (2.2nF, checked the connections at the scan-coil solder reflow cured the fault. U.H. 2kV) which was short-circuit. G.L.

June 2004 TELEVISION Campion BSMART (CRA WLEY) LTD Electronics Ltd. m um M e_111. SUPPLIERS OF QUALITY EX-RENTAL TV'S Largest selection and video equipment to independent of retailers across the UK and EIRE. FREE DELIVERY SERVICE MAJOR MANUFACTURERS to most areas of UK NEW "B" WORLD WIDE EXPORT SERVICE GRADE PRODUCTS Large stock of TVs suitable for export Experts in UHF/VHF conversion T.V. VIDEO AUDIO Visit our large warehouse at: MICRO WAVE OVENS

Contact Paul Bean Units 1 & 2 Tenat Works, Worcester Rd, Kidderminster, BSMART (CRAWLEY) LTD. Worc, DY10 1JR 10/11 LLOYDS COURT, MANOR ROYAL, CRAWLEY, SUSSEX RH10 2QX Tel. (01562) 746000 (2 Lines) Tel: (01293) 618000 Fax: (01293) 400133 Just 20 miles from Birmingham City Centre

• Synthesized satellite cable and TV field strength meter with *PERIFELEC panoramic reception on 14 on (5.5') screen and digital carriers measurement FRUSTRATED! MC 30 A Spectrum Analyser • Complete microprocessa and IspL51 logic control. • Continuous frequent. from 46 to 860 MHz and from 920 to 2150 MHz on 4 bands. Looking for ICs TRANSISTORS • Selectable 4, 1 and 0.2 MM: spectrum bandwidth, picture measurement 1 MN:. A phone call to us could get a • Display of picture of selected synthesized channel • FM (Radio/Lit.', FUG, I, CNIC/K% Mkt TV standards and Ku and result. We offer an extensive C satellite standards. • Possibility of 32 programs memorized per frequency band • Display (2 Lines of 16 characters). range and with a World-wide Range of measurement of signal strength horn 20 to 120 d8PV, manual or automatic attenuator. database at our fingertips, we are able Battery life about l hour 20 minutes. weight 5,8 Kg. to source even more. We specialise in • Display of full-band andi possible eapanded spectrums. • Channels and frequency plans of cable and TV standards memorized. • Frequency, signal strength in d8pV or bargraph. displayed on a digital display (1 lines of 16 characters). devices with the following prefix • Voltage of remote power supply in 14v or 18v and 22 KHz in satellites DiSEg C'• v1.2 switching (to name but a few). The panoramic field strength meter MC30A combines in one instrument all the functions necessary for installing and checking TV or satellite reception, both analogue and digital. The visualization of the spectrum 2N 2SA 2SB 2SC 2SD 2P 2SJ 2SK 3N 3SK 4N 6N 17 40 AD and the picture allows the carrying out of all the necessary adiustrnents with this one instrument. The high ADC AN AM AY BA BC BD BDT BDV BDW BDX BF technology used in the MC30A allows a range of possibilities unheard of M a instrument in this prke category. BFR BFS BFI' BFW BFX BFY BLY BLX BS BR BRX BRY BS BSS BSV BSW BSX BT BTA BTB BRW BU BUK BUT BUV BUW BUX BUY BUZ CA CD DX CXA DAC DG DM DS Lacu na Digital Satellite M eter NE W Lacu na Terrestrial DTA DTC GL GM HA HCF HD HEF ICL ICM IRF J KA Digital M eter r iisto m designed, small KIA L LA LB LC LD LF LM M M5M MA MAB MAX MB iightweight ABS case, Small, lightweight c ustorn designed ff., , created with the terrestrial digital installation, MC MDA J MJE MJF MM MN MPS MPSA MPSH MPSU e installer in mind . identifies • MRF NJM NE OM OP PA PAL PIC PN RC S SAA SAB

paw • M eas ures signal sr, • SAD SAJ SAS SDA SG SI SL SN SO STA STK STR STRD carrier/nome ai.. rt . STRM STRS SV I T TA TAA TAG TBA TC TCA TDA TDB • UHF,c Vii • Analouge and digital TEA TIC TIP TIPL TEA TL TLC TMP TMS TPU U UA measurerne,0 UAA UC UDN ULN UM UPA UPC UPD VN X XR Z ZN • Removable 'F' connectir ZTX + many others • 4 line LCD won backlight • Weight including batteries 600ci . 12y line r>owni We can also offer equi%alents (at customers' risk). 519.1 j1/1 .11id A LARGE RANGE OF ELECTRONIC COMPONENTS ON BER will be displayed together Indetifies the chosen satellite OUR CD ROM — LIST AVAILABLE ON REQUEST Signal strengths and BER settings calibrated Mail, phone, Fax, Credit Card orders & callers welcome. facility for recalibratan by distributor Removable 'F' connector Connect ..F113 short circuit protection and Lfiti power VISA supply Compatible with all satellite transmissions te. Ku and C band, DV8 and 055 Cricklewood Electronics Ltd 40-42 Cricklewood Broadway, London NW2 3ET Full catalogue of Perdeiec meters available, COASTAL AERIAL SUPPLIES Tel: 020 8452 0161 Fax: 020 8208 1441 sveveveeseceseepawsweeeweeeeteweeseesemaefee Sole Import please phone for Unit X2. Rudford Industrial Estate, Ford. Arundel BN18 OBD Distributors www.cricklewoodelectronics.co.uk deals. Telephone 0870 2641990 Fay. 0870 264 1991 E-mail: salesecricklewoodeleetronics.com

I ELEVISION June 2004 495 CLOSED CIRCUIT DICTIONARY OF TELEVISION BOOKS TELEVISION: CCTV VIDEO AND AND HOME ELECTRONICS REPAIR INSTALLATION, TELEVISION The Television Book Service offers access to our team of MAINTENANCE TECHNOLOGY AND OPERATION Jack Tsatsoulin specialist publishing experts. We can order any book or Joe Cieszynski This work provides comprehensive and CD-ROM currently in print from War And Peace to the CCTV surveillance is one of the fastest growing contemporary information on the essential areas in the security industry, and this is a concepts and terms in video and television, Newnes Guide to Television and Video Technology. All thorough guide to the technical side of COY — including coverage of test and measurement including installation, maintenance, video procedures, The CD accompanying the text books are delivered free of charge within the UK unless recording, cameras and monitors. The second includes an electronic version of the book. edition is fully dual-standard for PAL and otherwise stated. Contact us at the numbers below: 8151 systems. Telephone: 01737 812727 or 01737 812676 2nd edition • Sept 2003 • 256 pages Sept 2002 A 365 pages 8. CD-Rom Fax: 01737 813526 Glossary • Index • PB A Published in UK Published in UK Email: [email protected] I o 7ço6 sm 6 £24.99 £29.99

DVD PLAYERS ELECTRONIC INTRODUCTION NEWNES AND DRIVES CLASSICS: TO DIGITAL DICTIONARY OF K F Ibrahim DVD plagerssnd COLLECTING, SYSTEMS ELECTRONICS (College of North edehiss West London) RESTORATION John Crisp SW Amos; R S Amos +Aw e. This text is based on hands- AND REPAIR This self .study text introduces Aimed at engineers, on experience and acts as a Andrew Emmerson digital electronics from first technicians and students guide to DOD technology principles, before going on to cover all the main working in the field of This text encompasses all aspects of buying, and its application, with o special focus on design areas of knowledge and expertise. It covers electronics, this dictionary provides clear and collecting, restoring, repairing, sourcing parts, issues. The principles of the subject are the practicalities of designing and building concise definitions, including TV, radio and professional services, clubs and societies. The first introduced from the basics, and DOD applications circuits, including fault-finding and the use of computing terms, with illustrations and part covers technical aspects of restoration and are illustrated by genuine technical information. test equipment. circuit diagrams. details where components can be found; the second presents useful information for collectors.

Aug 1998 A 256 pages A Index Aug 2003 A 256 pages A Glossary A Index 10 halftones • 50 line illustrations A PB Feb 2000 • 302 pages A Glossary A Index 4th edition A Mar 2002 A 394 pages PB • Published in UK Published in UK PB A Published in UK 100 illustrations A PB • Published in UK Code 0-1506-5136-1 £24.99 Code 0-1506-3788-9 £21.99 Code 0-7506-4583-0 £18.99 Code 0 /506 5642 £12.99

NEWNES NEWNES PRACTICAL PRACTICAL GUIDE TO GUIDE TO ELECTRONIC FAULT • ELECTRONICS Practical TELEVISION DIGITAL TV FINDING AND rakl HANDBOOK Electronic , & VIDEO Richard Brice TROUBLESHOOTING Ian Sinclair Handbook TECHNOLOGY Television Covering all aspects of digital Robin Pain (Design A collection of all the key & Video television, this text Engineer, Cohn International Ltd) data, facts, practical guidance Eugene Trundle Technology encompasses the electronics A text using simple circuit examples to illustrate and circuit design basics An exploration of television of the equipment, data principles and concepts fundamental to the needed by a spectrum of students, electronics and video technology. It compression, television production, servicing and the process of analog and digital fault finding. It aims enthusiasts, technicians and circuit designers. It rovers the fundamentals of digital television different transition methods terrestrial, satellite and provides explanations and practical guidance, (satellite, cable and terrestrial) and digital 10 help the reader tackle any job, from fixing a cable. The text has been updated with developments TV to improving the sound of a hi-fi A digital and includes new sections on SHF techniques and video, as well as providing a grounding in since the 2000 edition. intruder alarms. analogue systems. multimeter and oscilloscope are needed for these jobs.

2nd edition • Oct 2002 • 304 pages • Index 3rd edition A Feb 2001 • 432 pages A Index 45 illustrations • 15 photographs à FIB Apr 1996 A 284 pages A Index 5th edition A Feb 2000 A 571 pages PB • Published in UK Published in UK 50 line illustrations • PB • Published in UK Illustrations • PB A Published in UK Cud , , , £17.99 £24.99 (ode , z £21.99 Cod,: u /506 4585 i £16.99

RSGB RADIO & REFERENCE DATA SERVICE SERVICING tn ELECTRONICS FOR ENGINEERS: ENGINEER'S UUMVP. TV, SATELLITE names M CIIIII/aC COOKBOOK COOICOO011 RADIO, POCKET BOOK & VIDEO Radio Society of ELECTRONICS, Lewis 8 Sinclair EQUIPMENT Great Britain COMPUTERS AND This title aims to provide the Eugene Trundle Only a basic knowledge of service engineer with all the COMMUNICATIONS A practical hands-on electronics is assumed for this necessary information to carry guide for service collection of electronics projects, and it is ideal for Mac E Van Valkenburg; Edited by out work on domestic electronics Wendy Middleton engineers, installation technicians and servicing all electronics and DIY enthusiasts and equipment. The coverage ranges from satellite students, this text emphasises the practical experimenters. Designed by the RSGB, the UK Written by professionals for professionals, this is reception to NICAM. Both analogue and digital business of fault diagnosis and repair of TV, radio amateurs federation, the projects are o complete reference for engineers. As well os equipment are covered, and there are chapters satellite and video equipment. clearly explained step by step. addressing radio technology data, it covers digital on common problems. electronics, computers and communications

9th edition • Aug 2001 Nov 2000 A 336 pages • PB • Illustrations 1568 pages 8 CD-Rom • 1385 line illustrations Revised 2nd edition • Nov 2001 • 336 pages Published in UK H8 A Published in UK Jan 1998 • 238 pegesA FIB Symptom index A PB A Published in UK Code 0-7506-5214-4 £17.99 Code 0-7506-7291-9 £90.00 Code 8000 .7506 £ 14.99 Code 0 7506 £21.99 TELEVISION TELEVISION IC TV FAULT- VALVE MICROPROCESSOR DATA FILES FINDING AMPLIFIERS Valve IC DATA FILES J Edwards GUIDE Morgan Jones Amplifiers 1 Edwards A compendium of data on Edited by The author s Microprocessor ICs ore the most complicated part all the most common Peter Marlow straightforward approach, integrated circuits used in of DJ equipment and present special problems to A distillation of the most using as little maths as televisions, Each device is the engineer. This text covers the most popular used fault reports from 11 possible, should be of use microprocessor ICs. Each device is presented illustrated with a pin-out years of Television to those with only a limited graphically with the relevant data information diagram, and all the measurements and signal magazine. Arranged by knowledge of the field cis gis en against each pin. data in the book were taken under actual make and model, it features over 200 reports on well os being the standard reference for experts working conditions. This second edition contains over 300 models of television, including diagnosis in valve audio. Design principles and construction over 70 new ICs. and repair advice. techniques are also provided.

Mor 1997 • 240 pages A 200 line drawings 2nd edition • Jan 2000 A 24.5 pages Mar 2000 A 381 pages A Illustrations 3rd edition • Aug 2003 • 624 pages • Index Pd à Published in UK PB A Published in UK PB • Published in UK PB • Published in UK Code 0-1506-3335-2 £19.99 (ode 0-75064581-4 £18.99 £20.99 £29.99

VCR FAULT- VCR IC VIDEO AND VIDEO FINDING 1111111 DATA FILES CAMCORDER DEMYSTIFIED GUIDE .1 Edwards SERVICING Keith Jack Edited by This text aims to provide the AND This edition has been Peter Marlow workshop technician and TECHNOLOGY updated to include A distillation of the most the field engineer with a information on digital used fault reports from 11 convenient method of fault- Steve Beaching television, datacasting, years of Television finding without the need to A comprehensive guide to domestic VCR interactive video, digital magazine Arranged by consult workshop manuals Tie most miler ICs technology and repair techniques. This edition camcorders and VCRs, and video interfacing. make and model, it features aver 2000 reports used in video recorders are revered. Each device brings the information fully-up-to-dote, with (overage is international, including European, on over 200 models of VCR, including diagnosis is presented graphically with fate given against expanded coverage of camcorders, sections on Asian and North/South American video and repair advice each pin. DVD equipment and the latest VCR technology. standards, methods and techniques.

3rd edition • Jul 2001 • 784 pages 8. CD-Rom Mar 2000 • 447 pages • Illustrations • P8 Jul 1998 A 448 pages • POO line illustrations 5th edition • Apr 2001 • 323 pages References • Glossary A Index • PB Published in UK PB • Published in UK Illustrations • PB A Published in UK Published in UK Code 0-7506 -163,1 9 £20.99 Code 0-7506-3993-8 £20.99 (ode 0-7506-5039-7 £20.99 Code 1-878707-56-6 £50.00

THE DIGITAL Ile liallel Salado NEWNES GUIDE TO TELEVISION ORDER FORM SATELLITE TV Handbook RADIO AND Please order or search the following: HANDBOOK COMMUNICATIONS Mark E Long TECHNOLOGY Code Description Clty Price A handbook and (D- Ian Poole ROM pack on digital satellite television. It This is a guide to the technology and applications provides an overview of all the digital TV of modern rodio and communications equipment. platforms in use world-wide. It includes satellite The author's approach prcvides a useful coverage maps and transmission parameters that readers will need to receive digital P/ services foundation for college students and technicians seeking an update on the latest technology. from any location in the world.

Jul 2003 • 352 pages • Index • PB Sept 1999 • 207 pages B. CD Rom A PB Published in UK POSTAGE & PACKING FREE IN THE UK" TOTAL (ode Bill 0 iSUii 71/1 8 £41.99 (ode 07)06-5612-3 £16.99 Name Daytime Tel Address VALVE RADIO NEWNES TV Postcode & AUDIO & VIDEO REPAIR ENGINEER'S I enclose a cheque/postal order value payable to 'Boffin Books Ltd' HANDBOOK POCKET BOOK VAIVE Please debit my Access/Visa/Switch/Delta card Issue number (Switch only) Moe wohmt4 Charles Miller RADIO& AUDIO Eugene Trundle REPAIR 1-1ANDB0( A practical manual for This updated text provides a Card Number Expiry Date collectors, dealers and pocket tool for service engineers. It presents a service engineers of valve audio and radio range of essential infc-mation in a compact form, Signed equipment. This edition includes new material on covering television reception, satellite and cable restoration and volve amplifiers. television, video recorders, colour camera 'Postage charges outside the UK available upon request or email, salesteamgboffinbooks.demon.co.uk technology, teletext wid fault-finding. Pot lo Boffin Books Led, 24 Walton Street, Walton-on-the-Hill, Tachvortfi, Surrey KT20 751, UK

If you 01 e ordering by credit card, need further information, or would like to use our search facilities, call 2nd edition A Apr 2000 A 280 pages 01737 812727 Fax 01737 813526 • 10 halftones A 50 line illustrations • PB Ihe order/helpline n open from 9am to 5pm or leave your order on our out of hours answetline or email us at Published in UK 3rd edition A Oct 1499 A 512 pages • HB soksieoneu'bolfinbooks demon ro ok Code 0-7506-3995-4 f 20.99 Code BUT 0-7506-4'94-0 £17.99 When placing orders please quote • Come • Address (home S delivery) • Daytime telephone number • Debit/Credit cord number • Expiry date • Details at order Meese noie that prices may change, but are correct at time of going to press. iijiii••••••••••• I T••••••4•• lapel PAY•

C•m•••• IGO o•ee.o.

r Ds * o.,... ••••, M AU'. lor

g Meyer II • ow ••• e

=etar.1•••

r p os r 1-1 r P r/Kocie r ron.r..., rem ro... r r os. r GSM r rovo,. r r r ohm. r Nee. r r nc r

tomemoller Mae 1 Ge m., ele Ala n.

I ele.2306 So Ur. Photo 2: The GX::Transcoder program.

"91 1111111,11111 11111111111111 mr1112111111E1 1111111111.111111

Photo 3: The Cool Edit Pro program.

SATELLITE NOTEBOOK BT Tower Reports from of them do), as these can be recorded over Christopher Holland and treated in much ttr same way as tape. General Enquiries Recording can be done using the PC-based Hugh Cocks and satellite receiver I've motioned several 0800 212 857 times over the past few months, though a +44 20 7432 5955 Michael Dranfield couple of intermediate steps are required before a recorded file can be transferred im—[email protected] on to a CD. When the satellite ridio programme is stored on the hard disk it will be in Recording satellite radio on CD MPEG-1 Layer 2 format (MP2), with sam- I like to record radio programmes on a CD pling at 48kHz. This has to be converted Photo 4: The BT Tower caption. from time to time, in particular for listen- to a Wave file with sampling at 44.1kHz ing to in the car. It's handy if the CD play- before it can be accepted by a CD record- er accepts rewriteable audio CDs (not all ing program such as Nero 6. ee GX:Transcoder ee. Universal Audio and Video Format Converter http://w ww.germanixsoft.de

Lade Enstellungen / Loading def auks ... check encoders FACIUTY UNE and Photo 1 The GX Transcoder program. Photo 5: The facility line caption.

June 2004 TELEVISION Table 1: Latest digital channel changes at 28.2°E

Channel and EPG no. Sat TP Frequency/pol

Bollywood TV (844) EB D7S 11•588GHz/H BT Tower caption*. See Photo 4 2A 14 11.973GHz/V Facility line*. See Photo 5 2A 14 11.973GHzN Golf TV Pro Shop 2B 36 12.402GHzN Islam TV (836). See Photo 6 EB D11S 11.662GHz/H Liberty Radio (936) 2B 36 12.402GHzN Yarr Radio (937) 2B 32 12.324GHzN

*Receivable only with non-digibox receivers at the time of writing. Photo 6: The Islam TV test pattern. TP = transponder. EB = Eurobird. 2A/B = Astra 2A and 2B.

Signal Detection While Nero is happy converting the sync with the MPV file. 11081MHz 114) SR 3750 3,4 more familiar MP3 type file into a Wave If you wish to save anything in MP2 file it can't cope with an MP2 file. A use- Signal Level (100%) format using Cool Edit Pro, a DLL file has 1111111111111 M1111111111111111111111 n11111111 r ful free program called GX::Transcoder to be added to the program. It's available (99%) that will convert MP2 files to Wave format free and was part of a much older version lnlI M1 MillInigl11111111111111111111111111 is available from www.germanixsoft.de of Cool Edit, being discontinued in the up- (see Photos 1 and 2). It will also convert to-date versions of the program. You can MP2 files to MP3, which is useful for find the DLL add-in, as I did, by doing an portable audio players that may not play internet search with Google or a similar MP2 files, though I have no experience of search engine: type in Cool Edit MP2. You this. The program is unfortunately a large are immediately directed to the right place, download, at about 17MB. with directions of how to install it as well. Photo 7: Exatel test signal from Express If the satellite receiver program has Another way of making an audio CD is AM22. saved the recorded programme as an MPA to use the Cool Edit Pro program to store file, alter it to an MP2 file as the audio directly on the hard disk any audio that's .111 'qr.« transcoder doesn't know what an MPA file coming from the sound card. Prior to stor- • . Main Menu , is! This is easily done by right-clicking on age, a new file has to be created: remem- - • - the mouse once the file icon has been ber, when prompted by the program, to set Select Service P TV Guide selected, then going to the rename option the audio sampling rate at 44•1kHz. Once Parental Control and changing the A to a 2. Ignore the you've stored the material and carried out Windows warning message that the file any editing, save it as a Wave file. It can may become unstable if you proceed with then be transferred to the CD recording the change. When the file has been con- program. H.C. verted to Wave format it will still be with 48kHz sampling but, once you've trans- Digital channel update ferred the file to the Nero recording pro- The latest channel additions at 28.2°E are gram, it will be changed to 44.1kHz sam- listed in Table I. Where allocated, the pling. That's helpful! EPG number is shown in brackets after the Another program that will do all the channel name. conversion is Cool Edit Pro, see Photo 3 — Towards the end of March a lot of the Photo 8: Test KRT signal from Express AM22. it was mentioned recently in the letters channels in the EPG range 100-200 were pages. The company that made this pro- renumbered. Table 2 shows the revised gram has been taken over by Adobe, and listing. C.H. the program is now known as Adobe Audition. Cool Edit doesn't mind whether Express AM22 (53°E) the stored file is MP2 or MPA, but the This month well take a look at the option of extracting the audio from a video transponder activity aboard the recently file has to be selected rather than opening launched Russian Express AM22 satellite the file in the conventional manner. at 53°E. Though the satellite has a relative- Cool Edit is also useful for enhancing ly low elevation angle, it provides very the sound track of stored off-air TV pro- strong Ku-band signals in Western Europe. grammes prior to recording them on to a Eutelsat recently announced that it would DVD, as described last month. After be leasing some transponder space on the adjusting the audio characteristics, save the satellite, which is so far relatively little file as an MP2 type which can then be used. At present only two transponders are transferred to the DVD Lab authoring pro- being used for TV, though this should gram. It's most important not to alter the increase somewhat in the near future. length of the file, as it would be out-of- In early April there were tests labelled Photo 9: Ukrania I Mir from Express AM22.

TELEVISION June 2004 499 Table 2: Revised EPG channel numbers

136 Men and Motors 181 Avago 139 Sky Travel 184 BEN 140 Sky Travel Extra 187 Reality TV 142 UKTV Style 190 Hallmark (no change) 143 UKTV Style Plus 193 E! Entertainment 144 UKTV Food 196 UKTV Bright Ideas 145 UKTV Food + 1 199 FTN 146 UKTV Drama 202 Performance Channel 148 Travel Channel 205 Rapture TV 149 Travel 2 208 Friendly TV 151 Ch. 4 VVales/S4C Digital* 211 ACTV 154 Discovery Health 214 Live TV 157 Arts World 217 Game Nation 160 Life TV 220 Fashion TV (no change) 164 E4 + 1 223 OBE 166 Overload 226 Game In TV 169 BBC1 (Ireland)** 229 Biography Channel 170 BBC2 (Ireland)** 232 Hollywood TV 172 Game Network 247 Classics TV (no change) 175 ITV2 289 FX (no change) 178 You TV 295 Sky Vegas Live (no change)

*With viewing cards registered at a Welsh address Channel 4 is now on EPG no. 151 and S4C on EPG no. 104. **In Ireland BBC1 and BBC2 Northern Ireland are on EGP nos. 169 and 170 respectively.

Table 3: Signals received from Express AM22 at 53°E ment and tested it in the shop for a day. It was fine. But ten minutes after the cus- Frequency/po! SR FEC Service tomer collected it he phoned to say that the picture was still breaking up. So the 10-978GHz/H 8,888 3/4 SGU TV1 and TV2. See Photos 10, 11 aerial installer was asked back to recheck 11.081GHzN 3,750 3/4 Exatel tests, Ukrania I Mir the dish and LNB, which he said were fine. After more messing about I obtained Exatel at 11.081 GHz V. Strangely, the another digibox from Panasonic, but the

CTC T Y, main on-screen picture consisted of a tun- fault was still present. Yet another digibox ing menu from a Humax satellite receiver, was obtained from Panasonic. Each one BeukaHrie cry TB see Photo 7. It showed the signal strength worked all right at the shop, but not at the of the downlinked signal, though the customer's house. B0306HOBNTCSI 16.03.04 polarisation was given as horizontal I then lent the customer two stock instead of the correct vertical! After a Panasonic digiboxes, a TU-DSB30 and a B 9.00 MCK CO CrlyTHOKOB period the transmission changed to a TU-DSB35. The former worked perfectly «3Kcnpecc-AM22» Russian channel called KRT, see Photo 8, at the customer's house but the DSB35, complete with hum bars and with no which looks the same as the DSB31, pro- «Aman-201» sound. After a few hours the tests stopped, duced break up. but several days later a channel called The customer decided to phone Sky for Ukrania I Mir started to be transmitted, advice, and was told to switch the output with the same signal characteristics. See from ROB to PAL. Much to my and his Photo 9. Table 3 shows the signals amazement, this cured the break-up prob- Photo 10: SGU TV1 from Express AM22. received to date. H.C. lem. But he had just bought an expensive 32in. set, and wanted the better picture Panasonic TU-DSB31 quality that ROB output provides. The customer complained about picture By now I could see that this was a fac- break up. When I ran his digibox in the tory problem, and that no matter how workshop for a couple of days it was OK, many new DSB31 or DSB35 digiboxes but the picture break up started again as were tried the problem would remain. I soon as it was returned. In view of this I managed to speak to the Panasonic service advised him to get the LNB checked. He manager in the workshop. He confirmed did so, and in fact had the LNB and cable that there was a design fault, and said that run replaced. But the fault remained. So there was nothing Panasonic or I could do. the digibox came back to the workshop, He suggested replacing the DSB31 with where again it worked correctly. I suggest- the later DSB50 model, to which I agreed, ed sending the digibox back to Panasonic, but later came back to say that his boss which runs an exchange scheme — you had vetoed this and all he could do was to never get the same box back, which is refund the money I had paid for the Photo 11: SGU TV2 from Express AM22. handy if there's a nasty intermittent fault. exchange. I eventually managed to get a replace- By now the customer was getting really

June 2004 TELEVISION angry. So I gave him the Panasonic ser- Replace this inductor. vice manager's phone number to see if he A leaded component has been used here instead of an SMD could sort the problem out. When the cus- tomer reported back to me the bottom line was that Panasonic knew about the prob- lem but was not prepared to provide a newer replacement model. At least the customer knew that it wasn't my fault! I then spoke to John Glenton at MCES about the problem. He said they had come up with a modification to cure it, and that if I sent him the tuner he would carry out the modification. I couldn't for the life of Remove this chip Replace the me see how a modification to the tuner Ul, CSP1034A1-IJ DSP1670TV7 modem microchip U7 would cure picture break up in the ROB Fig. 1: Wcrk required on a lightning-damaged Grundig GDS series modem PCB to mode but, clutching at any straw, I decid- restore digibox operation without the interactive facility. ed to give it a go. When the tuner came back I fitted it and let the customer try the MCES on 0161 746 8037, or alternatively get the modem board up and running so that box. A couple of days later, to my amaze- email [email protected] M.D. the box will work though the modem side is ment, he said that the fault had been dead. First replace the DSP1670TV7 cured. Grundig GDS series modem board modem microcontroller chip U7. Then According to John Glenton the current Vv lien the modem in one of these digibox- check the 100µH surface-mounted inductor drawn by the RGB output can affect the es has been affected by a lightning strike L5. If it's open-circuit, the CSP1034AH-J tuner, causing intermittent picture break the box will be stuck in standby with the line interface driver chip Ul is faulty. As up. I can only assume that the video out- red LED flashing. As the microcontroller this will no longer be required, remove it put chip and the tuner are fed from the chip has to communicate with the modem from the PCB. Replace L5 with virtually same supply line, and that this is how the before the box will come on, leaving the any RF choke that has a DC resistance of faults are related. Anyway the customer modem board out won't help. In my expe- about l I or less. Fig. 1 shows the work went away happy, more so because I had rience so much damage is caused to the required. repaired his digibox when Panasonic had line side that the modem board cannot be In 99 per cent of cases this action will told him that nothing could be done. But repaired economically. restore communication between the the credit has to go to John Glenton at All may not be lost however. Many cus- modem board and the main microcontroller MCES, without whose help repair would tomers don't use the interactive services chip, and the result will be a working digi- not have been possible. You can contact and, if these are not required, it's possible to box without interactive services. M.D.

Grandata Ltd f'3CrábatiCrr• e e a;

iin al Remote Control witti Menu t • op ïc ® cipth.) D eaur...-4 men tii) Opeset Ckfies , ui//ird) eMACi7 awoofl _LI I ?I, f ,nnyArkil/ iigl;L1

Order Code : R C81 Price : £ 35.00 + vat ( £ 3. 5 0 + vat each) carriage charged at £ 5.00 vat

z4. t•roke 850 W Electricity Generator Al most everything you

I Jetei0 6f:00)(pm:wee S i71 a 6;beeese ot 1.140Xleaw need for your business Oamealg u eemopeeCl 3 3.471Qw.DID1/ under one mouse a li/ t 5acatautfo 10@a1C3o2 M o ti f

Deegibmcil Ifteeton Doisetec9r CPC have over 100,000 top quality products online, 46.0 Homeo /232rom/i4j -ftwco ranging from spares and components to computing, Glo13- tY01.7.1, ,19.91, audio, video, cables, connectors, electrical, leles• 110 security components, tools, in the work place and ClO Ocoee:» &f,c..t1Dtl Order Code: G850 test equipment all available in just two clicks. Caocrtegaire Price: £ 100.00 + vat GàtbectE eilwy3 Carriage charged at £ 5.00 + vat

noxklo , P-.9p tri(...;9turesr ,_:1111 , , W9LriblY.y. hlldt1.19m2. HA) f).;-111 EiujhsnJ w w w.cpc.co.uk 4411r TC: (u2U) :3D0(J Frio (10.2(ti) ;_st11-:3 ;_5-12;:5- : i.-,1119-Don4jr-entkU.•teu.u.:t Sony KV29LS3OU PCB with the scart sockets against another All that happened when this set was module. This had worked — for about twen- switched on was that the standby LED start- ty minutes — then failed, leaving the cus- ed to flash. These sets are heavy beasts, and tomer £35 worse off and still with no I didn't relish the thought of having to take colour. it back to the workshop. Checks showed I took the set back to the workshop and that the HT supply came up when the set checked with the circuit diagram. Chroma was brought out of standby, but was low at and luminance separation, also input about 90V instead of 135V. I carry an oscil- switching, are carried out on the scan PCB. loscope in the car, and by checking at the I removed this PCB and looked for dry- collector of the line output transistor I could joints. There were several at the connectors see that all was not well. The most likely that plug into the main PCB, especially the suspect was the line output transformer. I one for chroma out. Resoldering provide a returned next day with a replacement and complete cure. Shame on that cowboy! fitted it. The set produced a good picture Incidentally our local main library has once the focus had been adjusted. all the U-View circuit books — it's where I found the circuit diagram for this set. Mitsubishi CT2125TX The complaint with this set was poor tele- Philips 20CT4636 text reception, especially BBC2 Ceefax. This elderly set appeared to be dead except Whenever I get one of these sets in I replace for a flash from the standby light. The cause all the electrolytic capacitors in the power turned out to be the TDA3576B timebase supply. Most of them were leaking. Once generator chip. I managed to obtain a replace- Service replacements had been fitted the set worked ment. which restored normal operation. very well — including BBC2 Ceefax. Finlandia C66HZ6 (Sabra M Casebook Matsui 32WN01 chassis) This set was actually badged Philips. So, This set was totally dead, with the mains when the customer phoned me up and told fuse blown and the chopper transistor short- me that it was dead apart from a flashing circuit. I found that the plastic holders Michael Maurice red light, I had an idea that the cause could which retain the degaussing coils and the be one of those little blue disc capacitors. Aquadag earthing braid had cracked. As a Unfortunately on test I found that the line result the braid had come off and shorted output transistor and transformer had both out the heatsinks. failed. I managed to obtain replacements I decided to take this set back to the next day and, once they had been fitted, I workshop, partly because it needed a ser- was rewarded with a good picture. vice and also because I feared that it might be a complicated repair. To start with I Toshiba 2939DB replaced the chopper transistor and the 15V l'his set had no sync. The cause turned out zener diode that's connected between its to be the clock crystal associated with the base and emitter. The replacements went text module, ZT01. A replacement cured short-circuit at switch on. I had to hunt the fault. round for someone who had an LF0070D hybrid chopper drive IC, but eventually Hitachi C1709T found one. I also replaced the small elec- The picture was very, very green. In fact trolytic capacitors on the primary side of there was simply no red or blue. The usual the power supply, and many on the sec- cause of loss of one or more colours is fail- ondary side. Fortunately the set then ure of the relevant BF459 RGB output tran- worked. sistors on the CRT base PCB. Not this time The pictures produced by these sets have however. After carrying out further checks, always been excellent. I wonder how many in the workshop, I came to the conclusion of today's sets will be working reliably that the cause of the fault lay in the with good CRTs in 13 years' time? TA8690AN jungle chip. A replacement confirmed this diagnosis. Panasonic TX25MDI (Euro 2 chassis) Toshiba 2505DB The customer complained that she couldn't I was told that there was intermittent loss of receive the 'cable channel', though she colour and found that there was a black- could with her portable TV set. It was an and-white picture. The set had received old analogue cable system, with the output attention from a local cowboy, who had from the terminal on ch. 52. The problem told the customer that there was a bad con- was that the set's tuner was failing. As I nection, probably broken print, and that carry these in stock it didn't take long to fit tracing it would be impossible. He had car- a replacement. A check with the customer ried out a makeshift repair by wedging the next day proved that all was well.

June 2004 TELEVISION To reserve your web site space telephone Tel: 01322 611289 Fax: 01322 616339 SERVICE E-MAILS [email protected]

Charles Hyde itt Son Ltd http://www.charleshyde.co.uk Search for both original and copy spare parts in our extensive database covering Akai, Alba, Bush, Ferguson, Goldstar, Hitachi, LG, Matsui, Nokia, Saisho, Sanyo, LIM Sony, Sharp, Thomson, Panasonic, Philips, I JIIII Samsung, Tascam, Teac, Toshiba, Yamaha and many more. In addition huge ranges of Lasers, Lopts, Remote controls and Semiconductors may be accessed.

A I L L Irwin Electronics Alban Electronics http://www.irwinelectronics.co.uk http://www.albanelectronics.co.uk As Classic Distributors we complement Alban stocks, supplies and provides our existing mail and trade counter technical support for a range of business with our website. You can terrestrial/cable/satellite and analogue/ order parts on-line quickly and easily. digital TV equipment. PROMAX We intend to explore alternative ways (manufacturers electronic test equipment of assisting engineers to run their including signal level meters, spectrum business successfully. analysers, BER/CSI/MER analysers for QPSK, QAM & COFDM, optical fibre light sources and power meters, 16:9 test Repairhelper's - Storefinder pattern generators), ALCAD (manufacturers UK of R.F. wide band and adjacent channel www.storefinder.repairhelper.co.uk amplifiers, aerials for MATV, SMATV & IRS systems) and ANTARES (cascadeable multi- We specialise in promoting electronic switches). ALBAN has a complete after repair services throughout the Internet. sales repair and calibration service that is It's a well known fact that the Internet is fully supported by the manufacturers, in the fastest growing advertising medium addition provides a free system design today but the majority of repair service using only reliable high quality companies and repair engineers are components not making use of the Internet to gain (AL um.a7n) more custom. Repairhelper's Storefinder is a UK Search Engine dedicated to the lam % Ma. electronic repair trade (i.e. TV, VCR, Swires Research DVD repair etc). Sign up with O.. var. Mom http://www.swires.com Repairhelper's Storefinder - you get ••• your own optimized pre-built web page Swires Research produce high quality t a m * . instruments for the television industry, 1.1101 M • •••••••••••• with a built-in online contact form and including portable signal level meters marry complete listings within the Repairhelper Network of sites. and spectrum analysers for digital and analogue RF signal measurements FreevIew

*Mal. INILTSGROVE LTD Wiltsgrove Alltrade Aerial & Satellite Ltd http://www.wiltsgrove.co.uk http://www.alltrade.co.uk WILTSGROVE LTD founded in 1984, is Leading distributor to the trade renowned as a leading supplier of Audio, Full e-commerce site with over 1500 products Video, TV, Spare parts and Accessories. with in-stock quantities!! We supply everything We are now pleased to announce the launch associated with Digital/Analogue Terrestrial of our ONLINE CATALOGUE: & DTH/Motorised Satellite reception. All Our easy to use search engine will allow you Antennas. All Brackets. All Cables. All to find the products you require via: • Make/Model. • Product Category. • Key Connectors. All Amplifiers. We provide a free Word search. • Manufacturers part number. • Our Order Code. MATV/SMATV planning service as well. All orders before 5pm will be dispatched the same day. Phone 0845 075 0751 Fax 0870 770 9151 TeL (0121) 772 2733 • Fax: (0121) 766 610• Email: [email protected]

TELEVISION June 2004 30 W HAT a LIFE!

From a pool-side idyll to a surprise interview, all in a day's work. Donald Bullock's servicing commentary

"Donald Bullock?" he asked t was good of the boys to pres- pared to go along. Then Gaffer sure me into having a day off. Unwin appeared. Another local. Gaffer. "You'm a joking" Gaffer Since it looked promising, I "Ha! Just phoned the shop" he I replied. decided to follow the quiet coun- exclaimed. "The boys said you I followed them in and hastily try lanes to the Haven Pool to were in the country, and I thought went through to the workshop, prepare my favourite tench swim 'yes, and I know were he gets. leaving Steven to book in their for the start of fishing next He won't mind a visit to the cot- sets. Moggy Morgan's was a month. It's a magical spot. There tage for a minute or two. 28in. widescreen Sharp set, were a few overhanging willows Ready? — Model 66GF63H (DA100 chas- to trim back, one or two water- I stared at them both. "Look, sis). "Crackle on the sound and lily roots to drag out and, to I'm off duty" I said, "why not no picture" he said. Paul immedi- make room for my rod, a few take your sets to the shop?" bank-side bulrush reeds to tether. The air seemed different when ately put it on the bench. To make it all enjoyable, the they'd departed. No more magic. Gaffer Unwin's set was a 32in. scent of wild roses filled the air. The soft mist had gone, also the widescreen Matsui model, fitted scent of wild roses. And the with the Grundig CUC2058 chas- Summer idyll doves, the coots and the dragon- sis. "Just before it died" he said, "it displayed a bowed picture". It promised to be a day of bliss. flies. I decided to return to work The sun smiled contentedly, and in the hope of being able to go The Western Gazette a gentle mist shrouded and soft- out again next day. ened the water. A pair of blue- The scruffy chap, taking it all in, powdered doves fluttered and Back at the shop wanted to get on. He addressed himself to Moggy Morgan. "Who cooed in a nearby beech tree, a Moggy Morgan and Gaffer flock of amorous coots twittered Unwin got there at the same time are you then, boy-oh?" he asked. and dived at the far end of the as I did. Both had brought along Moggy told him. He then turned to Gaffer pool, crickets chirped in the long enormous TV sets. I let them go Unwin. "You sure you're not old grass and dragon-flies hovered in first. Inside the shop the boys and darted over the lilies. I were talking to an extremely Mr Bullock?" he asked. "Quite certain" said Gaffer. plopped a handful of bread-paste scruffy-looking chap with a flash At that Steven called me out to nuggets into the water where my camera. He turned round and float would soon be. What heav- looked at us as we came in. introduce me to our scruffy en, I thought, what total tranquil- "Donald Bullock?" he asked caller. lity! There was never anything Moggy. "This is Scoop Spinner from the Western Gazette" he said, "he like the peace and solitude of the "Not me" Moggy answered. waterside to banish all thoughts of television — and the bores who pester those who carry its cross.

An interruption Then I heard the sound of feet tramping on the overgrown path. They drew nearer. It was old Moggy Morgan, who farms near- by. "Ah, Donald" he wheezed, "just the chap! That set you fixed the other month. Still playing up, you know. My missus reckons that the picture slips from corner to corner, and the sound sort of races. But 'er's been under the old Quack, like. Keeps on com- plaining though. Pop over to the house for me, will you?" I screwed my face up and pre-

504 June 2004 TELEVISION wants to interview you on your Dodgeworth, then arrived with a ter with a lady's handwriting. lifetime in the television trade." 28in. widescreen set. "It's a Smells nice and scenty ...." "Ello, Mr Bullock!" said Scoop, Lecron, Mr Bullock" he said. By the time he had gone on his "that's it, we're doing a series "A what-ron?" I asked.' way Paul had got Gaffer Unwin's featuring old-established local "A Lecron" he replied, "Model Matsui back in working order. businesses. Do you know that CTV900W it says on the back. The cause of the dead-set symp- yours is by far the oldest-estab- It's dead. Belongs to my cousin, tom was similar to that with the lished local TV firm?" Mrs Woodward, who got it from Lecron. The 1.6A fuse Si60001 Debenhams with the insurance had blown, the IRFPC50 chopper A hectic time she received after she put her MOSFET T60006 was short-cir- As he spoke the Reverend Goode husband away. Did you know cuit, also the TDA4605-3 control came in with his curate, who was him?" chip. In addition resistor R60001 carrying an Awai XR-MDS7EZ I shook my head. had risen in value from 2701d2 to hi-fi unit. Oh, a real beast he was" contin- over 550k Q. "Greetings, Donald" the ued Roger, "a real beast. Why he Once these items had been Reverend boomed. "Do be the replaced he investigated the EW angel you are and have a look at "Look Roger" I interrupted, fault. There was a short-circuit my verger's gramophone thing, "it's a bit hectic here at present. modulator diode, D53072, and will you? His wife is suffering Can we talk about the set?" the 4.7Q safety feed resistor from severe toothache." "One day she refused him a R55006 was open-circuit. After Greeneyes then brought in the Woodbine" Roger continued, fitting replacements he'd tested tea, and Paul announced his find- "and he walked out. Bought a the set. To his relief it crackled to ings after dealing with Moggy's toffee 'ammer, went home and life and produced excellent Sharp set. On test the set had dis- gave her an 'ammering!" results. played a faint blank raster with Steven was looking at the flyback lines, and there had been Reverend's Awai hi-fi unit while The interview a crackle with the sound. The Paul was attending to Gaffer Scoop, who was getting impa- cause of the former fault had Unwin's Matsui TV, so I decided tient and was a bit confused been Q912, a BC337-40 transis- to take a look at the Lecron. about what was going on, tor on the tube base panel. Its We'd no data on it, and I could- gnawed at his pencil and darted base-emitter junction was open- n't identify the chassis, but his eyes about. He decided to set- circuit and, as a result, the checks in the power supply tle on the Reverend. TEA5101A RGB output chip had revealed a blown fuse, a short- "Paul" he said, "was there ITV no 12V supply at pin 2. The circuit BUZ90A MOSFET, desig- when . ." crackle had been from the front nated T602, and a similarly "That's Paul there" the centre speaker. Replacement of shorted TDA4605-2 chopper Reverend said. the TDA7480 centre audio output control chip. I fitted replace- Scoop turned on his feet and chip IC1302, the BA4558F driver ments, then checked for any saw Greeneyes. "Er, Mrs chip IC1300 and three associated other shorts. Not finding any, I Catmore ..." he began. electrolytics on the centre-speak- switched the set on. The fuse Greeneyes sighed loudly and left er PCB had cleared the crackle. blew at once. Further investiga- the room. Some resoldering was also tion revealed that the degaussing At that Steven decided to inter- required. After that the set posistor was virtually short-cir- vene. "Look Scoop" he said as worked well. cuit when cold. Once I'd he pointed to everyone in turn, Scoop Spinner, who was paying replaced this item the set worked "this is Paul, I'm Steven, the attention to everything, was normally. The picture was OK, gentlemen with the white collars beginning to look bewildered. and the sound particularly good. are the Reverend Goode and his Mrs Catmore, accompanied by curate, George the postman her unruly kids, then came in to Progress brought the letters, and Moggie buy a battery. The eldest had a As I was boxing the set up Morgan, Gaffer Unwin and sticky toffee-apple which he Steven mentioned that he'd Roger Dodgeworth brought their waved about, the youngest pulled found the cause of the trouble sets in for attention. And this is the telephone off the counter with the Awai hi-fi unit. There my father Donald, who you came while the other one spun the bat- had been an open-circuit fusible to see. Mrs Catmore left with her tery carousel around so that it link, PRO01, in the supply to the little ones after buying a battery, collapsed and scattered batteries display. It worked correctly when and you're Scoop Spinner of the all over the floor. this had been replaced. Western Gazette. "Was a marrer with you lot?" Then George the postman came "Oh right, Donald" Scoop Mrs Catmore shouted, "I can't in with our mail. "Nothing too replied, "tell you what. Things take yous nowhere, can I?" worryin" he commented, "a can be a bit hectic here, can't packet from SEME, your water they? I'll go back to the office A Lecron rates, a letter from the telephone and we'll finish the interview on A further visitor, Roger people, a few bills and a nice let- the phone, if that's OK." •

TELEVISION June 2004 505 Taxan 7D16 (Model the main PCB were Samsung branded. The soldering was absolutely appalling! ThisEV735TC099) 17in. monitor powered up with the Apart from the loose signal connector at green LED lit but there was no display at the back of the board, almost every in-line 1 set of three or more pins had at least the all. Checks showed that the EHT was cor- rect but the Al /G2 voltage was only 1.4V. first signs of fracture rings forming around This model uses electrical adjustment of the solder fillets. Some of the ones in the Al /G2 voltage rather than the usual which the solder still had some malleability control on the LOPT. Checks in the rele- were beginning to pull through. Inspection vant circuitry showed that R255 and R256 was hindered by residues of whatever had (both 4701Q, 0.5W) were open-circuit. been used to deflux the PCB, and this They form a potential divider for the 1-1kV seemed to be resistant to most types of sol- supply developed by the LOPT for the vent. The only thing I could find that Al/G2 feed. G.M. would clean it off was a steel wire brush! A further problem was the remnants of Elonex MN034P pre-cropped leads that were hidden in the The complaint with this monitor was insta- solder fillets. The component leads had bility as the width was adjusted. It seemed evidently been cropped prior to flow-sol- to be caused by a glitch in the B+ PWM dering and many of the shorter leads, such regulator's voltage feedback loop from the as those of ICs, had incompletely cropped line output transformer. The effect was like bits hanging by a sliver as they went into a step on the width of the raster. With width the soldering dip. These incompletely sev- adjustment this step would diminish to a ered clippings hide in the solder, waiting to single slightly longer line that stuck out at cause shorts when the soldering is each side of the raster. The effect would reworked. Careful cleaning and inspection MONITORS disappear altogether when the width control with a magnifier is essential. Even when was rotated farther. the PCB has been scrubbed with a steel Fault reports from As no cause could be found, I had to wire brush flux residues survive in small assume that a servo-loop glitch had pro- clumps between close-spaced pins. This Gerry Mumford duced a visible effect because of compo- adds to the difficulty in spotting stray clip- nent-value drift. The solution seemed to be pings. The best approach is to have a and to increase the width by means other than scalpel at the ready while the PCB is under the magnifier so that any remaining con- Ian Field the front control. As various combinations of adjustment seemed to be able to increase taminants can be dug out. the width without moving the point of insta- After doing all this I found that the bility, I decided to try increasing the value monitor still failed to power up when of the flyback tuning capacitor. The original reassembled. To cut a long story short, value was 4.3nF (1.6kV). The maximum there was no voltage at pin 7 (supply) of limit seems to be 6-8nF with this chassis. If the KA3842 chopper control chip. Cutting the value is increased too far the flyback pin 7 restored the supply, which proved slows down, the result being foldover at the that the IC was faulty rather than the start- left-hand edge, with the line output transis- up resistors or the circuitry that cuts them tor showing no sign of distress. off when the power supply gets going. With other monitors a more likely result Once a replacement had been fitted the would be line output transistor overheating monitor powered up — and produced errat- and, in extreme cases, distortion of the for- ic, flickering colours! When I removed the ward-scan linear ramp. In such a case the CRT base screen I found that the soldering top of the linear ramp begins to flatten, pro- here was every bit as bad as on the main We welcome fault reports from readers ducing a cramped right-hand edge of the PCB. All three power transistors had at — payment for each fault is made after display. It seems that the 2SC5148 transis- least one leg detached, with signs of arcing. publication. tor used in this chassis has enough spare Although I remain uncertain about the capacity to provide increased collector cur- identification of this particular chassis, it's Reports can be sent by post to: rent! I.F. one I've seen from time to time and I should point out that this example was the Television Magazine Fault Reports, Dell Ultrascan P1428E worst I've ever come across. Normally the These monitors usually contain a Samsung cause of the reported fault consists of a Highbury Business, chassis, which is what I was expecting. The moderate number of dry-joints and/or one Media House, Samsung version seldom gives trouble but or two faulty electrolytics. But this one had Azalea Drive, Swanley, suffers from dry-joints, often with fairly been "run into the ground" before its owner Kent BR8 8HU alarming symptoms. So repair always decided to have it serviced. Judging by the begins with removal of the chassis and a burn marks around the video output transis- check on the soldering. When I got to this tors, the monitor must have remained in or e-mailed to: point I realised that the chassis was proba- use for a considerable time after it had [email protected] bly the similar-looking Hyundai one. There become obvious that faults were develop- was a Toshiba instead of the usual ing, and had been taken out of service only Samsung CRT, and only two of the ICs on when it refused to work at all! I.F.

June 2004 TELEVISION Solution to Test Case 498 TELEVISION INDEX & DIRECTORY 2004 - see page 489 —

Cathode Ray had done most of the right things in trying Plus hard-copy index and reprints service to diagnose the cause of the fault with this kamikaze Philips TV set. Maybe he would have eventually got to Here's the essential repair information you need! The the bottom of the trouble had he worked through the Television Index & Directory 2004, in CD-ROM form, contains suggestions in the Philips service manual. The guide it the text of over 15,000 high quality fault reports on TVs, VCRs, provides is commendable, and is something that very few Camcorders, DVD players, Monitors, Satellite TV units, Audio other manufacturers take the trouble to include, though equipment and CD players, searchable by make and model, the credit is somewhat dimmed by the tendency of this plus the text of 200 Test Cases and over 250 major servicing switch-mode power-supply design to self-destruct in the articles, from sixteen years of Television magazine. It also manner described. contains a full sixteen-year index of Television, a Spares Anyway Sage knew, and perhaps Ray should have Guide, a directory of Trade and Professional Organisations, an known or found out, that the fault is by no means International TV Standards guide, a satellite TV Channel unknown with this and similar chassis in the MD1 series, Finder, a TV transmitter list and a compendium of internet and that a kit of parts is available from Philips to cure it. resources for service engineers. The software is quick and Its name is ES7056, the part number being 4822 310 easy to use, and runs on any PC with Windows 95, 98, ME, NT, 32259, and the cost is about £14. It contains no fewer XP or 2000. than fourteen components, not all of which will be required for the particular version of the chassis. In Philips' own words, "mutual influences caused by Television Index & Directory 2004 CD-ROM, £199 the failure of one part are possible". Ray had another way of putting it, but nevertheless fitting all the relevant bits in Television Index & Directory 2004 CD-ROM upgrade, £46 (to the repair kit, including the items Ray had already qualify for this upgrade you need to have purchased a replaced, did the trick. It was a bit of an anticlimax for the previous version of the Television Index on floppy disk or on entire staff of the service department, who had gathered CD-ROM) around the bench at switch on, when the EHT rustled up followed by the sight and sound of the lovely Lorraine A six-month update of the index and fault reports will be avail- Kelley, the apple of Sage's eye. able in May 2004. If you wish to take advantage of this, £10 should be added to your order.

NEXT MONTH IN TELEVISION Television Index only, 1988-2003, £36 Television Index only upgrade from previous versions, £18 A microcontroller-based CCTV switching system Hard-copy indexes of Television magazine are available for John Young describes a microcontroller-based video Volumes 38 (1988) to 53 (2003) at £3.50 per volume. switching system which is used with four CCTV security cameras. These monitor activity in and around Reprints of articles from Television back to 1988 are also a garage that's sixty yards from the house, so a method available, at the flat rate of £4.00 per article — you can order of transmitting video signals is required. The through our web site, or write to the address below. microcontroller switches from camera to camera every three seconds — the PIR sensors are not triggered. The above prices include UK postage and VAT where applicable. Add an extra £1 postage for non-UK EC orders, or Freeview tryout £5 for non-EC overseas orders, although Channel Island Ray Porter's installation of a Freeview box was not residents do not need to add any extra postage. Cheques without its problems, especially as the local signal should be made payable to SoftCopy Ltd. All major credit and conditions are not ideal. After some experimentation debit cards are accepted. Please use our new secure website satisfactory reception of most multiplexes was obtained. for your orders, details below. Allow up to 28 days for delivery (UK). An aerial for DAB reception DAB reception via a receiver's vertical whip aerial SoftCopy Limited, 1 Vineries Close, Cheltenham, turned out to be very unsatisfactory, so K. Rutherford set GL53 ONU, UK about making a properly-proportioned dipole that was mounted in the loft and coupled to the receiver via the domestic signal-distribution system. The result was Telephone 01242 241 455 Fax 01242 241 468 good, error-free reception in all rooms. e-mail: [email protected] PLUS ALL THE REGULAR FEATURES web site: http://wvvw.televisionmag.co.uk

Published on the third Wednesday of each month by Highbury Business, Media House, Azalea Drive, Swanley, Kent, BR8 8HU. Highbury Business is a division of Highbury House Communications PLC. Filmsetting by Impress. Unit 2, Parkway, Southgate Way, Orton Southgate, Peterborough PE2 6YN. Printed in Eng- land by Polestar (Colchester) Ltd., Newcomen Way, SeveralIs Industrial Park, Colchester, Essex CO4 4TG. Distributed by Seymour Distribution Ltd, 86 Newman St, London, WIT 3EX. Sole Agents for Australia and New Zealand, Gordon and Gotch (Asia) Ltd.; South Africa, Central News Agency Ltd. Television is sold subject to the following conditions, namely that it shall not, without the written consent of the Publishers first having been given, be lent, resold, hired out or otherwise disposed by way of Trade at more than the recommended selling price shown on the cover, excluding Eire where the selling price is subject to currency exchange fluctuations and VAT, and that it shall not be lent, resold, hired or otherwise disposed of in a mutilated condition or in any unauthorised cover by way of Trade or affixed to or as part of any publication or advertising, literary or pictorial matter whatsoever.

Television June 2004 507 TUBES FOR Tuner Repairs SANYO SETS IC Filling Service 414 010 7100 W66ESF NE W £125.00 Digital Are you paying more? sel lop box repairs LOADS MORE TYPES IN STOCK For more information and latest prices CONTACT See our web site D'Lec Components Ltd 3 Manor Court, Sole Street, www.mces.co.uk Cobham, Kent DA13 9BU

Tel 01474 361276 MC ES Di ital

Fax 01474 335228 15 Lostock Road Davyhulme Manchester M41 OES E-mail: [email protected] E-mail: [email protected] Visit www.dlec.co.uk Phone: 0161 746 8037 Fax: 0161 746 8136

ONLINE SHOPPING CHEAPER AND EASIER DIgl R e p airs I I www.elclondon.co.uk TRADE REPAIR TV, VIDEO SPARES AND ELECTRICAL ITEMS SERVICE FOR THE sky UK & EIRE Are you looking for a reliable company to repair your sky digiboxes? We offer FREE SAMEDAY Collection when you send more than one box for repair! • FIXED PRICES Pace, Grundig. Amstrad Fixed price £38 + VAT includes return delivery Panasonic, Sony Fixed price £55 + VAT includes return delivery Sky + (Standard repair) Fixed price £45 + VAT includes return delivery (Hard Drive replacement) Fixed price £75 + VAT includes return delivery • Prices include all faults Micro processor. Modem, Software corruption and BGA replacement. Send more than one box at a time we collect for FREE • Specialists in the repair of Amstrad & Sony digiboxes

• Refurbished digiboxes for sale. • Fast Turnaround Time.

• All repairs fully guaranteed.

• Collection arranged from anywhere in the United Kingdom and Eire.

• Authorised Sky Digital Repair Centre. Receive our latest Satellite and technical newsletter FREE through email. Just send us an email with Newsletter in the Subject title to: [email protected] ELC EAST LONDON COMPONENTS Contact: DIGI RE P AIRS (UK 8, Ireland) 63 PLASHET GROVE, LONDON E6 IAD. UNIT 25, EN NIS KILLE N BUSINESS CE NT RE TWO MINUTES WALK FROM UPTON PARK TUBE STATION TE M P O RO A D, EN NIS KILLE N BT74 4RL TEL: 02866327293 (NATIO N AL RATE) TEL: 020 8472 4871 FAX: 020 8503 5926 0845 6441628 (LO C AL RATE) E-mail: [email protected] E mail: info edigirepairs.co.uk

June 2004 TELEVISION WHETHER ELECTRONICS IS YOUR HOBBY OR YOUR LIVELIHOOD ... YOU NEED THE MODERN ELECTRONICS MANUAL and the ELECTRONICS SERVICE MANUAL

THE MODERN ELECTRONICS MANUAL (CD-ROM VERSION ONLY)

The essential reference work for everyone studying electronics

• Over 800 pages • In-depth theory • Projects to build • Detailed assembly instructions • Full components checklists • Extensive data tables • Manufacturers' web links • Easy-to-use Adobe Acrobat format • Clear and simple layout • Comprehensive subject range • Professionally written • Supplements EVERYTHING YOU NEED TO GET STARTED AND GO FURTHER IN ELECTRONICS!

The revised CD-ROM edition of the Modern Electronics Base a computer interface, measuring instruments, workshop Manual (MEM) contains practical, easy-to-follow information on the equipment, security systems, medical and musical circuits, etc. following subjects: The Base Manual describes 12 projects including a Theremin and a Simple TENS Unit. BASIC PRINCIPLES: Electronic Components and their Characteristics (16 sections from Resistors and Potentiometers to ESSENTIAL DATA: Extensive tables on diodes, transistors, Crystals, Crystal Modules and Resonators); Circuits Using Passive thyristors and triacs, digital and linear i.c.s. Components (10 sections); Power Supplies; The Amateur Electronics Workshop; The Uses of Semiconductors; Digital EXTENSIVE GLOSSARY: Should you come across a technical Electronics (6 sections); Operational Amplifiers; Introduction to word, phrase or abbreviation you're not familiar with, simply look Physics, including practical experiments; Semiconductors up the glossary included in the Manual and you'll find a (5 sections) and Digital Instruments (3 sections). comprehensive definition in plain English.

CIRCUITS TO BUILD: There's nothing to beat the satisfaction of The Manual also covers Safety and provides web links to creating your own projects. From basic principles, like soldering component and equipment Manufacturers and Suppliers and making printed circuit boards, to the tools needed for The most comprehensive reference work ever produced at a price circuit-building, the Modern Electronics Manual and its you can afford, the CD-ROM edition of THE MODERN Supplements describe clearly, with appropriate diagrams, how to ELECTRONICS MANUAL provides you with all the essential assemble a radio, loudspeaker circuits, amplifiers, car projects, information you need.

THE MODERN ELECTRONICS MANUAL (MEM — CD-ROM version only) Revised CD-ROM Edition of Basic Work: Contains over 800 pages of information in Adobe Acrobat format. Edited by John Becker. Supplements: Additional CD-ROMs each containing approximately 500 pages of additional information on specific areas of electronics are available for £19.95 each. Information on the availability and content of each Supplement CD-ROM will be sent to you. Presentation: CD-ROM suitable for any modern PC. Requires Adobe Acrobat Reader which is included on the MEM CD-ROM. Price of the Basic Work: £29.95 POST FREE.

ORDER BOTH MANUALS TOGETHER AND SAVE £10 A mass of well-organised and clearly explained information is brought to you by expert editorial teams whose combined experience ensures the widest coverage Supplements to these unique publications, keep you abreast of the latest technology and techniques if required ELECTRONICS SERVICE MANUAL (CD-ROM VERSION ONLY)

EVERYTHING YOU NEED TO KNO W TO GET STARTED IN The essential work for REPAIRING AND SERVICING ELECTRONIC EQUIPMENT servicing and repairing SAFETY: Be knowledgeable about Safety Regulations, Electrical Safety and First Aid. electronic equipment UNDERPINNING KNOWLEDGE: Specific sections enable you to Understand Electrical • Around 900 pages and Electronic Principles, Active and Passive Components, Circuit Diagrams, Circuit Measurements, Radio, Computers, Valves and Manufacturers' Data, etc. • Fundamental principles • Troubleshooting techniques PRACTICAL SKILLS: Learn how to identify Electronic Components, Avoid Static • Servicing techniques Hazards, Carry Out Soldering and Wiring, Remove and Replace Components. • Choosing and using test TEST EQUIPMENT: How to Choose and Use Test Equipment, Assemble a Toolkit, Set equipment Up a Workshop, and Get the Most from Your Multimeter and Oscilloscope, etc. • Reference data SERVICING TECHNIQUES: The Manual includes vital guidelines on how to Service • Manufacturers' web links Audio Amplifiers. The Supplements include similar guidelines for Radio Receivers, TV • Easy-to-use Adobe Acrobat format Receivers, Cassette Recorders, Video Recorders, Personal Computers, etc. • Clear and simple layout TECHNICAL NOTES: Commencing with the IBM PC, this section and the Supplements • Vital safety precautions deal with a very wide range of specific types of equipment — radios, lys, cassette • Professionally written recorders, amplifiers, video recorders etc.. • Supplements REFERENCE DATA: Detailing vital parameters for Diodes, Small-Signal Transistors, Power Transistors, Thyristors, Triacs and Field Effect Transistors. Supplements include Operational Amplifiers, Logic Circuits, Optoelectronic Devices, etc. ELECTRONICS SERVICE MANUAL (ESM - CD-ROM version only) Basic Work: Contains around 900 pages of information. Edited by Mike Tooley BA Supplements: Additional CD-ROMs each containing approximately 500 pages of additional information on specific areas of electronics are available for £19.95 each. Information on the availability and content of each Supplement CD-ROM will be sent to you. Presentation: CD-ROM suitable for any modern PC. Requires Adobe Acrobat Reade which is included on the ESM CD-ROM. Price of the Basic Work: £29.95 POST FREE

LP ü SPECIAL OFFER -

£ 1 OFF Buy both Manuals together and save £10.

PLUS FREE POSTAGE TO ANY WHERE IN THE WORLD (We use the VAT portion of the price to pay for overseas AIR MAIL postage)

,Fcrircr, LPIT_PIP M2.5:)1['1,':, ,Pfirc11201C_P, Lfc-IPP_PLIUPP

Wimborne Publishing Ltd.. Dept D6, 408 Wimborne Road East. Ferndown. Dorset BH22 9ND. Tel: 01202 873872. Fax: 01202 874562. Online shop: www.epemag.wimborne.co.uk/shopdoor.htm r PLEASE send rne VISA El go lc ORDER FORM E THE MODERN ELECTRONICS MANUAL (CD-ROM version only) a Simply complete and return the order III ELECTRONICS SERVICE MANUAL (CD-ROM version only) form with your payment to the I enclose payment of £29.95 (for one Manual) or £49.90 for both Manuals (saving £10 by ordering both together). following address:

FULL NAME Wimborne Publishing Ltd, (PLEASE PRINT) Dept. D6, ADDRESS 408 Wimborne Road East, Ferndown, POSTCODE Dorset BH22 9ND

SIGNATURE

111 I enclose cheque/PO in UK pounds payable to Wimborne Publishing Ltd. El Please charge my Visa/Mastercard/Amex/Diners Club/Switch Switch Issue No Your CD-ROM(s) will be posted to you by first class Card No mail or airmail within four working days of receipt of Valid From Expiry Date your order L Card Security Code (The last 3 digits on or just under the signature strip) conornic evmces 73 Oakenele_s_TF2 8WR Tel e• 11 (0)1952 273130 Fa ••4/ (0)1952 105178 TUBES a DIrlei,CDe ‘nee'' o liruDlOCtig3 oçg club NEW and GRADED CRTs

S E MIM CIDIVID U C T 011t S W66ESF002X From £100 eiffœr a de Air 0 0 0 *y ore,* of fronoInfora IC's Motion «rte. or vollvoloorto stookaill W66ECK001X From £100 Some suppliers Just won't help.We will We take your hassle work naally hard to find those difficult W66EGV023X From £70 parts - Just ask and let our no holds barred' enquiry hound work for you.( I i - - - cm wit ci 1 c) cs lc ti t t 11 c (--,- --, W76ESF031X From £180 s p ccicil offec.srs Burl lA e ,9__: each B U T1 1AF eejle.lb each W76EGV023X From £150 B U508 A Ig5 k.1..:› each Fully wired acart lead g '9 CI Sli g h t i 811C 0111 %I teni e nC e--- - 66EAK071X From £50 - - y o u Iiiici-»t b u y m ow «:. the w 0 81 1 `. B U208 A X 5 75p ea T. f..Z0,18 A X 5 99p ea B U508 A X 5 79p ea Lmjaa42 X 5 59p ea Quantity reductions 13U508 AF X 5 85p ea C N X132 A X 5 29eap B U508 D X 5 89p ea S2000 AF X 5 84p ea B U T11 A X 5 29p ea T D A3853 B X 5 55 1, ea B U T11 AF X 5 47p ea T D A3854 X 5 82p ea Other makes and sizes available Philips type 1.2 volt Back up battery X 5 59p ea Philips type 2.4 volt Back up battery X 5 120p ea Scart - Scart lead 1.5 m Fully wired X 2 59P ea Poaltor PT37,TH98009 (White) x 5 591D ea De-scratching service Thorn TX100 Chassis 110 DG R LOPTX each £11.24 Philips CP90 Chassis LOPTX each . II mac> % R I ire-,.1c cei»e->tif c>usr- Prices plus carriage and VAT srcalt.«- 11.2.r- aba.c.ss.:•y faill i»ei c ce 11-.1_ Reme mber £1.50 post & handling All major credit cards accepted EXPRESS TV SUPPLIES LTD lorlor.tooIesp o rto ccr..u k „,.• ell •••• • lort ',out on bob Ily ze.= , d, t.r.4 1 ,,c.u r e elys,= ..‹. % model,. video 'el. mode onbe•.LOPTI rtt The Mill, Mill Lane, catalogue out NOW Rugeley, Staffs WS15 2JVV 1f2Att)E @Ty cameras, monitas, switches quads, multiplexers, the lot. Tel: 01889 577600 Fax: 01889 575600

beel,104...;eworld TV AN D VIDE O LTD SPECIAL OFFER - FOR ONE MONTH ONLY! Just to name a few, for example: 14" TV/DVD Combi £40 14" Portable TV £25 Widescreen TV from only £70 Working box VCR £15 Minimum quantity 5 items Our prices are unbeatable try us!

t a i li » I Is t Ito ti I 1.., .1 I \Ili »MIA MI i Pr lff f•••...

See our new awesome web site. Just click on the wholesale link to view just a small sample of our stock. A WL

.10111111.millie S, Infennenon O M Mrs • 11111111111b http://www. tyrus.co.uk All prices are Exclusive of VAT BIR MINGHA M 208 Bromford Lane, Erdington, Birmingham B24 8DL Tel: 0121 327 3273 Fax: 0121 322 2011 011 LONDON 221 Kenton Road, Middlesex HA3 OHD im Tel: 020 8907 9387 PRESTON Unit 434 Ranglet Road, Walton Summit, Preston PR5 8AR Tel: 01772 316066

TELEVISION June 2004 509 WEB SITE ‘‘Ad WW.JOHNSRADIO-UK.COM WWW.JOHNSRADIO.COM WATCH SLIDES ON TV JOHNSRADIO ELECTRONICS TEST AND COMMUNICATION EOPT MAKE VIDEOS OF M ASSIVE 10,000 SQ FT YOUR SLIDES W AREHOUSE CLEARANCE SALE DC-MICRO WAVE TO 300 GHZ - OPTICAL - LIGHT - EQPT - PARTS DIGITISE YOUR TEKTR O NIX - HP - AGILENT - MARC O NI SLIDES PHILIPS - RACAL - B&K - R&S - W& G - ETC Sales Warehouse, Johnsradio, Smithies Mill, Birstal Smithies Lights, 883-885 Bradford Rd, (using a video capture card) Batley, West Yorkshire, WFI 7 8NAI. Tel: 01924 442905 Fax: 01924 448170 E-mail: [email protected] "Liesgang diatv automatic slide viewer with built in high quality colour TV camera. It has Directions M62 Junction 27, A62 to Huddersfield, 1 mile to Birstal Smithies Lights, (6 roads) a composite video output to a phono plug (SCART & BNC adaptors are available). They left under fa:tory chimney aerial, Smithies Moor Lane 50 YDS second left red gate are in very good condition with few signs of use. For further details see www.diatv.co.uk HOURS M-F 9AM - 1PM AND 2PM - 5PM, SAT 9AM - 1PM £91.91+ vat = £108.00 Phone for appointment or to request item lists, photos, site map. Board cameras all with 512x582 pixels 8.5mm 1/3 inch sensor and composite video out. All welcome, Private or trade, for sales, workshop repairs or calibration. All need to be housed in your own enclosure and have fragile exposed surface mount PLEASE CONTACT PATRICIA AT WHITEHALLL WORKS, 84 WHITEHALL ROAD, parts. They all require a power supply of between 10 and 12v DC 150mA. EAST EIRKENSHAW, BRADFORD, WEST YORKSHIRE, BD11 2ER 47MIFI size 60x36x27mm with 6 infra red LEDs (gives the same illumination as a small torch but is not visible to the human eye) £37.00 + vat = £43.48 Tel: 01274 684007 Fax: 01274 651160 30MP size 32x32x14mm spy camera with a fixed focus pin hole lens for hiding behind a WEB SITE WWW.JOHNSRADIO-UK.COM WWW.JOHNSRADIO.COM very small hole £35.00 + vat = £41.13 40MC size 39x38x27mm camera for 'C mount lens these give a much sharper image than with the smaller lenses £32.00 + vat = £37.60 Economy C mount lenses all fixed focus & fixed iris VSL1220F 12mm F1.6 12x15 degrees viewing angle £15.97 + vat = £18.76 This Magazine reaches over VSL4022F 4mm F1.22 63x47 degrees viewing angle £17.65 + vat = £20.74 VSL6022F 6mm F1.22 42x32 degrees viewing angle £19.05 + vat = £22.38 VSL8020F 8mm F1.22 32x24 degrees viewing angle £19.90 + vat = £23.38 Better quality C Mount lenses .11 VSL1614F 16mm F1.6 30x24 degrees viewing angle £26.43 + vat = £31.06 1 0 0 0 0 VWL813M 8mm F1.3 with iris 56x42 degrees viewing angle £77.45 + vat = £91.00 1206 surface mount resistors E12 values 10 ohm to 1M ohm 100 of 1 value £1.00 + vat 1000 of 1 value £5.00 + vat potential custonle

866 battery pack originally intended to be used with an orbitel mobile telephone it contains 10 1.6Ah sub C batteries (42x22dia the size usually used in cordless screwdrivers etc.) To advertise in this s the pack is new and unused and can be broken open quite easily £7.46+vat = £8.77 c a I 1\11.71, \cb n Please add 1.66 + vat = £1.95 postage & packing per order JPG ELECTRONICS Shaws Row, Old Road, Chesterfield, S40 2RB Tel 01246 211202 Fax 01246 550959 MastercardNisaiSwitch 01322 611 289 Callers welcome 9:30 a.m .(o 5:30 p.m. Monday to Saturday 7 'e. '1,011°P

w w w.sdstrade.co.ulc

S k Y R a Z al FRESEVIEky W SPECIALISTS IN ALL MAKES AND reliability practicability professionality M ODELS OF SATELLITE EQUIP MENT

ALL ORDERS WELC O ME - LARGE OR SM ALL

REPAIRS FRO M ONLY £35 + VAT

SKY & SKY+ SPARES - MOST MAKES AND MODELS

NE W MODEL SKy+

eiell< 16-1 INCLUDING DELIVERY AND INSTALLATIO N KIT - E 199

HUNDREDS OF REFURBS AND NE W BOXES CALL FOR PRICES OR VISIT OUR WEB SITE Indispensable EXCLUSIVE lilt Multimetter fall Installer's TOOL THE ULTIMATE RANGE FIELD STRENGH METERS (FSM) TO SDS! , 3 or 5' TFT screen • Up to 4hours battery SILVER PACE 2200 DIGIB OXES • High resolution 0.1dB • Shock protection (rubber) I High accuracy +-10I3 MATV 8.-2SAT Quick menu keys CALL FOR TRADE PRICES I C/N measurement RS232 & Scan sockets 1 HO W AR D AVE N UE (analogue and digital measurements) 3 Easy and friendly to use B AR NST APLE DE V O N Televis U.K.LTD SDS EX3Z 8 0 A Satellite T 01633-375821 TEL: 01271 325888 e aur Digital Services F. 01633- 866311 eL) Televés F AX: 01271 329163 .Lketeleves.com televes com

510 June 2004 TELEVISION ••••• ' • •s• " -- -""-op " ...... -: ..- . _ -....;•• ril.,, • - -T..- _ • -7 ;. _ -:-. - - ar: '`-'• -.,Z:N., --.,:.-- - • - ; .• i v -....«- «UP '''.... ., - ;1 0 ... e r. 1 . . .«.--- - -.""1"..: rier,.- e _ • .- - _ - • . 3 «e r. . ZZ7 7;•ae-•" .1e 1. - " - er, '"r ' l..e. ; • „- .."....• .... • "•-•''.."' " - „ .0C - :i... e ir .,.c. a- - • .....4rwie, ""-- _b.f. - ...Ar • .1 . •"" -43' ,0 "‘Z >ye" - • . „ ••••••• - -4r. - el--- e: -_..; ---- ...... e. - . ;;¡,4,-.. -*ffite-*'es 9e. . •17 "7 . ••• - .„...rcr-.".1' --7....›,...... - 1,,,,e , , ....,.-,?...••!. - • r_--- _ -.'" - --....441ir gar 11" b.., r74., • - " %.er ".."Jirr.• •. . '84. '` ':à. .: - _;,-,. .r13.

_ • .

. - - efe

TELEVISION reader offer: Seen on sale for £20 each, these high- x 1 , x10 switchable quality oscilloscope probe sets comprise:

oscilloscope probes, • two xl, x10 switchable probe bodies • two insulating tips only £21.74 a pair, • two IC tips and two sprung hooks fully inclusive* • trimming tools There's also two BNC adaptors for using the *Additional pairs as part of the same orcer, orly cables as 1.5m-long BNC-to-BNC links. £19.24 each pair. Each probe has its own storage wallet. To order your pair of probes, send the Please supply the following: coupon together with £21.74 UK/Europe to Probes Probe Offer, Jackie Lowe, Highbury Business Communications, Anne T‘,1 l Boleyn House, 9-13 Ewell Road, Name Cheam, Surrey, SM3 8BZ

Address Readers outside Europe, please add £2.50 to your order.

Specifications

Switch position 1 Postcode Telephone Nandwidth DC to 10MHz Input resistance 1MS2 - i.e. oscilloscope i/p Method of payment (please circle) Input capacitance 40pF+oscilloscope capacitance \ Vorking voltage 600V DC or pk-pk AC Cheques should be made payable to TELEVISION Access/Mastercard/Visa/Cheque/PO Switch position 2 I iandwidth DC to 150MHz Rise time 2.4ns I iput resistance 10MQ ±1% if oscilloscope i/p is Credit card no I MQ Ilput capacitance 12pF if oscilloscope i/p is 20pF bmpensation range 10-60pF \ Vorking voltage 600V DC or pk-pk AC Card expiry date Signed Switch position 'Ref' Please allow up to 28 days for delivery l'robe tip grounded via 9MQ, scope i/p grounded CLASSIFIED TEL: 01322 611289 a. Tatung £239 LCD 15" PhilipsPhilips £299 £299 LCD LCD 17" 15" 171 HAREHILLS LANE, R eph p l o n y e : p ro jec t spa r e s@b t in teme t .com P RO JEC T SP AR E S Over R ECR U ITMENT Small Spare parts and service SERVICE DATA Tel: 0113 240 1114 Minimum of 3 years experience. Salary negotiable, dependent on CALL FOR FULL PRICE LIST * ELECTRON TECHNICAL video projectors fro m e xper ience a nd q ua l if ica t ions . VIDIKRON Stanford-Le-Hope requires a PROJECTOR Genuine help available to all LEEDS LS8 3QE 0906 470 1706 T.V. - V.C.R - SAT- AUDIO q ua l if i ed T V /VCRB ENCH /Aud / F io IELD Fax: 01444 831580 ELECTR1CS LIMITED Other models available Tel: 01444 831769 FOR SALE in 30 years experience and vast B ench /F ie ld E ng inee r . Calls cost family business, based near information for REQUIRED ENGINEER SPARES HELPLINE * Then ring the (Inc Valves) repairers of data base E- mail:

60p per 01375 640800 rtlInute

Service Link

VCRCTV Manualsfrom VCR ManualsCTV £14.50from Circuits0114 £10.50 from 285 £5.00 4254 e -ma iPayment l : c o l by in@f credit ryem s . f sbu card, s in e s PO s .cn or .uk cheque I User instructions also available

SERVICE DATA SERVICE DATA MANUAL COLLECTIONS PURCHASED. LIS Prices are from £5.50 + £2.75 P&P 4 0. CAMCORDERS, AUDIO & Sen tv/video remotes at competitive TELEPHONE 01322 611289 419 LANGSETT ROAD (P/P add £2.50 to each order) nut T CTV s/sheetVCR CTV C smn s/man VCR note: some itemsTV's, priced VCR's, individually SATELLITE SHEFFIELD S6 2LL TV - add a further £5.50 per item and Service Sheets for Ice we Circuits from £7.00 www .am t e l . co .uk Caithness . TEL A.T.V. on MANUALS Tel:Fax 01206 211570 II IS - Other items POA > 01955 611313 now supply universal SERVICE in the same order No VIDEO - AUDIO Marks Tey, Colchester Prices start AMTEL Fryerns (POST 1995) FAX 01322 616376 HI-FI's FES AUDIO OR MONITOR prices / a 10.00s/man p/p or VAT (WE DO NOT STOCK Huna, s/sheet TV/VCR CIRCUITS Easthorpe Green I N FORMA T ION ) 2 The Lodge WIK 4YL CO6 1HA

at

Diagram. Cut: ts, 13.00 - 7.005.00 Manual? Have you ever brought THE MANUALS LIBRARY HARVEY ELECTRONICS consultation on how a Service Manual and never For details and membership Have you ever turned away Tel/Fax No: 01291 623086 best to market your work for want of Visa: Mastercard accepted Chepstow, Mons, NP16 7HE used it more than once? MANUALS 43 Loop Road, Beachley, application form write, SERVICE p roduc ts /se rv ices Then why not join ... audience contact to a professional phone or fax: For a 611289 a Service 01322 LUKE on

FREE Service Link Tel: 01403 784961 FOR VALVES KT88, Ema i l : s a les@be l - tubes .co .uk PRI CES PAI D BEST H CAS PX4 AND MOST A UD IO /OTHER Visitors by appointment Billington Export Ltd WANTED Sussex RH149EZ Fax 01403 783519 TYPES. IS THIS THE END OF "BAD BACKS'P

www.advancedhandling.co.ukitylifting.htm

The LIFTM8Tm has revolutionized the way that I do business. I can now tackle lobs where I would have had to take a second man, saving me money every time I use it! It even gives me a stable working platform for repairing TV's in customers homes."

Mr Dobson - Shop Owner - North West

LIGHTWEIGHT UK SUCTION The LIFTM8 weighs less than 20KG's, is simple to move and transport, removable legs complete the package. Esy ROTATING SUCTION CUPS MRNIIIACTIMED ROTATION Simply rotate TV's through 90 degrees to fit through doorways with ease.

WINCH OPERATION CALL NOW Raise and lower the set using the marine quality winch lilted with a "memory tree" Kevlar rope.

01118 345305 MOBILE WORKBENCH Lay down the LIFTM8 and it becomes a mobile workbench.

advanced handling Northfields Industrial Estate, Market Deming, Peterborough, PE6 810 — Intelligent Handling Solutions Tel. 01178 345365 - Fax. 01778 341654 - sales a)advancedhandlin .co.0

Advanced Handling limited has been manufacturing materials handling equipment in the UK for the last 27 years. The LIFTM8 is the latest in a long line of intelligent handling solutions to be supplied to the UK electrical retail industry. TELEVISION TEST PATTERN GENERATORS P R O M A X The new GV 998 is a digital SELECTED ITEMS FROM THE PROMAX pattern generator offering more advanced features RANGE OF TEST EQUIPMENT at again a realistic price. Those features include :

• MPEG-2 format Transport Stream generation • Video and audio included in the TS • Video and audio inputs MS 250 • Generation of a variable frequency sound carrier for decoding verification Analogue and Digital Satellite Detector. • Multistandard and multisystem anal ague TV signal generation • Possibility to edit different fields of the TS database to present the name of the service provider

• Remote control via a personal computer ».1$ P R O NA A X • Moving video patterns to check MPEG-2 decoders

-so

PRODIG 1 Satellite Dish Installer's Meter Does more than just BSky13 1111111 E1 11

Chan 40 74.8 dBuV Chan 40 67.6 dBuV

PROMAX GV SERIES • Choice of 12 instruments • NICAM and Teletext • 4:3 and 16:9 Formats • Full field and VITS • Computer Controlled • Fro it panel memories • Own Company Logo • Computer Monitor testers Analogue & Digital Aerial Meter C/N • Hand Held Models Measures digital channel power and r. • Multi Standard, PAL, NTSC, SECA • High Quality Construction

• Attractive Price Levels 11•11 11 • Full After Sales Service •„, • Available from Stock •••• M eg 0 0 ...... MC 377+ Analogue & Digital, Satellite & Terrestrial

Me;1‘--wrn , cl-umno! newvf,r lnd C/N

....

e u. con

PROLINK 3 + 4 SERIES FOR TELEVISION PATTERN GENERATORS, A ;,,,,„ P R 0 N./1 AX Satellite & Terrestrial, Analogue & Digital, THERE'S NO WIDER CHOICE THAN WITH PROMAX L Spectrum Analyser with BER (optional on P3)

/4••.„.. PR ON./1A X

TELECOMMUNICATIONS Alban TEST EQUIPMENT AE 767 Spectrum Analyser

ITTIFII TI ALB AN ELECTR ONICS LIMITED

THE PROMAX SERVICE CENTRE ••••..• u• As

6 Caxton Centre, Porters Wood, St. Albans, Hertfordshire, AL3 6XT. 1

TEL: 01727 832266 FAX: 01727 810546 W E B : w w w.albanelectronics.co.uk 7 E M AIL: info ealbanelectronics.co.uk •

SALES + SE R VICE + CALIB R ATIO N